├── .acrolinx-config.edn ├── .ghal.rules.json ├── .gitattributes ├── .github ├── CODEOWNERS ├── ISSUE_TEMPLATE │ ├── doc-breaking-change.md │ ├── doc-issue.md │ └── docs-request.md ├── PULL_REQUEST_TEMPLATE.md ├── no-response.yml └── workflows │ └── markdownlint.yml ├── .gitignore ├── .markdownlint.json ├── .openpublishing.build.ps1 ├── .openpublishing.publish.config.json ├── .openpublishing.redirection.json ├── .vscode └── extensions.json ├── CODE_OF_CONDUCT.md ├── CONTRIBUTING.md ├── FETCH_HEAD ├── LICENSE ├── LICENSE-CODE ├── README.md ├── ThirdPartyNotices.md ├── _zip └── missingapi.yml ├── api └── index.md ├── appveyor.yml ├── cSpell.json ├── data-constraints ├── docfx.json ├── docs ├── architecture │ ├── blazor-for-web-forms-developers │ │ ├── app-startup.md │ │ ├── architecture-comparison.md │ │ ├── components.md │ │ ├── config.md │ │ ├── data.md │ │ ├── forms-validation.md │ │ ├── hosting-models.md │ │ ├── index.md │ │ ├── introduction.md │ │ ├── media │ │ │ ├── architecture-comparison │ │ │ │ ├── blazor-components-in-html.png │ │ │ │ └── blazor-dom-interaction.png │ │ │ ├── hosting-models │ │ │ │ ├── blazor-server.png │ │ │ │ └── blazor-webassembly.png │ │ │ ├── index │ │ │ │ └── blazor-for-web-forms-developers-cover.png │ │ │ └── middleware │ │ │ │ └── request-delegate-pipeline.png │ │ ├── middleware.md │ │ ├── migration.md │ │ ├── pages-routing-layouts.md │ │ ├── project-structure.md │ │ ├── security-authentication-authorization.md │ │ ├── state-management.md │ │ └── toc.yml │ ├── cloud-native │ │ ├── application-bundles.md │ │ ├── application-resiliency-patterns.md │ │ ├── authentication-authorization.md │ │ ├── azure-active-directory.md │ │ ├── azure-data-storage.md │ │ ├── azure-monitor.md │ │ ├── azure-security.md │ │ ├── candidate-apps.md │ │ ├── centralized-configuration.md │ │ ├── combine-containers-serverless-approaches.md │ │ ├── communication-patterns.md │ │ ├── data-patterns.md │ │ ├── definition.md │ │ ├── deploy-containers-azure.md │ │ ├── deploy-eshoponcontainers-azure.md │ │ ├── devops.md │ │ ├── distributed-data.md │ │ ├── front-end-communication.md │ │ ├── identity-server.md │ │ ├── identity.md │ │ ├── index.md │ │ ├── infrastructure-as-code.md │ │ ├── infrastructure-resiliency-azure.md │ │ ├── introduce-eshoponcontainers-reference-app.md │ │ ├── introduction.md │ │ ├── leverage-containers-orchestrators.md │ │ ├── leverage-serverless-functions.md │ │ ├── logging-with-elastic-stack.md │ │ ├── map-eshoponcontainers-azure-services.md │ │ ├── media │ │ │ ├── acr-runinstance-contextmenu.png │ │ │ ├── aggregator-microservice.png │ │ │ ├── aggregator-service.png │ │ │ ├── aks-cluster-autoscaler.png │ │ │ ├── aks-traffic-manager.png │ │ │ ├── always-encrypted.png │ │ │ ├── api-gateway-pattern.png │ │ │ ├── application-gateway-ingress-controller.png │ │ │ ├── application-types.png │ │ │ ├── azure-api-management.png │ │ │ ├── azure-dev-spaces-visual-studio-launchsettings.png │ │ │ ├── azure-devspaces-one.png │ │ │ ├── azure-devspaces-two.png │ │ │ ├── azure-event-hub.png │ │ │ ├── azure-monitor.png │ │ │ ├── azure-signalr-service.png │ │ │ ├── azure-sql-database-deployment-options.png │ │ │ ├── azure-table-api.png │ │ │ ├── backend-for-frontend-pattern.png │ │ │ ├── board-issue-types.png │ │ │ ├── breaking-up-monolith-with-backend-microservices.png │ │ │ ├── build-release-run-pipeline.png │ │ │ ├── caching-in-a-cloud-native-app.png │ │ │ ├── cap-theorem.png │ │ │ ├── centralized-logging.png │ │ │ ├── chaining-http-queries.png │ │ │ ├── check-rbac.png │ │ │ ├── checklist.png │ │ │ ├── circuit-breaker-pattern.png │ │ │ ├── cloud-native-design.png │ │ │ ├── cloud-native-foundational-pillars.png │ │ │ ├── cold-start-warm-start.png │ │ │ ├── command-interaction-with-queue.png │ │ │ ├── common-backing-services.png │ │ │ ├── containers-dashboard.png │ │ │ ├── containers-diagram.png │ │ │ ├── cosmos-db-consistency-levels.png │ │ │ ├── cosmos-db-entities.png │ │ │ ├── cosmos-db-overview.png │ │ │ ├── cosmos-db-partitioning.png │ │ │ ├── cosmos-db-providers.png │ │ │ ├── cosmos-encryption.png │ │ │ ├── cover.png │ │ │ ├── cqrs-implementation.png │ │ │ ├── create-container-registry.png │ │ │ ├── cross-service-query.png │ │ │ ├── data-across-microservices.png │ │ │ ├── devops-components.png │ │ │ ├── different-kinds-of-microservices.png │ │ │ ├── dir-struct.png │ │ │ ├── direct-client-to-service-communication.png │ │ │ ├── direct-http-communication.png │ │ │ ├── distributed-cloud-native-environment.png │ │ │ ├── docker-desktop-kubernetes.png │ │ │ ├── eshoponcontainers-architecture.png │ │ │ ├── eshoponcontainers-development-architecture.png │ │ │ ├── eshoponcontainers-helm-folder.png │ │ │ ├── eshoponcontainers-sample-app-screenshot.png │ │ │ ├── event-driven-messaging.png │ │ │ ├── event-grid-anatomy.png │ │ │ ├── event-hub-partitioning.png │ │ │ ├── grpc-project.png │ │ │ ├── grpc-usage.png │ │ │ ├── hosting-mulitple-containers.png │ │ │ ├── http-status-codes.png │ │ │ ├── istio-control-and-data-plane.png │ │ │ ├── kibana-dashboard.png │ │ │ ├── kubernetes-cluster-components.png │ │ │ ├── kubernetes-cluster-in-azure.png │ │ │ ├── materialized-view-pattern.png │ │ │ ├── microservices-vs-devops.png │ │ │ ├── monolithic-architecture.png │ │ │ ├── monolithic-design.png │ │ │ ├── monolithic-vs-microservices.png │ │ │ ├── polly-resiliency-framework.png │ │ │ ├── polyglot-data-persistence.png │ │ │ ├── projects-in-visual-studio-solution.png │ │ │ ├── rbac-role-definition.png │ │ │ ├── rbac-security-principal.png │ │ │ ├── release-pipeline.png │ │ │ ├── replicated-resources.png │ │ │ ├── request-reply-pattern.png │ │ │ ├── retry-pattern.png │ │ │ ├── saga-rollback-operation.png │ │ │ ├── saga-transaction-operation.png │ │ │ ├── scale-up-scale-out.png │ │ │ ├── service-bus-queue.png │ │ │ ├── service-mesh-with-side-car.png │ │ │ ├── single-monolithic-database.png │ │ │ ├── single-repository-vs-multiple.png │ │ │ ├── sprint-board.png │ │ │ ├── ssl-report.png │ │ │ ├── storage-queue-hierarchy.png │ │ │ ├── strategies-for-migrating-legacy-workloads.png │ │ │ ├── task-details.png │ │ │ ├── topic-architecture.png │ │ │ ├── virtual-network.png │ │ │ ├── visual-studio-2019-grpc-template.png │ │ │ ├── visual-studio-add-docker-support.png │ │ │ ├── visual-studio-add-orchestrator-support.png │ │ │ ├── visual-studio-docker-run-options.png │ │ │ ├── visual-studio-enable-docker-support.png │ │ │ └── what-container-orchestrators-do.png │ │ ├── monitoring-azure-kubernetes.md │ │ ├── monitoring-health.md │ │ ├── observability-patterns.md │ │ ├── other-deployment-options.md │ │ ├── resiliency.md │ │ ├── resilient-communications.md │ │ ├── rest-grpc.md │ │ ├── scale-applications.md │ │ ├── scale-containers-serverless.md │ │ ├── security.md │ │ ├── service-mesh-communication-infrastructure.md │ │ ├── service-to-service-communication.md │ │ └── toc.yml │ ├── containerized-lifecycle │ │ ├── Docker-application-lifecycle │ │ │ ├── containers-foundation-for-devops-collaboration.md │ │ │ ├── index.md │ │ │ └── media │ │ │ │ └── containers-foundation-for-devops-collaboration │ │ │ │ ├── generic-end-to-enddpcker-app-life-cycle.png │ │ │ │ └── persona-workloads-docker-container-lifecycle.png │ │ ├── Microsoft-platform-tools-containerized-apps │ │ │ ├── index.md │ │ │ └── media │ │ │ │ └── index │ │ │ │ └── microsoft-tools-contanerized-docker-app.png │ │ ├── design-develop-containerized-apps │ │ │ ├── build-aspnet-core-applications-linux-containers-aks-kubernetes.md │ │ │ ├── common-container-design-principles.md │ │ │ ├── deploy-azure-kubernetes-service.md │ │ │ ├── design-docker-applications.md │ │ │ ├── docker-apps-development-environment.md │ │ │ ├── docker-apps-inner-loop-workflow.md │ │ │ ├── index.md │ │ │ ├── media │ │ │ │ ├── add-docker-support-menu.png │ │ │ │ ├── add-docker-support-to-project.png │ │ │ │ ├── aks-cluster-view.png │ │ │ │ ├── aks-resource-group-view.png │ │ │ │ ├── az-cli-loginServer-name.png │ │ │ │ ├── create-aspnet-core-application.png │ │ │ │ ├── create-web-api-application.png │ │ │ │ ├── docker-apps-inner-loop-workflow │ │ │ │ │ ├── add-docker-files-to-workspace-command.PNG │ │ │ │ │ ├── inner-loop-development-context.png │ │ │ │ │ ├── install-docker-extension-vs-code.png │ │ │ │ │ ├── life-cycle-containerized-apps-docker-cli.png │ │ │ │ │ ├── results-docker-compose-up.png │ │ │ │ │ ├── run-docker-build-command.png │ │ │ │ │ ├── test-docker-app-locally-curl.png │ │ │ │ │ ├── test-docker-app-locally-localhost.png │ │ │ │ │ ├── view-existing-images-with-docker-images.png │ │ │ │ │ └── vm-with-docker-containers-deployed.png │ │ │ │ ├── docker-images-command.png │ │ │ │ ├── docker-support-solution-explorer.png │ │ │ │ ├── enable-docker-compose-support.png │ │ │ │ ├── enable-docker-support-visual-studio.png │ │ │ │ ├── get-credentials-command-result.png │ │ │ │ ├── getting-aks-credentials.png │ │ │ │ ├── kubectl-create-command.png │ │ │ │ ├── kubectl-get-nodes-command-result.png │ │ │ │ ├── kubernetes-cluster-information.png │ │ │ │ ├── loginServer-name.png │ │ │ │ ├── monolithic-applications │ │ │ │ │ ├── host-with-multiple-apps-containers.png │ │ │ │ │ ├── monolithic-application-architecture-example.png │ │ │ │ │ ├── multiple-hosts-from-single-docker-container.png │ │ │ │ │ └── publish-azure-app-service-container.png │ │ │ │ ├── orchestrate-high-scalability-availability │ │ │ │ │ ├── azure-kubernetes-service-logo.png │ │ │ │ │ ├── azure-service-fabric-business-microservice.png │ │ │ │ │ ├── azure-service-fabric-cluster-types.png │ │ │ │ │ ├── azure-service-fabric-logo.png │ │ │ │ │ ├── azure-service-fabric-mesh-logo.png │ │ │ │ │ ├── business-microservice-mapped-to-service-fabric-application.png │ │ │ │ │ ├── composed-docker-applications-cluster.png │ │ │ │ │ ├── deploy-microservice-containers-apps-service-fabric-mesh.png │ │ │ │ │ ├── kubernetes-cluster-simplified-structure.png │ │ │ │ │ ├── kubernetes-container-orchestration-system-logo.png │ │ │ │ │ ├── kubernetes-development-environment.png │ │ │ │ │ ├── orchestrator-selection-azure-guidance.png │ │ │ │ │ ├── service-fabric-stateful-business-microservice.png │ │ │ │ │ ├── stateless-vs-stateful-microservices.png │ │ │ │ │ └── use-multiple-spaces-azure-dev.png │ │ │ │ ├── select-linux-docker-support.png │ │ │ │ ├── select-release-mode.png │ │ │ │ ├── state-and-data-in-docker-applications │ │ │ │ │ └── container-based-application-external-data-sources.png │ │ │ │ ├── tagged-docker-images-list.png │ │ │ │ ├── uploading-docker-images-complete.png │ │ │ │ ├── uploading-image-to-acr.png │ │ │ │ └── visual-studio-docker-tools-options.png │ │ │ ├── monolithic-applications.md │ │ │ ├── orchestrate-high-scalability-availability.md │ │ │ ├── set-up-windows-containers-with-powershell.md │ │ │ ├── soa-applications.md │ │ │ ├── state-and-data-in-docker-applications.md │ │ │ └── visual-studio-tools-for-docker.md │ │ ├── docker-containers-images-and-registries.md │ │ ├── docker-devops-workflow │ │ │ ├── create-ci-cd-pipelines-azure-devops-services-aspnetcore-kubernetes.md │ │ │ ├── docker-application-outer-loop-devops-workflow.md │ │ │ ├── index.md │ │ │ └── media │ │ │ │ ├── build-ci-pipeline-azure-devops-push-to-docker-registry.png │ │ │ │ ├── docker-application-outer-loop-devops-workflow │ │ │ │ ├── add-deploy-to-kubernetes-task.png │ │ │ │ ├── add-tasks-docker-compose.png │ │ │ │ ├── cd-deploy-to-orchestrators.png │ │ │ │ ├── configure-docker-compose-release.png │ │ │ │ ├── continuous-integration-steps.png │ │ │ │ ├── deploy-app-containers-to-docker-host-environments.png │ │ │ │ ├── docker-ci-pipeline-azure-devops.png │ │ │ │ ├── docker-push-custom-images.png │ │ │ │ ├── edit-deploy-to-kubernetes-task.png │ │ │ │ ├── overview-dev-ops-outter-loop-workflow.png │ │ │ │ └── publish-custom-image-to-docker-registry.png │ │ │ │ ├── docker-workflow-ci-cd-aks.png │ │ │ │ └── release-cd-pipeline-azure-devops-deploy-to-kubernetes.png │ │ ├── docker-terminology.md │ │ ├── index.md │ │ ├── key-takeaways │ │ │ └── index.md │ │ ├── media │ │ │ ├── docker-containers-images-and-registries │ │ │ │ └── taxonomy-docker-terms-concepts.png │ │ │ ├── index │ │ │ │ └── multiple-containers-single-host.png │ │ │ └── what-is-docker │ │ │ │ ├── comparison-vms-docker-conatiners.png │ │ │ │ └── docker-containers-run-anywhere.png │ │ ├── road-to-modern-applications-based-on-containers.md │ │ ├── run-manage-monitor-docker-environments │ │ │ ├── index.md │ │ │ ├── manage-production-docker-environments.md │ │ │ ├── monitor-containerized-application-services.md │ │ │ └── run-microservices-based-applications-in-production.md │ │ ├── toc.yml │ │ └── what-is-docker.md │ ├── grpc-for-wcf-developers │ │ ├── appendix.md │ │ ├── application-performance-management.md │ │ ├── approach.md │ │ ├── call-credentials.md │ │ ├── channel-credentials.md │ │ ├── client-libraries.md │ │ ├── create-project.md │ │ ├── docker.md │ │ ├── encryption.md │ │ ├── error-handling.md │ │ ├── grpc-in-production.md │ │ ├── grpc-overview.md │ │ ├── index.md │ │ ├── interface-definition-language.md │ │ ├── introduction.md │ │ ├── kubernetes.md │ │ ├── load-balancing.md │ │ ├── media │ │ │ ├── application-performance-management │ │ │ │ └── grafana-screenshot.png │ │ │ ├── cover.png │ │ │ ├── create-project │ │ │ │ ├── configure-project.png │ │ │ │ ├── create-new-grpc-service.png │ │ │ │ └── new-grpc-project.png │ │ │ ├── kubernetes │ │ │ │ ├── enable-kubernetes-docker-desktop.png │ │ │ │ └── stockweb-screenshot.png │ │ │ ├── migrate-request-reply │ │ │ │ ├── add-connected-service.png │ │ │ │ └── add-new-grpc-service-reference.png │ │ │ └── service-mesh │ │ │ │ ├── linkerd-screenshot.png │ │ │ │ └── stockweb-servicemesh-screenshot.png │ │ ├── metadata.md │ │ ├── migrate-duplex-services.md │ │ ├── migrate-request-reply.md │ │ ├── migrate-wcf-to-grpc.md │ │ ├── network-protocols.md │ │ ├── protobuf-any-oneof.md │ │ ├── protobuf-data-types.md │ │ ├── protobuf-enums.md │ │ ├── protobuf-maps.md │ │ ├── protobuf-messages.md │ │ ├── protobuf-nested-types.md │ │ ├── protobuf-repeated.md │ │ ├── protobuf-reserved.md │ │ ├── protocol-buffers.md │ │ ├── rpc-types.md │ │ ├── security.md │ │ ├── self-hosted.md │ │ ├── service-mesh.md │ │ ├── streaming-versus-repeated.md │ │ ├── toc.yml │ │ ├── wcf-bindings.md │ │ ├── wcf-endpoints-grpc-methods.md │ │ ├── wcf-services-to-grpc-comparison.md │ │ ├── why-grpc.md │ │ └── ws-protocols.md │ ├── index.yml │ ├── microservices │ │ ├── architect-microservice-container-applications │ │ │ ├── asynchronous-message-based-communication.md │ │ │ ├── communication-in-microservice-architecture.md │ │ │ ├── containerize-monolithic-applications.md │ │ │ ├── data-sovereignty-per-microservice.md │ │ │ ├── direct-client-to-microservice-communication-versus-the-API-Gateway-pattern.md │ │ │ ├── distributed-data-management.md │ │ │ ├── docker-application-state-data.md │ │ │ ├── identify-microservice-domain-model-boundaries.md │ │ │ ├── index.md │ │ │ ├── logical-versus-physical-architecture.md │ │ │ ├── maintain-microservice-apis.md │ │ │ ├── media │ │ │ │ ├── asynchronous-message-based-communication │ │ │ │ │ ├── asynchronous-event-driven-communication.png │ │ │ │ │ └── single-receiver-message-based-communication.png │ │ │ │ ├── communication-in-microservice-architecture │ │ │ │ │ ├── one-to-many-communication.png │ │ │ │ │ ├── request-response-comms-live-queries-updates.png │ │ │ │ │ └── sync-vs-async-patterns-across-microservices.png │ │ │ │ ├── containerize-monolithic-applications │ │ │ │ │ ├── docker-infrastructure-monolithic-application.png │ │ │ │ │ ├── host-multiple-apps-containers.png │ │ │ │ │ ├── monolithic-containerized-application.png │ │ │ │ │ └── publish-azure-app-service-container.png │ │ │ │ ├── data-sovereignty-per-microservice │ │ │ │ │ └── data-sovereignty-comparison.png │ │ │ │ ├── direct-client-to-microservice-communication-versus-the-API-Gateway-pattern │ │ │ │ │ ├── api-gateway-azure-api-management.png │ │ │ │ │ ├── custom-service-api-gateway.png │ │ │ │ │ └── multiple-custom-api-gateways.png │ │ │ │ ├── direct-client-to-microservice-communication.png │ │ │ │ ├── distributed-data-management │ │ │ │ │ └── indepentent-microservice-databases.png │ │ │ │ ├── docker-application-state-data │ │ │ │ │ └── volumes-external-data-sources.png │ │ │ │ ├── identify-microservice-domain-model-boundaries │ │ │ │ │ ├── decompose-traditional-data-models.png │ │ │ │ │ └── identify-entities-microservice-model-boundries.png │ │ │ │ ├── logical-versus-physical-architecture │ │ │ │ │ └── multiple-physical-services.png │ │ │ │ ├── microservice-based-composite-ui-shape-layout │ │ │ │ │ ├── microservice-generate-composite-ui.png │ │ │ │ │ └── monolith-ui-consume-microservices.png │ │ │ │ ├── microservices-architecture │ │ │ │ │ └── monolith-deployment-vs-microservice-approach.png │ │ │ │ ├── resilient-high-availability-microservices │ │ │ │ │ └── microservice-platform.png │ │ │ │ └── scalable-available-multi-container-microservice-applications │ │ │ │ │ ├── azure-kubernetes-service-logo.png │ │ │ │ │ ├── composed-docker-applications-cluster.png │ │ │ │ │ ├── kubernetes-cluster-simplified-structure.png │ │ │ │ │ ├── kubernetes-container-orchestration-system-logo.png │ │ │ │ │ ├── kubernetes-development-environment.png │ │ │ │ │ └── use-multiple-spaces-azure-dev.png │ │ │ ├── microservice-based-composite-ui-shape-layout.md │ │ │ ├── microservices-addressability-service-registry.md │ │ │ ├── microservices-architecture.md │ │ │ ├── resilient-high-availability-microservices.md │ │ │ ├── scalable-available-multi-container-microservice-applications.md │ │ │ └── service-oriented-architecture.md │ │ ├── container-docker-introduction │ │ │ ├── docker-containers-images-registries.md │ │ │ ├── docker-defined.md │ │ │ ├── docker-terminology.md │ │ │ ├── index.md │ │ │ └── media │ │ │ │ ├── docker-containers-images-registries │ │ │ │ └── taxonomy-of-docker-terms-and-concepts.png │ │ │ │ ├── docker-defined │ │ │ │ ├── docker-container-hardware-software.png │ │ │ │ ├── docker-containers-run-anywhere.png │ │ │ │ └── virtual-machine-hardware-software.png │ │ │ │ └── index │ │ │ │ └── multiple-containers-single-host.png │ │ ├── docker-application-development-process │ │ │ ├── docker-app-development-workflow.md │ │ │ ├── index.md │ │ │ └── media │ │ │ │ └── docker-app-development-workflow │ │ │ │ ├── add-container-orchestrator-support-option.png │ │ │ │ ├── add-docker-support-option.png │ │ │ │ ├── debug-toolbar-docker-compose-project.png │ │ │ │ ├── docker-compose-tree-node.PNG │ │ │ │ ├── dotnet-core-cross-platform-development.png │ │ │ │ ├── enable-docker-support-check-box.png │ │ │ │ ├── life-cycle-containerized-apps-docker-cli.png │ │ │ │ ├── results-docker-compose-up.png │ │ │ │ ├── run-docker-build-command.png │ │ │ │ ├── simplified-life-cycle-containerized-apps-docker-cli.png │ │ │ │ ├── step-1-code-your-app.png │ │ │ │ ├── step-2-write-dockerfile.png │ │ │ │ ├── step-3-create-dockerfile-defined-images.png │ │ │ │ ├── step-4-define-services-docker-compose-yml.png │ │ │ │ ├── step-5-run-containers-compose-app.png │ │ │ │ ├── step-6-test-app-microservices.png │ │ │ │ ├── test-docker-app-locally-curl.png │ │ │ │ ├── test-docker-app-locally-localhost.png │ │ │ │ ├── use-docker-run-command.png │ │ │ │ ├── view-existing-images-with-docker-images.png │ │ │ │ └── vm-with-docker-containers-deployed.png │ │ ├── implement-resilient-applications │ │ │ ├── explore-custom-http-call-retries-exponential-backoff.md │ │ │ ├── handle-partial-failure.md │ │ │ ├── implement-circuit-breaker-pattern.md │ │ │ ├── implement-http-call-retries-exponential-backoff-polly.md │ │ │ ├── implement-resilient-entity-framework-core-sql-connections.md │ │ │ ├── implement-retries-exponential-backoff.md │ │ │ ├── index.md │ │ │ ├── media │ │ │ │ ├── handle-partial-failure │ │ │ │ │ ├── multiple-distributed-dependencies.png │ │ │ │ │ ├── partial-failure-amplified-microservices.png │ │ │ │ │ └── partial-failures-diagram.png │ │ │ │ ├── implement-circuit-breaker-pattern │ │ │ │ │ ├── basket-service-inoperative.png │ │ │ │ │ └── failing-middleware-simulation.png │ │ │ │ ├── monitor-app-health │ │ │ │ │ ├── aspnet-core-diagnostics-health-checks.png │ │ │ │ │ ├── health-check-json-response.png │ │ │ │ │ └── health-check-status-ui.png │ │ │ │ └── use-httpclientfactory-to-implement-resilient-http-requests │ │ │ │ │ └── client-application-code.png │ │ │ ├── monitor-app-health.md │ │ │ ├── partial-failure-strategies.md │ │ │ └── use-httpclientfactory-to-implement-resilient-http-requests.md │ │ ├── index.md │ │ ├── key-takeaways.md │ │ ├── media │ │ │ └── cover-small.png │ │ ├── microservice-ddd-cqrs-patterns │ │ │ ├── apply-simplified-microservice-cqrs-ddd-patterns.md │ │ │ ├── client-side-validation.md │ │ │ ├── cqrs-microservice-reads.md │ │ │ ├── ddd-oriented-microservice.md │ │ │ ├── domain-events-design-implementation.md │ │ │ ├── domain-model-layer-validations.md │ │ │ ├── enumeration-classes-over-enum-types.md │ │ │ ├── eshoponcontainers-cqrs-ddd-microservice.md │ │ │ ├── implement-value-objects.md │ │ │ ├── index.md │ │ │ ├── infrastructure-persistence-layer-design.md │ │ │ ├── infrastructure-persistence-layer-implemenation-entity-framework-core.md │ │ │ ├── media │ │ │ │ ├── apply-simplified-microservice-cqrs-ddd-patterns │ │ │ │ │ └── simplified-cqrs-ddd-microservice.png │ │ │ │ ├── cqrs-microservice-reads │ │ │ │ │ ├── drapper-package-nuget.png │ │ │ │ │ ├── ordering-api-queries-folder.png │ │ │ │ │ ├── simple-approach-cqrs-queries.png │ │ │ │ │ └── swagger-ordering-http-api.png │ │ │ │ ├── ddd-oriented-microservice │ │ │ │ │ ├── ddd-service-layer-dependencies.png │ │ │ │ │ ├── domain-driven-design-microservice.png │ │ │ │ │ └── ordering-domain-dependencies.png │ │ │ │ ├── domain-events-design-implementation │ │ │ │ │ ├── aggregate-domain-event-handlers.png │ │ │ │ │ ├── domain-event-dispatcher.png │ │ │ │ │ └── domain-model-ordering-microservice.png │ │ │ │ ├── implement-value-objects │ │ │ │ │ └── value-object-within-aggregate.png │ │ │ │ ├── index │ │ │ │ │ └── internal-versus-external-architecture.png │ │ │ │ ├── infrastructure-persistence-layer-design │ │ │ │ │ └── repository-aggregate-database-table-relationships.png │ │ │ │ ├── infrastructure-persistence-layer-implemenation-entity-framework-core │ │ │ │ │ └── custom-repo-versus-db-context.png │ │ │ │ ├── microservice-application-layer-implementation-web-api │ │ │ │ │ ├── add-ha-message-queue.png │ │ │ │ │ ├── high-level-writes-side.png │ │ │ │ │ ├── mediator-cqrs-microservice.png │ │ │ │ │ └── ordering-api-microservice.png │ │ │ │ ├── microservice-domain-model │ │ │ │ │ ├── buyer-order-aggregate-pattern.png │ │ │ │ │ └── domain-entity-pattern.png │ │ │ │ ├── net-core-microservice-domain-model │ │ │ │ │ ├── ordering-microservice-container.png │ │ │ │ │ └── vs-solution-explorer-order-aggregate.png │ │ │ │ ├── nosql-database-persistence-infrastructure │ │ │ │ │ ├── azure-cosmos-db-global-distribution.png │ │ │ │ │ ├── eshoponcontainers-mongodb-containers.png │ │ │ │ │ ├── mongodb-api-nuget-packages.png │ │ │ │ │ └── mongodb-api-wire-protocol.png │ │ │ │ └── seedwork-domain-model-base-classes-interfaces │ │ │ │ │ └── vs-solution-seedwork-classes.png │ │ │ ├── microservice-application-layer-implementation-web-api.md │ │ │ ├── microservice-application-layer-web-api-design.md │ │ │ ├── microservice-domain-model.md │ │ │ ├── net-core-microservice-domain-model.md │ │ │ ├── nosql-database-persistence-infrastructure.md │ │ │ └── seedwork-domain-model-base-classes-interfaces.md │ │ ├── multi-container-microservice-net-applications │ │ │ ├── background-tasks-with-ihostedservice.md │ │ │ ├── data-driven-crud-microservice.md │ │ │ ├── database-server-container.md │ │ │ ├── implement-api-gateways-with-ocelot.md │ │ │ ├── index.md │ │ │ ├── integration-event-based-microservice-communications.md │ │ │ ├── media │ │ │ │ ├── background-tasks-with-ihostedservice │ │ │ │ │ ├── class-diagram-custom-ihostedservice.png │ │ │ │ │ └── ihosted-service-webhost-vs-host.png │ │ │ │ ├── data-driven-crud-microservice │ │ │ │ │ ├── create-asp-net-core-web-api-project.png │ │ │ │ │ ├── internal-design-simple-crud-microservices.png │ │ │ │ │ ├── simple-crud-web-api-microservice-dependencies.png │ │ │ │ │ ├── simple-data-driven-crud-microservice.png │ │ │ │ │ ├── swagger-json-metadata.png │ │ │ │ │ ├── swagger-metadata-eshoponcontainers-catalog-microservice.png │ │ │ │ │ └── swashbuckle-ui-testing.png │ │ │ │ ├── implement-api-gateways-with-ocelot │ │ │ │ │ ├── access-microservice-through-url.png │ │ │ │ │ ├── catalog-api-microservice-folders.png │ │ │ │ │ ├── direct-access-microservice-testing.png │ │ │ │ │ ├── eshoponcontainer-ingress-tier.png │ │ │ │ │ ├── eshoponcontainers-architecture-aggregator-services.png │ │ │ │ │ ├── eshoponcontainers-architecture.png │ │ │ │ │ ├── eshoponcontainers-identity-service-position.png │ │ │ │ │ ├── eshoponcontainers-microservice-folders.png │ │ │ │ │ ├── ocelot-authentication.png │ │ │ │ │ ├── ocelot-configuration-files.png │ │ │ │ │ ├── ocelotapigw-base-project.png │ │ │ │ │ ├── reusing-single-ocelot-docker-image.png │ │ │ │ │ ├── test-catalog-microservice.png │ │ │ │ │ └── zoom-in-vision-aggregator-services.png │ │ │ │ ├── integration-event-based-microservice-communications │ │ │ │ │ ├── event-driven-communication.png │ │ │ │ │ ├── multiple-implementations-event-bus.png │ │ │ │ │ └── publish-subscribe-basics.png │ │ │ │ ├── microservice-application-design │ │ │ │ │ ├── eshoponcontainers-reference-application-architecture.png │ │ │ │ │ ├── external-versus-internal-architecture.png │ │ │ │ │ └── multi-architectural-patterns-polyglot-microservices.png │ │ │ │ ├── multi-container-applications-docker-compose │ │ │ │ │ ├── docker-compose-file-visual-studio.png │ │ │ │ │ └── multiple-docker-compose-files-override-base.png │ │ │ │ ├── rabbitmq-event-bus-development-test-environment │ │ │ │ │ └── rabbitmq-implementation.png │ │ │ │ ├── subscribe-events │ │ │ │ │ ├── atomicity-publish-event-bus.png │ │ │ │ │ ├── atomicity-publish-worker-microservice.png │ │ │ │ │ └── display-item-price-change.png │ │ │ │ └── test-aspnet-core-services-web-apps │ │ │ │ │ └── eshoponcontainers-test-folder-structure.png │ │ │ ├── microservice-application-design.md │ │ │ ├── multi-container-applications-docker-compose.md │ │ │ ├── rabbitmq-event-bus-development-test-environment.md │ │ │ ├── subscribe-events.md │ │ │ └── test-aspnet-core-services-web-apps.md │ │ ├── net-core-net-framework-containers │ │ │ ├── container-framework-choice-factors.md │ │ │ ├── general-guidance.md │ │ │ ├── index.md │ │ │ ├── media │ │ │ │ └── net-container-os-targets │ │ │ │ │ └── targeting-operating-systems.png │ │ │ ├── net-container-os-targets.md │ │ │ ├── net-core-container-scenarios.md │ │ │ ├── net-framework-container-scenarios.md │ │ │ └── official-net-docker-images.md │ │ ├── secure-net-microservices-web-applications │ │ │ ├── authorization-net-microservices-web-applications.md │ │ │ ├── azure-key-vault-protects-secrets.md │ │ │ ├── developer-app-secrets-storage.md │ │ │ ├── index.md │ │ │ └── media │ │ │ │ └── index │ │ │ │ ├── api-gateway-centralized-authentication.png │ │ │ │ ├── identity-microservice-authentication.png │ │ │ │ └── select-external-authentication-option.png │ │ └── toc.yml │ ├── modern-web-apps-azure │ │ ├── architectural-principles.md │ │ ├── azure-hosting-recommendations-for-asp-net-web-apps.md │ │ ├── choose-between-traditional-web-and-single-page-apps.md │ │ ├── common-client-side-web-technologies.md │ │ ├── common-web-application-architectures.md │ │ ├── develop-asp-net-core-mvc-apps.md │ │ ├── development-process-for-azure.md │ │ ├── index.md │ │ ├── media │ │ │ ├── image1-10.png │ │ │ ├── image1-5.png │ │ │ ├── image1-6.png │ │ │ ├── image1-7.png │ │ │ ├── image1-8.png │ │ │ ├── image1-9.gif │ │ │ ├── image10-1.png │ │ │ ├── image10-2.png │ │ │ ├── image10-3.png │ │ │ ├── image11-2.png │ │ │ ├── image2-1.png │ │ │ ├── image4-1.png │ │ │ ├── image4-2.png │ │ │ ├── image5-1.png │ │ │ ├── image5-10.png │ │ │ ├── image5-11.png │ │ │ ├── image5-12.png │ │ │ ├── image5-13.png │ │ │ ├── image5-14.png │ │ │ ├── image5-2.png │ │ │ ├── image5-3.png │ │ │ ├── image5-4.png │ │ │ ├── image5-5.png │ │ │ ├── image5-6.png │ │ │ ├── image5-7.png │ │ │ ├── image5-8.png │ │ │ ├── image5-9.png │ │ │ ├── image6-1.png │ │ │ ├── image7-1.png │ │ │ ├── image7-2.png │ │ │ ├── image7-3.png │ │ │ ├── image7-4.png │ │ │ ├── image7-5.png │ │ │ ├── image7-6.png │ │ │ ├── image8-1.png │ │ │ ├── image8-2.png │ │ │ ├── image9-1.png │ │ │ ├── image9-2.png │ │ │ ├── image9-3.png │ │ │ ├── image9-4.png │ │ │ └── index │ │ │ │ └── web-application-guide-cover-image.png │ │ ├── modern-web-applications-characteristics.md │ │ ├── test-asp-net-core-mvc-apps.md │ │ ├── toc.yml │ │ └── work-with-data-in-asp-net-core-apps.md │ ├── modernize-with-azure-containers │ │ ├── conclusions.md │ │ ├── index.md │ │ ├── lift-and-shift-existing-apps-azure-iaas.md │ │ ├── media │ │ │ ├── image1-1.png │ │ │ ├── image1-2.png │ │ │ ├── image1-3.png │ │ │ ├── image1-4.png │ │ │ ├── image1-5.png │ │ │ ├── image1-6.png │ │ │ ├── image1-7.png │ │ │ ├── image2-1.png │ │ │ ├── image2-2.png │ │ │ ├── image2-3.png │ │ │ ├── image3-1.png │ │ │ ├── image5-1.5.png │ │ │ ├── image5-1.png │ │ │ ├── image5-11.png │ │ │ ├── image5-2.png │ │ │ ├── image5-3.5.6.png │ │ │ ├── image5-3.5.png │ │ │ ├── image5-3.png │ │ │ ├── image5-4.png │ │ │ ├── image5-5.png │ │ │ ├── image5-6.png │ │ │ ├── image5-7.png │ │ │ ├── image5-8.png │ │ │ └── index │ │ │ │ └── web-application-guide-cover-image.png │ │ ├── migrate-your-relational-databases-to-azure.md │ │ ├── modernize-existing-apps-to-cloud-optimized │ │ │ ├── build-resilient-services-ready-for-the-cloud-embrace-transient-failures-in-the-cloud.md │ │ │ ├── choosing-azure-compute-options-for-container-based-applications.md │ │ │ ├── deploy-existing-net-apps-as-windows-containers.md │ │ │ ├── index.md │ │ │ ├── life-cycle-ci-cd-pipelines-devops-tools.md │ │ │ ├── media │ │ │ │ ├── build-resilient-services-ready-for-the-cloud-embrace-transient-failures-in-the-cloud │ │ │ │ │ └── retry-partial-failures.png │ │ │ │ ├── choosing-azure-compute-options-for-container-based-applications │ │ │ │ │ └── azure-hosting-scenarios-for-apps.png │ │ │ │ ├── deploy-existing-net-apps-as-windows-containers │ │ │ │ │ ├── azure-container-ecosystem.png │ │ │ │ │ ├── docker-deploys-containers-all-layers.png │ │ │ │ │ └── dotnet-framework-operating-systems.png │ │ │ │ ├── index │ │ │ │ │ └── position-cloud-optimized-application.png │ │ │ │ ├── life-cycle-ci-cd-pipelines-devops-tools │ │ │ │ │ └── deploy-mvc-app-container-kubernetes.png │ │ │ │ ├── main-pillars-cloud-optimized-application.png │ │ │ │ ├── migrate-to-hybrid-cloud-scenarios │ │ │ │ │ └── microsoft-hybrid-cloud-platform.png │ │ │ │ ├── modernize-your-apps-with-monitoring-and-telemetry │ │ │ │ │ ├── application-insights-monitoring-dashboard.png │ │ │ │ │ └── log-analytics-container-monitoring-solution.png │ │ │ │ └── what-about-cloud-native-applications │ │ │ │ │ ├── cloud-native-characteristics.png │ │ │ │ │ └── positioning-cloud-native-applications.png │ │ │ ├── microsoft-technologies-in-cloud-optimized-applications.md │ │ │ ├── migrate-to-hybrid-cloud-scenarios.md │ │ │ ├── modernize-your-apps-with-monitoring-and-telemetry.md │ │ │ ├── reasons-to-modernize-existing-net-apps-to-cloud-optimized-applications.md │ │ │ ├── what-about-cloud-native-applications.md │ │ │ ├── when-not-to-deploy-to-windows-containers.md │ │ │ ├── when-to-deploy-windows-containers-in-your-on-premises-iaas-vm-infrastructure.md │ │ │ ├── when-to-deploy-windows-containers-to-azure-container-instances-ACI.md │ │ │ ├── when-to-deploy-windows-containers-to-azure-container-service-kubernetes.md │ │ │ └── when-to-deploy-windows-containers-to-azure-vms-iaas-cloud.md │ │ ├── toc.yml │ │ └── walkthroughs-technical-get-started-overview.md │ ├── serverless │ │ ├── application-insights.md │ │ ├── architecture-approaches.md │ │ ├── architecture-deployment-approaches.md │ │ ├── azure-functions.md │ │ ├── azure-serverless-platform.md │ │ ├── durable-azure-functions.md │ │ ├── event-grid.md │ │ ├── index.md │ │ ├── logic-apps.md │ │ ├── media │ │ │ ├── app-integration.png │ │ │ ├── application-insights-logo.png │ │ │ ├── automated-image-gallery.png │ │ │ ├── azure-functions-architecture.png │ │ │ ├── azure-functions-logo.png │ │ │ ├── azure-messaging-services.png │ │ │ ├── azure-serverless-platform.png │ │ │ ├── cqrs-example.png │ │ │ ├── custom-telemetry.png │ │ │ ├── event-grid-logo.png │ │ │ ├── iaas-approach.png │ │ │ ├── image-processing-example.png │ │ │ ├── index │ │ │ │ └── serverless-apps-cover.jpg │ │ │ ├── kubernetes-example.png │ │ │ ├── link-shortener-architecture.png │ │ │ ├── logic-app-triggers.png │ │ │ ├── logic-app-workflow.png │ │ │ ├── logic-apps-architecture.png │ │ │ ├── logic-apps-logo.png │ │ │ ├── metrics-explorer.png │ │ │ ├── microservices-architecture.png │ │ │ ├── migration-architecture.png │ │ │ ├── monolith-architecture.png │ │ │ ├── n-layer-architecture.png │ │ │ ├── n-tier-architecture.png │ │ │ ├── ops-automation.png │ │ │ ├── orlando-eye-both.png │ │ │ ├── paas-architecture.png │ │ │ ├── power-bi-example.png │ │ │ ├── serverless-api-gateway.png │ │ │ ├── serverless-apps.png │ │ │ ├── serverless-business-scenarios │ │ │ │ └── csv-parse-database-import.png │ │ │ ├── serverless-data-pipeline.png │ │ │ ├── serverless-evolution-iaas-paas.png │ │ │ ├── serverless-file-triggers.png │ │ │ ├── serverless-implementation.png │ │ │ ├── serverless-mobile-backend.png │ │ │ ├── serverless-monolith-migration.png │ │ │ ├── serverless-scheduling.png │ │ │ ├── serverless-stream-processing.png │ │ │ └── serverless-web-api.png │ │ ├── orchestration-patterns.md │ │ ├── serverless-architecture-considerations.md │ │ ├── serverless-architecture.md │ │ ├── serverless-business-scenarios.md │ │ ├── serverless-conclusion.md │ │ ├── serverless-design-examples.md │ │ └── toc.yml │ └── toc.yml ├── breadcrumb │ └── toc.yml ├── context │ └── desktop-guide-wpf-getstarted-context.yml ├── core │ ├── about.md │ ├── additional-tools │ │ ├── dotnet-svcutil-guide.md │ │ ├── dotnet-svcutil.xmlserializer-guide.md │ │ ├── index.md │ │ ├── media │ │ │ └── wcf-web-service-reference-guide │ │ │ │ ├── wcfcs-connectedservicespage.png │ │ │ │ ├── wcfcs-datatypespage.png │ │ │ │ ├── wcfcs-progresswindow.png │ │ │ │ └── wcfcs-serviceendpointpage.png │ │ ├── wcf-web-service-reference-guide.md │ │ └── xml-serializer-generator.md │ ├── build │ │ ├── distribution-packaging.md │ │ └── index.md │ ├── compatibility │ │ ├── 2.2-3.0.md │ │ ├── 3.0.6-3.0.7.md │ │ ├── 3.0.7-3.0.8.md │ │ ├── 3.0.8-3.0.9.md │ │ ├── 3.0.9-3.0rc1.md │ │ ├── aspnetcore.md │ │ ├── breaking-changes.md │ │ ├── categories.md │ │ ├── corefx.md │ │ ├── crypto.md │ │ ├── cryptography.md │ │ ├── framework-core.md │ │ ├── globalization.md │ │ ├── index.md │ │ ├── networking.md │ │ ├── toc.yml │ │ ├── visualbasic.md │ │ └── winforms.md │ ├── dependency-loading │ │ ├── default-probing.md │ │ ├── loading-managed.md │ │ ├── loading-resources.md │ │ ├── loading-unmanaged.md │ │ ├── overview.md │ │ └── understanding-assemblyloadcontext.md │ ├── deploying │ │ ├── creating-nuget-packages.md │ │ ├── deploy-with-cli.md │ │ ├── deploy-with-vs.md │ │ ├── index.md │ │ ├── reducing-dependencies.md │ │ ├── runtime-patch-selection.md │ │ └── runtime-store.md │ ├── diagnostics │ │ ├── dotnet-counters.md │ │ ├── dotnet-dump.md │ │ ├── dotnet-trace.md │ │ ├── index.md │ │ ├── logging-tracing.md │ │ └── managed-debuggers.md │ ├── docker │ │ ├── build-container.md │ │ └── introduction.md │ ├── get-started.md │ ├── index.md │ ├── linux-prerequisites.md │ ├── macos-prerequisites.md │ ├── media │ │ ├── packages │ │ │ └── package-framework.png │ │ └── windows-prerequisites │ │ │ ├── target-dotnet-core-3-0.jpg │ │ │ ├── targeting-dotnet-core.jpg │ │ │ ├── vs-2017-workloads.jpg │ │ │ └── vs-2019-workloads.jpg │ ├── migration │ │ ├── 20-21.md │ │ ├── from-dnx.md │ │ ├── index.md │ │ └── media │ │ │ └── one-way-upgrade.jpg │ ├── native-interop │ │ └── expose-components-to-com.md │ ├── packages.md │ ├── porting │ │ ├── index.md │ │ ├── libraries.md │ │ ├── media │ │ │ └── project-structure │ │ │ │ ├── existing-project-structure.png │ │ │ │ ├── multi-targeted-project.png │ │ │ │ └── separate-projects-same-source.png │ │ ├── net-framework-tech-unavailable.md │ │ ├── project-structure.md │ │ ├── third-party-deps.md │ │ ├── tools.md │ │ ├── windows-compat-pack.md │ │ └── winforms.md │ ├── rid-catalog.md │ ├── sdk.md │ ├── testing │ │ ├── index.md │ │ ├── selective-unit-tests.md │ │ ├── unit-testing-best-practices.md │ │ ├── unit-testing-fsharp-with-dotnet-test.md │ │ ├── unit-testing-fsharp-with-mstest.md │ │ ├── unit-testing-fsharp-with-nunit.md │ │ ├── unit-testing-published-output.md │ │ ├── unit-testing-visual-basic-with-dotnet-test.md │ │ ├── unit-testing-visual-basic-with-mstest.md │ │ ├── unit-testing-visual-basic-with-nunit.md │ │ ├── unit-testing-with-dotnet-test.md │ │ ├── unit-testing-with-mstest.md │ │ └── unit-testing-with-nunit.md │ ├── toc.yml │ ├── tools │ │ ├── cli-msbuild-architecture.md │ │ ├── csproj.md │ │ ├── custom-templates.md │ │ ├── dependencies.md │ │ ├── dotnet-add-package.md │ │ ├── dotnet-add-reference.md │ │ ├── dotnet-build-server.md │ │ ├── dotnet-build.md │ │ ├── dotnet-clean.md │ │ ├── dotnet-help.md │ │ ├── dotnet-install-script.md │ │ ├── dotnet-list-package.md │ │ ├── dotnet-list-reference.md │ │ ├── dotnet-migrate.md │ │ ├── dotnet-msbuild.md │ │ ├── dotnet-new.md │ │ ├── dotnet-nuget-delete.md │ │ ├── dotnet-nuget-locals.md │ │ ├── dotnet-nuget-push.md │ │ ├── dotnet-pack.md │ │ ├── dotnet-publish.md │ │ ├── dotnet-remove-package.md │ │ ├── dotnet-remove-reference.md │ │ ├── dotnet-restore.md │ │ ├── dotnet-run.md │ │ ├── dotnet-sln.md │ │ ├── dotnet-store.md │ │ ├── dotnet-test.md │ │ ├── dotnet-tool-install.md │ │ ├── dotnet-tool-list.md │ │ ├── dotnet-tool-uninstall.md │ │ ├── dotnet-tool-update.md │ │ ├── dotnet-vstest.md │ │ ├── dotnet.md │ │ ├── elevated-access.md │ │ ├── enable-tab-autocomplete.md │ │ ├── extensibility.md │ │ ├── global-json.md │ │ ├── global-tools-how-to-create.md │ │ ├── global-tools.md │ │ ├── index.md │ │ ├── media │ │ │ ├── cli-msbuild-architecture │ │ │ │ ├── p2-arch.png │ │ │ │ └── p3-arch.png │ │ │ └── using-ci-with-cli │ │ │ │ ├── add-build-step.png │ │ │ │ ├── add-powershell-script.png │ │ │ │ ├── powershell-script-path.png │ │ │ │ └── select-empty-build-definition.png │ │ ├── project-json-to-csproj.md │ │ ├── telemetry.md │ │ ├── troubleshoot-usage-issues.md │ │ └── using-ci-with-cli.md │ ├── tutorials │ │ ├── aspnet-core.md │ │ ├── cli-templates-create-item-template.md │ │ ├── cli-templates-create-project-template.md │ │ ├── cli-templates-create-template-pack.md │ │ ├── consuming-library-with-visual-studio.md │ │ ├── creating-app-with-plugin-support.md │ │ ├── debugging-with-visual-studio.md │ │ ├── index.md │ │ ├── libraries.md │ │ ├── library-with-visual-studio.md │ │ ├── media │ │ │ ├── consuming-library-with-visual-studio │ │ │ │ ├── add-new-project-dialog.png │ │ │ │ ├── add-new-vb-project-dialog.png │ │ │ │ ├── add-reference-context-menu.png │ │ │ │ ├── manage-project-references.png │ │ │ │ ├── set-startup-project-context-menu.png │ │ │ │ └── visual-studio-project-toolbar.png │ │ │ ├── debugging-with-visual-studio │ │ │ │ ├── autos-immediate-window.png │ │ │ │ ├── breakpoint-console-window.png │ │ │ │ ├── breakpoint-settings.png │ │ │ │ ├── debug-changed-value.png │ │ │ │ ├── immediate-window-output.png │ │ │ │ ├── set-breakpoint-in-editor.png │ │ │ │ ├── step-into-method.png │ │ │ │ ├── step-into-source-method.png │ │ │ │ ├── vb-breakpointsettings.png │ │ │ │ ├── vb-immediate-window-output.png │ │ │ │ ├── vb-set-breakpoint-in-editor.png │ │ │ │ ├── vb-step-into-method.png │ │ │ │ ├── vb-step-into-source-method.png │ │ │ │ ├── vb-stop-at-breakpoint.png │ │ │ │ ├── visual-studio-toolbar-debug.png │ │ │ │ └── visual-studio-toolbar-release.png │ │ │ ├── library-with-visual-studio │ │ │ │ ├── add-new-library-project.png │ │ │ │ ├── library-project-properties.png │ │ │ │ ├── new-project-dialog.png │ │ │ │ ├── output-pane-successful-build.png │ │ │ │ └── string-library-project.png │ │ │ ├── publishing-with-visual-studio │ │ │ │ ├── publish-context-menu.png │ │ │ │ ├── publish-settings-window.png │ │ │ │ ├── published-files-output.png │ │ │ │ └── visual-studio-toolbar-release.png │ │ │ ├── testing-library-with-visual-studio │ │ │ │ ├── add-reference-context-menu.png │ │ │ │ ├── advanced-save-options.png │ │ │ │ ├── build-library-context-menu.png │ │ │ │ ├── create-new-test-project.png │ │ │ │ ├── failed-test-detail.png │ │ │ │ ├── failed-test-window.png │ │ │ │ ├── project-reference-manager.png │ │ │ │ ├── save-file-as-dialog.png │ │ │ │ ├── test-explorer-window.png │ │ │ │ ├── unit-test-editor-window.png │ │ │ │ ├── vb-create-new-test-project.png │ │ │ │ ├── vb-unit-test-editor-window.png │ │ │ │ └── visual-studio-toolbar-release.png │ │ │ ├── using-on-mac-vs-full-solution │ │ │ │ ├── visual-studio-for-mac-unit-test-failure.png │ │ │ │ ├── visual-studio-mac-assert-test.png │ │ │ │ ├── visual-studio-mac-breakpoint.png │ │ │ │ ├── visual-studio-mac-build-panel.png │ │ │ │ ├── visual-studio-mac-console-window.png │ │ │ │ ├── visual-studio-mac-debugger.png │ │ │ │ ├── visual-studio-mac-edit-references.png │ │ │ │ ├── visual-studio-mac-editor.png │ │ │ │ ├── visual-studio-mac-error-button.png │ │ │ │ ├── visual-studio-mac-immediate-window.png │ │ │ │ ├── visual-studio-mac-new-project-name.png │ │ │ │ ├── visual-studio-mac-new-project-options.png │ │ │ │ ├── visual-studio-mac-new-project.png │ │ │ │ ├── visual-studio-mac-output.png │ │ │ │ ├── visual-studio-mac-project-options.png │ │ │ │ ├── visual-studio-mac-toolbar.png │ │ │ │ ├── visual-studio-mac-unit-test-dock-icon.png │ │ │ │ ├── visual-studio-mac-unit-test-failure.png │ │ │ │ ├── visual-studio-mac-unit-test-panel.png │ │ │ │ ├── visual-studio-mac-unit-test-pass.png │ │ │ │ └── visual-studio-mac-unit-test-project.png │ │ │ ├── using-on-mac-vs │ │ │ │ ├── visual-studio-mac-editor.png │ │ │ │ ├── visual-studio-mac-new-dialog.png │ │ │ │ ├── visual-studio-mac-new-options.png │ │ │ │ ├── visual-studio-mac-new-project.png │ │ │ │ └── visual-studio-mac-output.png │ │ │ ├── using-on-macos │ │ │ │ └── visual-studio-code-debugger.png │ │ │ ├── vb-library-with-visual-studio │ │ │ │ ├── create-new-library-project.png │ │ │ │ └── visual-studio-library.png │ │ │ ├── vb-with-visual-studio │ │ │ │ ├── visual-basic-code-window.png │ │ │ │ ├── visual-studio-main-window.png │ │ │ │ └── visual-studio-new-project.png │ │ │ ├── with-visual-studio-code │ │ │ │ ├── dotnet-new-command.png │ │ │ │ ├── dotnet-restore-command.png │ │ │ │ ├── dotnet-run-command.png │ │ │ │ ├── missing-assets.png │ │ │ │ ├── open-debug-tab.png │ │ │ │ ├── open-program-cs.png │ │ │ │ ├── run-debug-vs-code.png │ │ │ │ ├── select-net-core.png │ │ │ │ ├── set-breakpoint-vs-code.png │ │ │ │ └── vs-code-open-folder.png │ │ │ └── with-visual-studio │ │ │ │ ├── hello-world-console.png │ │ │ │ ├── hello-world-update.png │ │ │ │ ├── visual-csharp-code-window.png │ │ │ │ ├── visual-studio-main-window.png │ │ │ │ └── visual-studio-new-project.png │ │ ├── netcore-hosting.md │ │ ├── publishing-with-visual-studio.md │ │ ├── testing-library-with-visual-studio.md │ │ ├── testing-with-cli.md │ │ ├── using-on-mac-vs-full-solution.md │ │ ├── using-on-mac-vs.md │ │ ├── using-on-macos.md │ │ ├── using-with-xplat-cli.md │ │ ├── vb-library-with-visual-studio.md │ │ ├── vb-with-visual-studio.md │ │ ├── with-visual-studio-code.md │ │ └── with-visual-studio.md │ ├── versions │ │ ├── index.md │ │ ├── media │ │ │ └── remove-runtime-sdk-versions │ │ │ │ └── programs-and-features.png │ │ ├── remove-runtime-sdk-versions.md │ │ └── selection.md │ ├── whats-new │ │ ├── dotnet-core-2-0.md │ │ ├── dotnet-core-2-1.md │ │ ├── dotnet-core-2-2.md │ │ ├── dotnet-core-3-0.md │ │ ├── index.md │ │ └── media │ │ │ └── dotnet-core-2-0 │ │ │ └── target-framework-selection.png │ └── windows-prerequisites.md ├── csharp │ ├── async.md │ ├── basic-types.md │ ├── codedoc.md │ ├── deconstruct.md │ ├── delegate-class.md │ ├── delegates-overview.md │ ├── delegates-patterns.md │ ├── delegates-strongly-typed.md │ ├── discards.md │ ├── distinguish-delegates-events.md │ ├── event-pattern.md │ ├── events-overview.md │ ├── expression-classes.md │ ├── expression-trees-building.md │ ├── expression-trees-execution.md │ ├── expression-trees-explained.md │ ├── expression-trees-interpreting.md │ ├── expression-trees-summary.md │ ├── expression-trees-translating.md │ ├── expression-trees.md │ ├── getting-started │ │ ├── index.md │ │ ├── introduction-to-the-csharp-language-and-the-net-framework.md │ │ └── media │ │ │ └── introduction-to-the-csharp-language-and-the-net-framework │ │ │ └── net-architecture-relationships.png │ ├── how-to │ │ ├── compare-strings.md │ │ ├── concatenate-multiple-strings.md │ │ ├── index.md │ │ ├── modify-string-contents.md │ │ ├── parse-strings-using-split.md │ │ ├── safely-cast-using-pattern-matching-is-and-as-operators.md │ │ └── search-strings.md │ ├── implicitly-typed-lambda-expressions.md │ ├── index.md │ ├── indexers.md │ ├── iterators.md │ ├── language-reference │ │ ├── builtin-types │ │ │ ├── floating-point-numeric-types.md │ │ │ ├── integral-numeric-types.md │ │ │ ├── nullable-value-types.md │ │ │ ├── numeric-conversions.md │ │ │ ├── reference-types.md │ │ │ └── unmanaged-types.md │ │ ├── compiler-messages │ │ │ ├── cs0001.md │ │ │ ├── cs0006.md │ │ │ ├── cs0007.md │ │ │ ├── cs0015.md │ │ │ ├── cs0016.md │ │ │ ├── cs0019.md │ │ │ ├── cs0029.md │ │ │ ├── cs0034.md │ │ │ ├── cs0038.md │ │ │ ├── cs0039.md │ │ │ ├── cs0050.md │ │ │ ├── cs0051.md │ │ │ ├── cs0052.md │ │ │ ├── cs0071.md │ │ │ ├── cs0103.md │ │ │ ├── cs0106.md │ │ │ ├── cs0108.md │ │ │ ├── cs0115.md │ │ │ ├── cs0116.md │ │ │ ├── cs0120.md │ │ │ ├── cs0122.md │ │ │ ├── cs0134.md │ │ │ ├── cs0151.md │ │ │ ├── cs0163.md │ │ │ ├── cs0165.md │ │ │ ├── cs0173.md │ │ │ ├── cs0178.md │ │ │ ├── cs0188.md │ │ │ ├── cs0201.md │ │ │ ├── cs0229.md │ │ │ ├── cs0233.md │ │ │ ├── cs0234.md │ │ │ ├── cs0246.md │ │ │ ├── cs0260.md │ │ │ ├── cs0266.md │ │ │ ├── cs0269.md │ │ │ ├── cs0270.md │ │ │ ├── cs0304.md │ │ │ ├── cs0310.md │ │ │ ├── cs0311.md │ │ │ ├── cs0413.md │ │ │ ├── cs0417.md │ │ │ ├── cs0420.md │ │ │ ├── cs0429.md │ │ │ ├── cs0433.md │ │ │ ├── cs0445.md │ │ │ ├── cs0446.md │ │ │ ├── cs0465.md │ │ │ ├── cs0467.md │ │ │ ├── cs0504.md │ │ │ ├── cs0507.md │ │ │ ├── cs0518.md │ │ │ ├── cs0523.md │ │ │ ├── cs0545.md │ │ │ ├── cs0552.md │ │ │ ├── cs0563.md │ │ │ ├── cs0570.md │ │ │ ├── cs0571.md │ │ │ ├── cs0579.md │ │ │ ├── cs0592.md │ │ │ ├── cs0616.md │ │ │ ├── cs0618.md │ │ │ ├── cs0650.md │ │ │ ├── cs0675.md │ │ │ ├── cs0686.md │ │ │ ├── cs0702.md │ │ │ ├── cs0703.md │ │ │ ├── cs0731.md │ │ │ ├── cs0826.md │ │ │ ├── cs0834.md │ │ │ ├── cs0840.md │ │ │ ├── cs0843.md │ │ │ ├── cs0845.md │ │ │ ├── cs1001.md │ │ │ ├── cs1009.md │ │ │ ├── cs1018.md │ │ │ ├── cs1019.md │ │ │ ├── cs1026.md │ │ │ ├── cs1029.md │ │ │ ├── cs1058.md │ │ │ ├── cs1060.md │ │ │ ├── cs1061.md │ │ │ ├── cs1112.md │ │ │ ├── cs1501.md │ │ │ ├── cs1502.md │ │ │ ├── cs1519.md │ │ │ ├── cs1540.md │ │ │ ├── cs1546.md │ │ │ ├── cs1548.md │ │ │ ├── cs1564.md │ │ │ ├── cs1567.md │ │ │ ├── cs1579.md │ │ │ ├── cs1591.md │ │ │ ├── cs1598.md │ │ │ ├── cs1607.md │ │ │ ├── cs1610.md │ │ │ ├── cs1612.md │ │ │ ├── cs1614.md │ │ │ ├── cs1616.md │ │ │ ├── cs1640.md │ │ │ ├── cs1644.md │ │ │ ├── cs1656.md │ │ │ ├── cs1658.md │ │ │ ├── cs1674.md │ │ │ ├── cs1683.md │ │ │ ├── cs1685.md │ │ │ ├── cs1690.md │ │ │ ├── cs1691.md │ │ │ ├── cs1699.md │ │ │ ├── cs1700.md │ │ │ ├── cs1701.md │ │ │ ├── cs1703.md │ │ │ ├── cs1704.md │ │ │ ├── cs1705.md │ │ │ ├── cs1708.md │ │ │ ├── cs1716.md │ │ │ ├── cs1721.md │ │ │ ├── cs1726.md │ │ │ ├── cs1729.md │ │ │ ├── cs1762.md │ │ │ ├── cs1919.md │ │ │ ├── cs1921.md │ │ │ ├── cs1926.md │ │ │ ├── cs1933.md │ │ │ ├── cs1936.md │ │ │ ├── cs1941.md │ │ │ ├── cs1942.md │ │ │ ├── cs1943.md │ │ │ ├── cs1946.md │ │ │ ├── cs1956.md │ │ │ ├── cs2032.md │ │ │ ├── cs3003.md │ │ │ ├── cs3007.md │ │ │ ├── cs3009.md │ │ │ ├── cs4014.md │ │ │ ├── cs7003.md │ │ │ ├── index.md │ │ │ └── toc.yml │ │ ├── compiler-options │ │ │ ├── addmodule-compiler-option.md │ │ │ ├── appconfig-compiler-option.md │ │ │ ├── baseaddress-compiler-option.md │ │ │ ├── bugreport-compiler-option.md │ │ │ ├── checked-compiler-option.md │ │ │ ├── codepage-compiler-option.md │ │ │ ├── command-line-building-with-csc-exe.md │ │ │ ├── debug-compiler-option.md │ │ │ ├── define-compiler-option.md │ │ │ ├── delaysign-compiler-option.md │ │ │ ├── deterministic-compiler-option.md │ │ │ ├── doc-compiler-option.md │ │ │ ├── errorreport-compiler-option.md │ │ │ ├── filealign-compiler-option.md │ │ │ ├── fullpaths-compiler-option.md │ │ │ ├── help-compiler-option.md │ │ │ ├── highentropyva-compiler-option.md │ │ │ ├── how-to-set-environment-variables-for-the-visual-studio-command-line.md │ │ │ ├── index.md │ │ │ ├── keycontainer-compiler-option.md │ │ │ ├── keyfile-compiler-option.md │ │ │ ├── langversion-compiler-option.md │ │ │ ├── lib-compiler-option.md │ │ │ ├── link-compiler-option.md │ │ │ ├── linkresource-compiler-option.md │ │ │ ├── listed-alphabetically.md │ │ │ ├── listed-by-category.md │ │ │ ├── main-compiler-option.md │ │ │ ├── moduleassemblyname-compiler-option.md │ │ │ ├── noconfig-compiler-option.md │ │ │ ├── nologo-compiler-option.md │ │ │ ├── nostdlib-compiler-option.md │ │ │ ├── nowarn-compiler-option.md │ │ │ ├── nowin32manifest-compiler-option.md │ │ │ ├── optimize-compiler-option.md │ │ │ ├── out-compiler-option.md │ │ │ ├── pathmap-compiler-option.md │ │ │ ├── pdb-compiler-option.md │ │ │ ├── platform-compiler-option.md │ │ │ ├── preferreduilang-compiler-option.md │ │ │ ├── publicsign-compiler-option.md │ │ │ ├── recurse-compiler-option.md │ │ │ ├── reference-compiler-option.md │ │ │ ├── refonly-compiler-option.md │ │ │ ├── refout-compiler-option.md │ │ │ ├── resource-compiler-option.md │ │ │ ├── response-file-compiler-option.md │ │ │ ├── subsystemversion-compiler-option.md │ │ │ ├── target-appcontainerexe-compiler-option.md │ │ │ ├── target-compiler-option.md │ │ │ ├── target-exe-compiler-option.md │ │ │ ├── target-library-compiler-option.md │ │ │ ├── target-module-compiler-option.md │ │ │ ├── target-winexe-compiler-option.md │ │ │ ├── target-winmdobj-compiler-option.md │ │ │ ├── unsafe-compiler-option.md │ │ │ ├── utf8output-compiler-option.md │ │ │ ├── warn-compiler-option.md │ │ │ ├── warnaserror-compiler-option.md │ │ │ ├── win32icon-compiler-option.md │ │ │ ├── win32manifest-compiler-option.md │ │ │ └── win32res-compiler-option.md │ │ ├── configure-language-version.md │ │ ├── index.md │ │ ├── keywords │ │ │ ├── abstract.md │ │ │ ├── access-modifiers.md │ │ │ ├── accessibility-domain.md │ │ │ ├── accessibility-levels.md │ │ │ ├── add.md │ │ │ ├── ascending.md │ │ │ ├── async.md │ │ │ ├── base.md │ │ │ ├── bool.md │ │ │ ├── break.md │ │ │ ├── built-in-types-table.md │ │ │ ├── by.md │ │ │ ├── char.md │ │ │ ├── checked-and-unchecked.md │ │ │ ├── checked.md │ │ │ ├── class.md │ │ │ ├── const.md │ │ │ ├── contextual-keywords.md │ │ │ ├── continue.md │ │ │ ├── default-values-table.md │ │ │ ├── default.md │ │ │ ├── descending.md │ │ │ ├── do.md │ │ │ ├── enum.md │ │ │ ├── equals.md │ │ │ ├── event.md │ │ │ ├── extern-alias.md │ │ │ ├── extern.md │ │ │ ├── false-literal.md │ │ │ ├── fixed-statement.md │ │ │ ├── for.md │ │ │ ├── foreach-in.md │ │ │ ├── formatting-numeric-results-table.md │ │ │ ├── from-clause.md │ │ │ ├── get.md │ │ │ ├── goto.md │ │ │ ├── group-clause.md │ │ │ ├── if-else.md │ │ │ ├── in-generic-modifier.md │ │ │ ├── in-parameter-modifier.md │ │ │ ├── in.md │ │ │ ├── index.md │ │ │ ├── interface.md │ │ │ ├── internal.md │ │ │ ├── into.md │ │ │ ├── is.md │ │ │ ├── join-clause.md │ │ │ ├── let-clause.md │ │ │ ├── lock-statement.md │ │ │ ├── method-parameters.md │ │ │ ├── namespace.md │ │ │ ├── new-constraint.md │ │ │ ├── new-modifier.md │ │ │ ├── null.md │ │ │ ├── on.md │ │ │ ├── orderby-clause.md │ │ │ ├── out-generic-modifier.md │ │ │ ├── out-parameter-modifier.md │ │ │ ├── out.md │ │ │ ├── override.md │ │ │ ├── params.md │ │ │ ├── partial-method.md │ │ │ ├── partial-type.md │ │ │ ├── private-protected.md │ │ │ ├── private.md │ │ │ ├── protected-internal.md │ │ │ ├── protected.md │ │ │ ├── public.md │ │ │ ├── query-keywords.md │ │ │ ├── readonly.md │ │ │ ├── ref.md │ │ │ ├── reference-types.md │ │ │ ├── remove.md │ │ │ ├── restrictions-on-using-accessibility-levels.md │ │ │ ├── return.md │ │ │ ├── sealed.md │ │ │ ├── select-clause.md │ │ │ ├── set.md │ │ │ ├── statement-keywords.md │ │ │ ├── static.md │ │ │ ├── struct.md │ │ │ ├── switch.md │ │ │ ├── this.md │ │ │ ├── throw.md │ │ │ ├── true-literal.md │ │ │ ├── try-catch-finally.md │ │ │ ├── try-catch.md │ │ │ ├── try-finally.md │ │ │ ├── unchecked.md │ │ │ ├── unsafe.md │ │ │ ├── using-directive.md │ │ │ ├── using-statement.md │ │ │ ├── using-static.md │ │ │ ├── using.md │ │ │ ├── value-types-table.md │ │ │ ├── value-types.md │ │ │ ├── value.md │ │ │ ├── var.md │ │ │ ├── virtual.md │ │ │ ├── void.md │ │ │ ├── volatile.md │ │ │ ├── when.md │ │ │ ├── where-clause.md │ │ │ ├── where-generic-type-constraint.md │ │ │ ├── while.md │ │ │ └── yield.md │ │ ├── operators │ │ │ ├── addition-operator.md │ │ │ ├── arithmetic-operators.md │ │ │ ├── assignment-operator.md │ │ │ ├── await.md │ │ │ ├── bitwise-and-shift-operators.md │ │ │ ├── boolean-logical-operators.md │ │ │ ├── comparison-operators.md │ │ │ ├── conditional-operator.md │ │ │ ├── default.md │ │ │ ├── delegate-operator.md │ │ │ ├── equality-operators.md │ │ │ ├── index.md │ │ │ ├── lambda-operator.md │ │ │ ├── member-access-operators.md │ │ │ ├── nameof.md │ │ │ ├── namespace-alias-qualifier.md │ │ │ ├── new-operator.md │ │ │ ├── null-coalescing-operator.md │ │ │ ├── null-forgiving.md │ │ │ ├── operator-overloading.md │ │ │ ├── pointer-related-operators.md │ │ │ ├── sizeof.md │ │ │ ├── stackalloc.md │ │ │ ├── subtraction-operator.md │ │ │ ├── true-false-operators.md │ │ │ ├── type-testing-and-cast.md │ │ │ └── user-defined-conversion-operators.md │ │ ├── preprocessor-directives │ │ │ ├── index.md │ │ │ ├── preprocessor-define.md │ │ │ ├── preprocessor-elif.md │ │ │ ├── preprocessor-else.md │ │ │ ├── preprocessor-endif.md │ │ │ ├── preprocessor-endregion.md │ │ │ ├── preprocessor-error.md │ │ │ ├── preprocessor-if.md │ │ │ ├── preprocessor-line.md │ │ │ ├── preprocessor-pragma-checksum.md │ │ │ ├── preprocessor-pragma-warning.md │ │ │ ├── preprocessor-pragma.md │ │ │ ├── preprocessor-region.md │ │ │ ├── preprocessor-undef.md │ │ │ └── preprocessor-warning.md │ │ ├── proposals │ │ │ └── toc.yml │ │ ├── specification │ │ │ └── toc.yml │ │ └── tokens │ │ │ ├── index.md │ │ │ ├── interpolated.md │ │ │ └── verbatim.md │ ├── linq │ │ ├── create-a-nested-group.md │ │ ├── dynamically-specify-predicate-filters-at-runtime.md │ │ ├── group-query-results.md │ │ ├── group-results-by-contiguous-keys.md │ │ ├── handle-exceptions-in-query-expressions.md │ │ ├── handle-null-values-in-query-expressions.md │ │ ├── index.md │ │ ├── join-by-using-composite-keys.md │ │ ├── linq-in-csharp.md │ │ ├── order-the-results-of-a-join-clause.md │ │ ├── perform-a-subquery-on-a-grouping-operation.md │ │ ├── perform-custom-join-operations.md │ │ ├── perform-grouped-joins.md │ │ ├── perform-inner-joins.md │ │ ├── perform-left-outer-joins.md │ │ ├── query-a-collection-of-objects.md │ │ ├── query-expression-basics.md │ │ ├── return-a-query-from-a-method.md │ │ ├── store-the-results-of-a-query-in-memory.md │ │ └── write-linq-queries.md │ ├── local-functions-vs-lambdas.md │ ├── methods.md │ ├── misc │ │ ├── CS4009.md │ │ ├── cs0003.md │ │ ├── cs0004.md │ │ ├── cs0005.md │ │ ├── cs0008.md │ │ ├── cs0009.md │ │ ├── cs0010.md │ │ ├── cs0011.md │ │ ├── cs0012.md │ │ ├── cs0013.md │ │ ├── cs0014.md │ │ ├── cs0017.md │ │ ├── cs0020.md │ │ ├── cs0021.md │ │ ├── cs0022.md │ │ ├── cs0023.md │ │ ├── cs0025.md │ │ ├── cs0026.md │ │ ├── cs0027.md │ │ ├── cs0028.md │ │ ├── cs0030.md │ │ ├── cs0031.md │ │ ├── cs0035.md │ │ ├── cs0036.md │ │ ├── cs0037.md │ │ ├── cs0040.md │ │ ├── cs0041.md │ │ ├── cs0042.md │ │ ├── cs0043.md │ │ ├── cs0053.md │ │ ├── cs0054.md │ │ ├── cs0055.md │ │ ├── cs0056.md │ │ ├── cs0057.md │ │ ├── cs0058.md │ │ ├── cs0059.md │ │ ├── cs0060.md │ │ ├── cs0061.md │ │ ├── cs0065.md │ │ ├── cs0066.md │ │ ├── cs0067.md │ │ ├── cs0068.md │ │ ├── cs0069.md │ │ ├── cs0070.md │ │ ├── cs0072.md │ │ ├── cs0073.md │ │ ├── cs0074.md │ │ ├── cs0075.md │ │ ├── cs0076.md │ │ ├── cs0077.md │ │ ├── cs0078.md │ │ ├── cs0079.md │ │ ├── cs0080.md │ │ ├── cs0081.md │ │ ├── cs0082.md │ │ ├── cs0100.md │ │ ├── cs0101.md │ │ ├── cs0102.md │ │ ├── cs0104.md │ │ ├── cs0105.md │ │ ├── cs0107.md │ │ ├── cs0109.md │ │ ├── cs0110.md │ │ ├── cs0111.md │ │ ├── cs0112.md │ │ ├── cs0113.md │ │ ├── cs0114.md │ │ ├── cs0117.md │ │ ├── cs0118.md │ │ ├── cs0119.md │ │ ├── cs0121.md │ │ ├── cs0123.md │ │ ├── cs0126.md │ │ ├── cs0127.md │ │ ├── cs0128.md │ │ ├── cs0131.md │ │ ├── cs0132.md │ │ ├── cs0133.md │ │ ├── cs0135.md │ │ ├── cs0136.md │ │ ├── cs0138.md │ │ ├── cs0139.md │ │ ├── cs0140.md │ │ ├── cs0143.md │ │ ├── cs0144.md │ │ ├── cs0145.md │ │ ├── cs0146.md │ │ ├── cs0148.md │ │ ├── cs0149.md │ │ ├── cs0150.md │ │ ├── cs0152.md │ │ ├── cs0153.md │ │ ├── cs0154.md │ │ ├── cs0155.md │ │ ├── cs0156.md │ │ ├── cs0157.md │ │ ├── cs0158.md │ │ ├── cs0159.md │ │ ├── cs0160.md │ │ ├── cs0161.md │ │ ├── cs0162.md │ │ ├── cs0164.md │ │ ├── cs0167.md │ │ ├── cs0168.md │ │ ├── cs0169.md │ │ ├── cs0170.md │ │ ├── cs0171.md │ │ ├── cs0172.md │ │ ├── cs0174.md │ │ ├── cs0175.md │ │ ├── cs0176.md │ │ ├── cs0177.md │ │ ├── cs0179.md │ │ ├── cs0180.md │ │ ├── cs0182.md │ │ ├── cs0183.md │ │ ├── cs0184.md │ │ ├── cs0185.md │ │ ├── cs0186.md │ │ ├── cs0191.md │ │ ├── cs0192.md │ │ ├── cs0193.md │ │ ├── cs0196.md │ │ ├── cs0197.md │ │ ├── cs0198.md │ │ ├── cs0199.md │ │ ├── cs0200.md │ │ ├── cs0202.md │ │ ├── cs0204.md │ │ ├── cs0205.md │ │ ├── cs0206.md │ │ ├── cs0208.md │ │ ├── cs0209.md │ │ ├── cs0210.md │ │ ├── cs0211.md │ │ ├── cs0212.md │ │ ├── cs0213.md │ │ ├── cs0214.md │ │ ├── cs0215.md │ │ ├── cs0216.md │ │ ├── cs0217.md │ │ ├── cs0218.md │ │ ├── cs0219.md │ │ ├── cs0220.md │ │ ├── cs0221.md │ │ ├── cs0225.md │ │ ├── cs0226.md │ │ ├── cs0227.md │ │ ├── cs0228.md │ │ ├── cs0230.md │ │ ├── cs0231.md │ │ ├── cs0236.md │ │ ├── cs0238.md │ │ ├── cs0239.md │ │ ├── cs0241.md │ │ ├── cs0242.md │ │ ├── cs0243.md │ │ ├── cs0244.md │ │ ├── cs0245.md │ │ ├── cs0247.md │ │ ├── cs0248.md │ │ ├── cs0249.md │ │ ├── cs0250.md │ │ ├── cs0251.md │ │ ├── cs0252.md │ │ ├── cs0253.md │ │ ├── cs0254.md │ │ ├── cs0255.md │ │ ├── cs0261.md │ │ ├── cs0262.md │ │ ├── cs0263.md │ │ ├── cs0264.md │ │ ├── cs0265.md │ │ ├── cs0267.md │ │ ├── cs0268.md │ │ ├── cs0271.md │ │ ├── cs0272.md │ │ ├── cs0273.md │ │ ├── cs0274.md │ │ ├── cs0275.md │ │ ├── cs0276.md │ │ ├── cs0277.md │ │ ├── cs0278.md │ │ ├── cs0279.md │ │ ├── cs0280.md │ │ ├── cs0281.md │ │ ├── cs0282.md │ │ ├── cs0283.md │ │ ├── cs0305.md │ │ ├── cs0306.md │ │ ├── cs0307.md │ │ ├── cs0308.md │ │ ├── cs0312.md │ │ ├── cs0313.md │ │ ├── cs0314.md │ │ ├── cs0315.md │ │ ├── cs0316.md │ │ ├── cs0400.md │ │ ├── cs0401.md │ │ ├── cs0402.md │ │ ├── cs0403.md │ │ ├── cs0404.md │ │ ├── cs0405.md │ │ ├── cs0406.md │ │ ├── cs0407.md │ │ ├── cs0409.md │ │ ├── cs0410.md │ │ ├── cs0411.md │ │ ├── cs0412.md │ │ ├── cs0414.md │ │ ├── cs0415.md │ │ ├── cs0416.md │ │ ├── cs0418.md │ │ ├── cs0419.md │ │ ├── cs0422.md │ │ ├── cs0423.md │ │ ├── cs0424.md │ │ ├── cs0425.md │ │ ├── cs0426.md │ │ ├── cs0428.md │ │ ├── cs0430.md │ │ ├── cs0431.md │ │ ├── cs0432.md │ │ ├── cs0434.md │ │ ├── cs0435.md │ │ ├── cs0436.md │ │ ├── cs0437.md │ │ ├── cs0438.md │ │ ├── cs0439.md │ │ ├── cs0440.md │ │ ├── cs0441.md │ │ ├── cs0442.md │ │ ├── cs0443.md │ │ ├── cs0444.md │ │ ├── cs0447.md │ │ ├── cs0448.md │ │ ├── cs0449.md │ │ ├── cs0450.md │ │ ├── cs0451.md │ │ ├── cs0452.md │ │ ├── cs0453.md │ │ ├── cs0454.md │ │ ├── cs0455.md │ │ ├── cs0456.md │ │ ├── cs0457.md │ │ ├── cs0458.md │ │ ├── cs0459.md │ │ ├── cs0460.md │ │ ├── cs0462.md │ │ ├── cs0463.md │ │ ├── cs0464.md │ │ ├── cs0466.md │ │ ├── cs0468.md │ │ ├── cs0469.md │ │ ├── cs0470.md │ │ ├── cs0471.md │ │ ├── cs0472.md │ │ ├── cs0473.md │ │ ├── cs0500.md │ │ ├── cs0501.md │ │ ├── cs0502.md │ │ ├── cs0503.md │ │ ├── cs0505.md │ │ ├── cs0506.md │ │ ├── cs0508.md │ │ ├── cs0509.md │ │ ├── cs0513.md │ │ ├── cs0514.md │ │ ├── cs0515.md │ │ ├── cs0516.md │ │ ├── cs0517.md │ │ ├── cs0520.md │ │ ├── cs0522.md │ │ ├── cs0524.md │ │ ├── cs0525.md │ │ ├── cs0526.md │ │ ├── cs0527.md │ │ ├── cs0528.md │ │ ├── cs0529.md │ │ ├── cs0531.md │ │ ├── cs0533.md │ │ ├── cs0534.md │ │ ├── cs0535.md │ │ ├── cs0537.md │ │ ├── cs0538.md │ │ ├── cs0539.md │ │ ├── cs0540.md │ │ ├── cs0541.md │ │ ├── cs0542.md │ │ ├── cs0543.md │ │ ├── cs0544.md │ │ ├── cs0546.md │ │ ├── cs0547.md │ │ ├── cs0548.md │ │ ├── cs0549.md │ │ ├── cs0550.md │ │ ├── cs0551.md │ │ ├── cs0553.md │ │ ├── cs0554.md │ │ ├── cs0555.md │ │ ├── cs0556.md │ │ ├── cs0557.md │ │ ├── cs0558.md │ │ ├── cs0559.md │ │ ├── cs0562.md │ │ ├── cs0564.md │ │ ├── cs0567.md │ │ ├── cs0568.md │ │ ├── cs0569.md │ │ ├── cs0572.md │ │ ├── cs0573.md │ │ ├── cs0574.md │ │ ├── cs0575.md │ │ ├── cs0576.md │ │ ├── cs0577.md │ │ ├── cs0578.md │ │ ├── cs0582.md │ │ ├── cs0583.md │ │ ├── cs0584.md │ │ ├── cs0585.md │ │ ├── cs0586.md │ │ ├── cs0587.md │ │ ├── cs0588.md │ │ ├── cs0589.md │ │ ├── cs0590.md │ │ ├── cs0591.md │ │ ├── cs0594.md │ │ ├── cs0596.md │ │ ├── cs0599.md │ │ ├── cs0601.md │ │ ├── cs0602.md │ │ ├── cs0609.md │ │ ├── cs0610.md │ │ ├── cs0611.md │ │ ├── cs0612.md │ │ ├── cs0617.md │ │ ├── cs0619.md │ │ ├── cs0620.md │ │ ├── cs0621.md │ │ ├── cs0622.md │ │ ├── cs0623.md │ │ ├── cs0625.md │ │ ├── cs0626.md │ │ ├── cs0628.md │ │ ├── cs0629.md │ │ ├── cs0631.md │ │ ├── cs0633.md │ │ ├── cs0635.md │ │ ├── cs0636.md │ │ ├── cs0637.md │ │ ├── cs0641.md │ │ ├── cs0642.md │ │ ├── cs0643.md │ │ ├── cs0644.md │ │ ├── cs0645.md │ │ ├── cs0646.md │ │ ├── cs0647.md │ │ ├── cs0648.md │ │ ├── cs0649.md │ │ ├── cs0652.md │ │ ├── cs0653.md │ │ ├── cs0655.md │ │ ├── cs0656.md │ │ ├── cs0657.md │ │ ├── cs0658.md │ │ ├── cs0659.md │ │ ├── cs0660.md │ │ ├── cs0661.md │ │ ├── cs0662.md │ │ ├── cs0663.md │ │ ├── cs0664.md │ │ ├── cs0665.md │ │ ├── cs0666.md │ │ ├── cs0667.md │ │ ├── cs0668.md │ │ ├── cs0669.md │ │ ├── cs0670.md │ │ ├── cs0672.md │ │ ├── cs0673.md │ │ ├── cs0674.md │ │ ├── cs0677.md │ │ ├── cs0678.md │ │ ├── cs0681.md │ │ ├── cs0682.md │ │ ├── cs0683.md │ │ ├── cs0684.md │ │ ├── cs0685.md │ │ ├── cs0687.md │ │ ├── cs0688.md │ │ ├── cs0689.md │ │ ├── cs0690.md │ │ ├── cs0692.md │ │ ├── cs0693.md │ │ ├── cs0694.md │ │ ├── cs0695.md │ │ ├── cs0698.md │ │ ├── cs0699.md │ │ ├── cs0701.md │ │ ├── cs0704.md │ │ ├── cs0706.md │ │ ├── cs0708.md │ │ ├── cs0709.md │ │ ├── cs0710.md │ │ ├── cs0711.md │ │ ├── cs0712.md │ │ ├── cs0713.md │ │ ├── cs0714.md │ │ ├── cs0715.md │ │ ├── cs0716.md │ │ ├── cs0717.md │ │ ├── cs0718.md │ │ ├── cs0719.md │ │ ├── cs0720.md │ │ ├── cs0721.md │ │ ├── cs0722.md │ │ ├── cs0723.md │ │ ├── cs0724.md │ │ ├── cs0726.md │ │ ├── cs0727.md │ │ ├── cs0728.md │ │ ├── cs0729.md │ │ ├── cs0730.md │ │ ├── cs0733.md │ │ ├── cs0734.md │ │ ├── cs0735.md │ │ ├── cs0736.md │ │ ├── cs0737.md │ │ ├── cs0738.md │ │ ├── cs0739.md │ │ ├── cs0742.md │ │ ├── cs0743.md │ │ ├── cs0744.md │ │ ├── cs0745.md │ │ ├── cs0746.md │ │ ├── cs0747.md │ │ ├── cs0748.md │ │ ├── cs0750.md │ │ ├── cs0751.md │ │ ├── cs0752.md │ │ ├── cs0753.md │ │ ├── cs0754.md │ │ ├── cs0755.md │ │ ├── cs0756.md │ │ ├── cs0757.md │ │ ├── cs0758.md │ │ ├── cs0759.md │ │ ├── cs0761.md │ │ ├── cs0762.md │ │ ├── cs0763.md │ │ ├── cs0764.md │ │ ├── cs0765.md │ │ ├── cs0766.md │ │ ├── cs0809.md │ │ ├── cs0811.md │ │ ├── cs0815.md │ │ ├── cs0818.md │ │ ├── cs0819.md │ │ ├── cs0820.md │ │ ├── cs0821.md │ │ ├── cs0822.md │ │ ├── cs0824.md │ │ ├── cs0825.md │ │ ├── cs0828.md │ │ ├── cs0831.md │ │ ├── cs0832.md │ │ ├── cs0833.md │ │ ├── cs0835.md │ │ ├── cs0836.md │ │ ├── cs0837.md │ │ ├── cs0838.md │ │ ├── cs0839.md │ │ ├── cs0841.md │ │ ├── cs0842.md │ │ ├── cs0844.md │ │ ├── cs1002.md │ │ ├── cs1003.md │ │ ├── cs1004.md │ │ ├── cs1007.md │ │ ├── cs1008.md │ │ ├── cs1010.md │ │ ├── cs1011.md │ │ ├── cs1012.md │ │ ├── cs1013.md │ │ ├── cs1014.md │ │ ├── cs1015.md │ │ ├── cs1016.md │ │ ├── cs1017.md │ │ ├── cs1020.md │ │ ├── cs1021.md │ │ ├── cs1022.md │ │ ├── cs1023.md │ │ ├── cs1024.md │ │ ├── cs1025.md │ │ ├── cs1027.md │ │ ├── cs1028.md │ │ ├── cs1030.md │ │ ├── cs1031.md │ │ ├── cs1032.md │ │ ├── cs1033.md │ │ ├── cs1034.md │ │ ├── cs1035.md │ │ ├── cs1036.md │ │ ├── cs1037.md │ │ ├── cs1038.md │ │ ├── cs1039.md │ │ ├── cs1040.md │ │ ├── cs1041.md │ │ ├── cs1043.md │ │ ├── cs1044.md │ │ ├── cs1055.md │ │ ├── cs1056.md │ │ ├── cs1057.md │ │ ├── cs1059.md │ │ ├── cs1100.md │ │ ├── cs1101.md │ │ ├── cs1102.md │ │ ├── cs1103.md │ │ ├── cs1104.md │ │ ├── cs1105.md │ │ ├── cs1106.md │ │ ├── cs1107.md │ │ ├── cs1108.md │ │ ├── cs1109.md │ │ ├── cs1110.md │ │ ├── cs1113.md │ │ ├── cs1200.md │ │ ├── cs1201.md │ │ ├── cs1202.md │ │ ├── cs1203.md │ │ ├── cs1503.md │ │ ├── cs1504.md │ │ ├── cs1507.md │ │ ├── cs1508.md │ │ ├── cs1509.md │ │ ├── cs1510.md │ │ ├── cs1511.md │ │ ├── cs1512.md │ │ ├── cs1513.md │ │ ├── cs1514.md │ │ ├── cs1515.md │ │ ├── cs1517.md │ │ ├── cs1518.md │ │ ├── cs1520.md │ │ ├── cs1521.md │ │ ├── cs1522.md │ │ ├── cs1524.md │ │ ├── cs1525.md │ │ ├── cs1526.md │ │ ├── cs1527.md │ │ ├── cs1528.md │ │ ├── cs1529.md │ │ ├── cs1530.md │ │ ├── cs1534.md │ │ ├── cs1535.md │ │ ├── cs1536.md │ │ ├── cs1537.md │ │ ├── cs1541.md │ │ ├── cs1542.md │ │ ├── cs1545.md │ │ ├── cs1547.md │ │ ├── cs1551.md │ │ ├── cs1552.md │ │ ├── cs1553.md │ │ ├── cs1554.md │ │ ├── cs1555.md │ │ ├── cs1556.md │ │ ├── cs1557.md │ │ ├── cs1558.md │ │ ├── cs1559.md │ │ ├── cs1560.md │ │ ├── cs1561.md │ │ ├── cs1562.md │ │ ├── cs1563.md │ │ ├── cs1565.md │ │ ├── cs1566.md │ │ ├── cs1569.md │ │ ├── cs1570.md │ │ ├── cs1571.md │ │ ├── cs1572.md │ │ ├── cs1573.md │ │ ├── cs1574.md │ │ ├── cs1575.md │ │ ├── cs1576.md │ │ ├── cs1577.md │ │ ├── cs1578.md │ │ ├── cs1580.md │ │ ├── cs1581.md │ │ ├── cs1583.md │ │ ├── cs1584.md │ │ ├── cs1585.md │ │ ├── cs1586.md │ │ ├── cs1587.md │ │ ├── cs1588.md │ │ ├── cs1589.md │ │ ├── cs1590.md │ │ ├── cs1592.md │ │ ├── cs1593.md │ │ ├── cs1594.md │ │ ├── cs1597.md │ │ ├── cs1599.md │ │ ├── cs1600.md │ │ ├── cs1601.md │ │ ├── cs1604.md │ │ ├── cs1605.md │ │ ├── cs1606.md │ │ ├── cs1608.md │ │ ├── cs1609.md │ │ ├── cs1611.md │ │ ├── cs1613.md │ │ ├── cs1615.md │ │ ├── cs1617.md │ │ ├── cs1618.md │ │ ├── cs1619.md │ │ ├── cs1620.md │ │ ├── cs1621.md │ │ ├── cs1622.md │ │ ├── cs1623.md │ │ ├── cs1624.md │ │ ├── cs1625.md │ │ ├── cs1626.md │ │ ├── cs1627.md │ │ ├── cs1628.md │ │ ├── cs1629.md │ │ ├── cs1630.md │ │ ├── cs1631.md │ │ ├── cs1632.md │ │ ├── cs1633.md │ │ ├── cs1634.md │ │ ├── cs1635.md │ │ ├── cs1637.md │ │ ├── cs1638.md │ │ ├── cs1639.md │ │ ├── cs1641.md │ │ ├── cs1642.md │ │ ├── cs1643.md │ │ ├── cs1645.md │ │ ├── cs1646.md │ │ ├── cs1647.md │ │ ├── cs1648.md │ │ ├── cs1649.md │ │ ├── cs1650.md │ │ ├── cs1651.md │ │ ├── cs1654.md │ │ ├── cs1655.md │ │ ├── cs1657.md │ │ ├── cs1660.md │ │ ├── cs1661.md │ │ ├── cs1662.md │ │ ├── cs1663.md │ │ ├── cs1664.md │ │ ├── cs1665.md │ │ ├── cs1666.md │ │ ├── cs1667.md │ │ ├── cs1668.md │ │ ├── cs1670.md │ │ ├── cs1671.md │ │ ├── cs1672.md │ │ ├── cs1673.md │ │ ├── cs1675.md │ │ ├── cs1676.md │ │ ├── cs1677.md │ │ ├── cs1678.md │ │ ├── cs1679.md │ │ ├── cs1680.md │ │ ├── cs1681.md │ │ ├── cs1682.md │ │ ├── cs1684.md │ │ ├── cs1686.md │ │ ├── cs1687.md │ │ ├── cs1688.md │ │ ├── cs1689.md │ │ ├── cs1692.md │ │ ├── cs1694.md │ │ ├── cs1695.md │ │ ├── cs1696.md │ │ ├── cs1697.md │ │ ├── cs1698.md │ │ ├── cs1702.md │ │ ├── cs1706.md │ │ ├── cs1707.md │ │ ├── cs1709.md │ │ ├── cs1710.md │ │ ├── cs1711.md │ │ ├── cs1712.md │ │ ├── cs1713.md │ │ ├── cs1714.md │ │ ├── cs1715.md │ │ ├── cs1717.md │ │ ├── cs1718.md │ │ ├── cs1719.md │ │ ├── cs1720.md │ │ ├── cs1722.md │ │ ├── cs1723.md │ │ ├── cs1724.md │ │ ├── cs1725.md │ │ ├── cs1727.md │ │ ├── cs1728.md │ │ ├── cs1730.md │ │ ├── cs1731.md │ │ ├── cs1732.md │ │ ├── cs1733.md │ │ ├── cs1900.md │ │ ├── cs1902.md │ │ ├── cs1906.md │ │ ├── cs1908.md │ │ ├── cs1909.md │ │ ├── cs1910.md │ │ ├── cs1911.md │ │ ├── cs1912.md │ │ ├── cs1913.md │ │ ├── cs1914.md │ │ ├── cs1917.md │ │ ├── cs1918.md │ │ ├── cs1920.md │ │ ├── cs1922.md │ │ ├── cs1925.md │ │ ├── cs1927.md │ │ ├── cs1928.md │ │ ├── cs1929.md │ │ ├── cs1930.md │ │ ├── cs1931.md │ │ ├── cs1932.md │ │ ├── cs1934.md │ │ ├── cs1935.md │ │ ├── cs1937.md │ │ ├── cs1938.md │ │ ├── cs1939.md │ │ ├── cs1940.md │ │ ├── cs1944.md │ │ ├── cs1945.md │ │ ├── cs1947.md │ │ ├── cs1948.md │ │ ├── cs1949.md │ │ ├── cs1950.md │ │ ├── cs1951.md │ │ ├── cs1952.md │ │ ├── cs1953.md │ │ ├── cs1954.md │ │ ├── cs1955.md │ │ ├── cs1957.md │ │ ├── cs1958.md │ │ ├── cs1959.md │ │ ├── cs2001.md │ │ ├── cs2002.md │ │ ├── cs2003.md │ │ ├── cs2005.md │ │ ├── cs2006.md │ │ ├── cs2007.md │ │ ├── cs2008.md │ │ ├── cs2011.md │ │ ├── cs2012.md │ │ ├── cs2013.md │ │ ├── cs2014.md │ │ ├── cs2015.md │ │ ├── cs2016.md │ │ ├── cs2017.md │ │ ├── cs2018.md │ │ ├── cs2019.md │ │ ├── cs2020.md │ │ ├── cs2021.md │ │ ├── cs2022.md │ │ ├── cs2023.md │ │ ├── cs2024.md │ │ ├── cs2029.md │ │ ├── cs2033.md │ │ ├── cs2034.md │ │ ├── cs2035.md │ │ ├── cs2036.md │ │ ├── cs3000.md │ │ ├── cs3001.md │ │ ├── cs3002.md │ │ ├── cs3004.md │ │ ├── cs3005.md │ │ ├── cs3006.md │ │ ├── cs3008.md │ │ ├── cs3010.md │ │ ├── cs3011.md │ │ ├── cs3012.md │ │ ├── cs3013.md │ │ ├── cs3014.md │ │ ├── cs3015.md │ │ ├── cs3016.md │ │ ├── cs3017.md │ │ ├── cs3018.md │ │ ├── cs3019.md │ │ ├── cs3021.md │ │ ├── cs3022.md │ │ ├── cs3023.md │ │ ├── cs3024.md │ │ ├── cs3026.md │ │ ├── cs3027.md │ │ ├── cs5000.md │ │ ├── cs5001.md │ │ └── sorry-we-don-t-have-specifics-on-this-csharp-error.md │ ├── modern-events.md │ ├── nullable-attributes.md │ ├── nullable-references.md │ ├── pattern-matching.md │ ├── programming-guide │ │ ├── arrays │ │ │ ├── arrays-as-objects.md │ │ │ ├── implicitly-typed-arrays.md │ │ │ ├── index.md │ │ │ ├── jagged-arrays.md │ │ │ ├── multidimensional-arrays.md │ │ │ ├── passing-arrays-as-arguments.md │ │ │ ├── single-dimensional-arrays.md │ │ │ └── using-foreach-with-arrays.md │ │ ├── classes-and-structs │ │ │ ├── abstract-and-sealed-classes-and-class-members.md │ │ │ ├── access-modifiers.md │ │ │ ├── anonymous-types.md │ │ │ ├── auto-implemented-properties.md │ │ │ ├── classes.md │ │ │ ├── constants.md │ │ │ ├── constructors.md │ │ │ ├── destructors.md │ │ │ ├── extension-methods.md │ │ │ ├── fields.md │ │ │ ├── how-to-create-a-new-method-for-an-enumeration.md │ │ │ ├── how-to-declare-and-use-read-write-properties.md │ │ │ ├── how-to-define-abstract-properties.md │ │ │ ├── how-to-define-constants.md │ │ │ ├── how-to-implement-a-lightweight-class-with-auto-implemented-properties.md │ │ │ ├── how-to-implement-and-call-a-custom-extension-method.md │ │ │ ├── how-to-initialize-a-dictionary-with-a-collection-initializer.md │ │ │ ├── how-to-initialize-objects-by-using-an-object-initializer.md │ │ │ ├── how-to-know-the-difference-passing-a-struct-and-passing-a-class-to-a-method.md │ │ │ ├── how-to-override-the-tostring-method.md │ │ │ ├── how-to-return-subsets-of-element-properties-in-a-query.md │ │ │ ├── how-to-use-implicitly-typed-local-variables-and-arrays-in-a-query-expression.md │ │ │ ├── how-to-use-named-and-optional-arguments-in-office-programming.md │ │ │ ├── how-to-write-a-copy-constructor.md │ │ │ ├── implicitly-typed-local-variables.md │ │ │ ├── index.md │ │ │ ├── inheritance.md │ │ │ ├── instance-constructors.md │ │ │ ├── interface-properties.md │ │ │ ├── knowing-when-to-use-override-and-new-keywords.md │ │ │ ├── local-functions.md │ │ │ ├── media │ │ │ │ ├── how-to-use-named-and-optional-arguments-in-office-programming │ │ │ │ │ └── convert-table-parameters.png │ │ │ │ ├── inheritance │ │ │ │ │ └── class-inheritance-diagram.png │ │ │ │ └── named-and-optional-arguments │ │ │ │ │ ├── autoformat-method-parameters.png │ │ │ │ │ └── optional-examplemethod-parameters.png │ │ │ ├── members.md │ │ │ ├── methods.md │ │ │ ├── named-and-optional-arguments.md │ │ │ ├── nested-types.md │ │ │ ├── object-and-collection-initializers.md │ │ │ ├── objects.md │ │ │ ├── partial-classes-and-methods.md │ │ │ ├── passing-parameters.md │ │ │ ├── passing-reference-type-parameters.md │ │ │ ├── passing-value-type-parameters.md │ │ │ ├── polymorphism.md │ │ │ ├── private-constructors.md │ │ │ ├── properties.md │ │ │ ├── ref-returns.md │ │ │ ├── restricting-accessor-accessibility.md │ │ │ ├── static-classes-and-static-class-members.md │ │ │ ├── static-constructors.md │ │ │ ├── structs.md │ │ │ ├── using-constructors.md │ │ │ ├── using-properties.md │ │ │ ├── using-structs.md │ │ │ └── versioning-with-the-override-and-new-keywords.md │ │ ├── concepts │ │ │ ├── async │ │ │ │ ├── async-return-types.md │ │ │ │ ├── cancel-an-async-task-or-a-list-of-tasks.md │ │ │ │ ├── cancel-async-tasks-after-a-period-of-time.md │ │ │ │ ├── cancel-remaining-async-tasks-after-one-is-complete.md │ │ │ │ ├── control-flow-in-async-programs.md │ │ │ │ ├── fine-tuning-your-async-application.md │ │ │ │ ├── handling-reentrancy-in-async-apps.md │ │ │ │ ├── how-to-extend-the-async-walkthrough-by-using-task-whenall.md │ │ │ │ ├── how-to-make-multiple-web-requests-in-parallel-by-using-async-and-await.md │ │ │ │ ├── index.md │ │ │ │ ├── media │ │ │ │ │ ├── asynctrace-five.png │ │ │ │ │ ├── asynctrace-four.png │ │ │ │ │ ├── asynctrace-onetwo.png │ │ │ │ │ ├── asynctrace-six.png │ │ │ │ │ ├── asynctrace-three.png │ │ │ │ │ ├── fine-tuning-your-async-application │ │ │ │ │ │ └── cancellation-and-start-button.png │ │ │ │ │ └── task-asynchronous-programming-model │ │ │ │ │ │ └── navigation-trace-async-program.png │ │ │ │ ├── start-multiple-async-tasks-and-process-them-as-they-complete.md │ │ │ │ ├── task-asynchronous-programming-model.md │ │ │ │ ├── using-async-for-file-access.md │ │ │ │ └── walkthrough-accessing-the-web-by-using-async-and-await.md │ │ │ ├── attributes │ │ │ │ ├── accessing-attributes-by-using-reflection.md │ │ │ │ ├── attributeusage.md │ │ │ │ ├── common-attributes.md │ │ │ │ ├── creating-custom-attributes.md │ │ │ │ ├── how-to-create-a-c-cpp-union-by-using-attributes.md │ │ │ │ └── index.md │ │ │ ├── caller-information.md │ │ │ ├── collections.md │ │ │ ├── covariance-contravariance │ │ │ │ ├── creating-variant-generic-interfaces.md │ │ │ │ ├── index.md │ │ │ │ ├── using-variance-for-func-and-action-generic-delegates.md │ │ │ │ ├── using-variance-in-delegates.md │ │ │ │ ├── using-variance-in-interfaces-for-generic-collections.md │ │ │ │ ├── variance-in-delegates.md │ │ │ │ └── variance-in-generic-interfaces.md │ │ │ ├── expression-trees │ │ │ │ ├── debugging-expression-trees-in-visual-studio.md │ │ │ │ ├── debugview-syntax.md │ │ │ │ ├── how-to-execute-expression-trees.md │ │ │ │ ├── how-to-modify-expression-trees.md │ │ │ │ ├── how-to-use-expression-trees-to-build-dynamic-queries.md │ │ │ │ ├── index.md │ │ │ │ └── media │ │ │ │ │ └── debugging-expression-trees-in-visual-studio │ │ │ │ │ ├── debugview-expression-tree.png │ │ │ │ │ ├── expression-to-string-visualizer.png │ │ │ │ │ ├── expression-tree-visualizers.png │ │ │ │ │ ├── readable-expressions-visualizer.png │ │ │ │ │ └── string-visualizer-debugview.png │ │ │ ├── index.md │ │ │ ├── iterators.md │ │ │ ├── linq │ │ │ │ ├── adding-elements-attributes-and-nodes-to-an-xml-tree.md │ │ │ │ ├── aggregation-operations.md │ │ │ │ ├── applicability-of-functional-transformation.md │ │ │ │ ├── atomized-xname-and-xnamespace-objects-linq-to-xml.md │ │ │ │ ├── basic-linq-query-operations.md │ │ │ │ ├── basic-queries-linq-to-xml.md │ │ │ │ ├── chaining-queries-example.md │ │ │ │ ├── chaining-standard-query-operators-together.md │ │ │ │ ├── classification-of-standard-query-operators-by-manner-of-execution.md │ │ │ │ ├── comparison-of-xpath-and-linq-to-xml.md │ │ │ │ ├── concatenation-operations.md │ │ │ │ ├── concepts-and-terminology-functional-transformation.md │ │ │ │ ├── converting-data-types.md │ │ │ │ ├── creating-the-source-office-open-xml-document.md │ │ │ │ ├── creating-xml-trees-linq-to-xml-2.md │ │ │ │ ├── data-transformations-with-linq.md │ │ │ │ ├── deferred-execution-and-lazy-evaluation-in-linq-to-xml.md │ │ │ │ ├── deferred-execution-example.md │ │ │ │ ├── element-operations.md │ │ │ │ ├── enabling-a-data-source-for-linq-querying1.md │ │ │ │ ├── equality-operations.md │ │ │ │ ├── example-that-outputs-office-open-xml-document-parts.md │ │ │ │ ├── features-that-support-linq.md │ │ │ │ ├── filtering-data.md │ │ │ │ ├── finding-text-in-word-documents.md │ │ │ │ ├── finding-the-default-paragraph-style.md │ │ │ │ ├── functional-construction-linq-to-xml.md │ │ │ │ ├── functional-programming-vs-imperative-programming.md │ │ │ │ ├── functional-transformation-of-xml.md │ │ │ │ ├── functional-vs-procedural-programming-linq-to-xml.md │ │ │ │ ├── generation-operations.md │ │ │ │ ├── grouping-data.md │ │ │ │ ├── how-to-add-custom-methods-for-linq-queries.md │ │ │ │ ├── how-to-build-linq-to-xml-examples.md │ │ │ │ ├── how-to-calculate-intermediate-values.md │ │ │ │ ├── how-to-catch-parsing-errors.md │ │ │ │ ├── how-to-chain-axis-method-calls-linq-to-xml.md │ │ │ │ ├── how-to-change-the-namespace-for-an-entire-xml-tree.md │ │ │ │ ├── how-to-combine-and-compare-string-collections-linq.md │ │ │ │ ├── how-to-combine-linq-queries-with-regular-expressions.md │ │ │ │ ├── how-to-compare-the-contents-of-two-folders-linq.md │ │ │ │ ├── how-to-compute-column-values-in-a-csv-text-file-linq.md │ │ │ │ ├── how-to-control-namespace-prefixes-linq-to-xml.md │ │ │ │ ├── how-to-control-the-type-of-a-projection.md │ │ │ │ ├── how-to-count-occurrences-of-a-word-in-a-string-linq.md │ │ │ │ ├── how-to-create-a-document-with-namespaces-linq-to-xml.md │ │ │ │ ├── how-to-create-a-tree-from-an-xmlreader.md │ │ │ │ ├── how-to-create-hierarchy-using-grouping.md │ │ │ │ ├── how-to-debug-empty-query-results-sets.md │ │ │ │ ├── how-to-filter-on-an-attribute-xpath-linq-to-xml.md │ │ │ │ ├── how-to-filter-on-an-optional-element.md │ │ │ │ ├── how-to-filter-on-element-names-linq-to-xml.md │ │ │ │ ├── how-to-find-a-child-element-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-a-list-of-child-elements-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-a-single-descendant-using-the-descendants-method.md │ │ │ │ ├── how-to-find-a-union-of-two-location-paths-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-all-nodes-in-a-namespace.md │ │ │ │ ├── how-to-find-an-attribute-of-the-parent-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-an-element-with-a-specific-attribute.md │ │ │ │ ├── how-to-find-an-element-with-a-specific-child-element.md │ │ │ │ ├── how-to-find-attributes-of-siblings-with-a-specific-name-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-child-elements-based-on-position-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-descendant-elements-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-descendants-of-a-child-element-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-descendants-with-a-specific-element-name.md │ │ │ │ ├── how-to-find-elements-in-a-namespace-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-elements-with-a-specific-attribute-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-preceding-siblings-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-related-elements-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-sibling-nodes-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-the-immediate-preceding-sibling-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-the-root-element-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-the-set-difference-between-two-lists-linq.md │ │ │ │ ├── how-to-generate-text-files-from-xml.md │ │ │ │ ├── how-to-generate-xml-from-csv-files.md │ │ │ │ ├── how-to-group-files-by-extension-linq.md │ │ │ │ ├── how-to-join-content-from-dissimilar-files-linq.md │ │ │ │ ├── how-to-join-two-collections-linq-to-xml.md │ │ │ │ ├── how-to-list-all-nodes-in-a-tree.md │ │ │ │ ├── how-to-load-xml-from-a-file.md │ │ │ │ ├── how-to-modify-an-office-open-xml-document.md │ │ │ │ ├── how-to-parse-a-string.md │ │ │ │ ├── how-to-perform-streaming-transform-of-large-xml-documents.md │ │ │ │ ├── how-to-perform-streaming-transformations-of-text-to-xml.md │ │ │ │ ├── how-to-populate-an-xml-tree-from-the-file-system.md │ │ │ │ ├── how-to-populate-an-xml-tree-with-an-xmlwriter-linq-to-xml.md │ │ │ │ ├── how-to-populate-object-collections-from-multiple-sources-linq.md │ │ │ │ ├── how-to-project-a-new-type-linq-to-xml.md │ │ │ │ ├── how-to-project-an-anonymous-type.md │ │ │ │ ├── how-to-project-an-object-graph.md │ │ │ │ ├── how-to-query-an-arraylist-with-linq.md │ │ │ │ ├── how-to-query-an-assembly-s-metadata-with-reflection-linq.md │ │ │ │ ├── how-to-query-for-characters-in-a-string-linq.md │ │ │ │ ├── how-to-query-for-duplicate-files-in-a-directory-tree-linq.md │ │ │ │ ├── how-to-query-for-files-with-a-specified-attribute-or-name.md │ │ │ │ ├── how-to-query-for-sentences-that-contain-a-specified-set-of-words-linq.md │ │ │ │ ├── how-to-query-for-the-largest-file-or-files-in-a-directory-tree-linq.md │ │ │ │ ├── how-to-query-for-the-total-number-of-bytes-in-a-set-of-folders-linq.md │ │ │ │ ├── how-to-query-linq-to-xml-using-xpath.md │ │ │ │ ├── how-to-query-the-contents-of-files-in-a-folder-lin.md │ │ │ │ ├── how-to-read-and-write-an-encoded-document.md │ │ │ │ ├── how-to-reorder-the-fields-of-a-delimited-file-linq.md │ │ │ │ ├── how-to-retrieve-a-collection-of-attributes-linq-to-xml.md │ │ │ │ ├── how-to-retrieve-a-collection-of-elements-linq-to-xml.md │ │ │ │ ├── how-to-retrieve-a-single-attribute-linq-to-xml.md │ │ │ │ ├── how-to-retrieve-a-single-child-element-linq-to-xml.md │ │ │ │ ├── how-to-retrieve-paragraphs-from-an-office-open-xml-document.md │ │ │ │ ├── how-to-retrieve-the-shallow-value-of-an-element.md │ │ │ │ ├── how-to-retrieve-the-value-of-an-attribute-linq-to-xml.md │ │ │ │ ├── how-to-retrieve-the-value-of-an-element-linq-to-xml.md │ │ │ │ ├── how-to-serialize-using-datacontractserializer.md │ │ │ │ ├── how-to-serialize-using-xmlserializer.md │ │ │ │ ├── how-to-sort-elements-on-multiple-keys.md │ │ │ │ ├── how-to-sort-elements.md │ │ │ │ ├── how-to-sort-or-filter-text-data-by-any-word-or-field-linq.md │ │ │ │ ├── how-to-split-a-file-into-many-files-by-using-groups-linq.md │ │ │ │ ├── how-to-stream-xml-fragments-from-an-xmlreader.md │ │ │ │ ├── how-to-stream-xml-fragments-with-access-to-header-information.md │ │ │ │ ├── how-to-transform-the-shape-of-an-xml-tree.md │ │ │ │ ├── how-to-use-annotations-to-transform-linq-to-xml-trees-in-an-xslt-style.md │ │ │ │ ├── how-to-validate-using-xsd-linq-to-xml.md │ │ │ │ ├── how-to-work-with-dictionaries-using-linq-to-xml.md │ │ │ │ ├── how-to-write-a-linq-to-xml-axis-method.md │ │ │ │ ├── how-to-write-a-query-that-finds-elements-based-on-context.md │ │ │ │ ├── how-to-write-queries-on-xml-in-namespaces.md │ │ │ │ ├── how-to-write-queries-with-complex-filtering.md │ │ │ │ ├── in-memory-xml-tree-modification-vs-functional-construction-linq-to-xml.md │ │ │ │ ├── index.md │ │ │ │ ├── intermediate-materialization.md │ │ │ │ ├── introduction-to-linq-queries.md │ │ │ │ ├── introduction-to-pure-functional-transformations.md │ │ │ │ ├── join-operations.md │ │ │ │ ├── linq-and-file-directories.md │ │ │ │ ├── linq-and-generic-types.md │ │ │ │ ├── linq-and-strings.md │ │ │ │ ├── linq-to-adonet-portal-page.md │ │ │ │ ├── linq-to-objects.md │ │ │ │ ├── linq-to-xml-annotations.md │ │ │ │ ├── linq-to-xml-axes-overview.md │ │ │ │ ├── linq-to-xml-classes-overview.md │ │ │ │ ├── linq-to-xml-events.md │ │ │ │ ├── linq-to-xml-overview.md │ │ │ │ ├── linq-to-xml-security.md │ │ │ │ ├── linq-to-xml-vs-dom.md │ │ │ │ ├── linq-to-xml-vs-other-xml-technologies.md │ │ │ │ ├── maintaining-name-value-pairs.md │ │ │ │ ├── media │ │ │ │ │ ├── aggregation-operations │ │ │ │ │ │ └── linq-aggregation-operations.png │ │ │ │ │ ├── concatenation-operations │ │ │ │ │ │ └── concatenation-two-sequences.png │ │ │ │ │ ├── filtering-data │ │ │ │ │ │ └── linq-filter-operation.png │ │ │ │ │ ├── grouping-data │ │ │ │ │ │ └── linq-group-operation.png │ │ │ │ │ ├── introduction-to-linq-queries │ │ │ │ │ │ └── linq-query-complete-operation.png │ │ │ │ │ ├── introduction-to-linq │ │ │ │ │ │ └── linq-query-intellisense.png │ │ │ │ │ ├── join-operations │ │ │ │ │ │ └── join-method-overlapping-circles.png │ │ │ │ │ ├── partitioning-data │ │ │ │ │ │ └── linq-partitioning-operations.png │ │ │ │ │ ├── projection-operations │ │ │ │ │ │ ├── select-action-graphic.png │ │ │ │ │ │ └── select-many-action-graphic.png │ │ │ │ │ ├── quantifier-operations │ │ │ │ │ │ └── linq-quantifier-operations.png │ │ │ │ │ ├── query-syntax-and-method-syntax-in-linq │ │ │ │ │ │ └── standard-query-operators.png │ │ │ │ │ ├── set-operations │ │ │ │ │ │ ├── distinct-method-behavior.png │ │ │ │ │ │ ├── except-behavior-graphic.png │ │ │ │ │ │ ├── intersection-two-sequences.png │ │ │ │ │ │ └── union-operation-two-sequences.png │ │ │ │ │ ├── sorting-data │ │ │ │ │ │ └── alphabetical-sort-operation.png │ │ │ │ │ └── type-relationships-in-linq-query-operations │ │ │ │ │ │ ├── linq-complex-query-transform-data-type.png │ │ │ │ │ │ ├── linq-query-data-type-relation.png │ │ │ │ │ │ ├── linq-query-transform-data-type.png │ │ │ │ │ │ └── linq-type-flow-implicit-typing.png │ │ │ │ ├── mixed-declarative-code-imperative-code-bugs-linq-to-xml.md │ │ │ │ ├── modifying-elements-attributes-and-nodes-in-an-xml-tree.md │ │ │ │ ├── namespaces-overview-linq-to-xml.md │ │ │ │ ├── partitioning-data.md │ │ │ │ ├── performance-of-chained-queries-linq-to-xml.md │ │ │ │ ├── pre-atomization-of-xname-objects-linq-to-xml.md │ │ │ │ ├── preserving-white-space-while-loading-or-parsing-xml1.md │ │ │ │ ├── preserving-white-space-while-serializing.md │ │ │ │ ├── programming-with-nodes.md │ │ │ │ ├── projecting-xml-in-a-different-shape.md │ │ │ │ ├── projection-operations.md │ │ │ │ ├── quantifier-operations.md │ │ │ │ ├── query-expression-syntax-for-standard-query-operators.md │ │ │ │ ├── query-syntax-and-method-syntax-in-linq.md │ │ │ │ ├── querying-an-xdocument-vs-querying-an-xelement.md │ │ │ │ ├── refactoring-into-pure-functions.md │ │ │ │ ├── refactoring-using-a-pure-function.md │ │ │ │ ├── refactoring-using-an-extension-method.md │ │ │ │ ├── reference-linq-to-xml.md │ │ │ │ ├── removing-elements-attributes-and-nodes-from-an-xml-tree.md │ │ │ │ ├── retrieving-the-paragraphs-and-their-styles.md │ │ │ │ ├── retrieving-the-text-of-the-paragraphs.md │ │ │ │ ├── sample-xml-file-books-linq-to-xml.md │ │ │ │ ├── sample-xml-file-consolidated-purchase-orders.md │ │ │ │ ├── sample-xml-file-customers-and-orders-in-a-namespace.md │ │ │ │ ├── sample-xml-file-customers-and-orders-linq-to-xml-2.md │ │ │ │ ├── sample-xml-file-multiple-purchase-orders-in-a-namespace.md │ │ │ │ ├── sample-xml-file-multiple-purchase-orders-linq-to-xml.md │ │ │ │ ├── sample-xml-file-numerical-data-in-a-namespace.md │ │ │ │ ├── sample-xml-file-numerical-data-linq-to-xml.md │ │ │ │ ├── sample-xml-file-test-configuration-in-a-namespace1.md │ │ │ │ ├── sample-xml-file-test-configuration-linq-to-xml.md │ │ │ │ ├── sample-xml-file-typical-purchase-order-in-a-namespace.md │ │ │ │ ├── sample-xml-file-typical-purchase-order-linq-to-xml-1.md │ │ │ │ ├── sample-xsd-file-customers-and-orders1.md │ │ │ │ ├── scope-of-default-namespaces.md │ │ │ │ ├── serializing-to-an-xmlreader-invoking-xslt.md │ │ │ │ ├── serializing-to-files-textwriters-and-xmlwriters.md │ │ │ │ ├── serializing-with-an-xml-declaration.md │ │ │ │ ├── set-operations.md │ │ │ │ ├── shape-of-wordprocessingml-documents.md │ │ │ │ ├── sorting-data.md │ │ │ │ ├── standard-query-operators-overview.md │ │ │ │ ├── statically-compiled-queries-linq-to-xml.md │ │ │ │ ├── style-part-of-a-wordprocessingml-document.md │ │ │ │ ├── type-relationships-in-linq-query-operations.md │ │ │ │ ├── using-xslt-to-transform-an-xml-tree.md │ │ │ │ ├── valid-content-of-xelement-and-xdocument-objects3.md │ │ │ │ ├── visual-studio-ide-and-tools-support-for-linq.md │ │ │ │ ├── walkthrough-writing-queries-linq.md │ │ │ │ ├── wordprocessingml-document-with-styles.md │ │ │ │ ├── xattribute-class-overview.md │ │ │ │ ├── xdocument-class-overview.md │ │ │ │ └── xelement-class-overview.md │ │ │ ├── object-oriented-programming.md │ │ │ ├── reflection.md │ │ │ └── serialization │ │ │ │ ├── how-to-read-object-data-from-an-xml-file.md │ │ │ │ ├── how-to-write-object-data-to-an-xml-file.md │ │ │ │ ├── index.md │ │ │ │ ├── media │ │ │ │ └── index │ │ │ │ │ └── serialization-process.gif │ │ │ │ └── walkthrough-persisting-an-object-in-visual-studio.md │ │ ├── delegates │ │ │ ├── delegates-with-named-vs-anonymous-methods.md │ │ │ ├── how-to-combine-delegates-multicast-delegates.md │ │ │ ├── how-to-declare-instantiate-and-use-a-delegate.md │ │ │ ├── index.md │ │ │ └── using-delegates.md │ │ ├── enumeration-types.md │ │ ├── events │ │ │ ├── how-to-implement-custom-event-accessors.md │ │ │ ├── how-to-implement-interface-events.md │ │ │ ├── how-to-publish-events-that-conform-to-net-framework-guidelines.md │ │ │ ├── how-to-raise-base-class-events-in-derived-classes.md │ │ │ ├── how-to-subscribe-to-and-unsubscribe-from-events.md │ │ │ └── index.md │ │ ├── exceptions │ │ │ ├── compiler-generated-exceptions.md │ │ │ ├── creating-and-throwing-exceptions.md │ │ │ ├── exception-handling.md │ │ │ ├── how-to-catch-a-non-cls-exception.md │ │ │ ├── how-to-execute-cleanup-code-using-finally.md │ │ │ ├── how-to-handle-an-exception-using-try-catch.md │ │ │ ├── index.md │ │ │ └── using-exceptions.md │ │ ├── file-system │ │ │ ├── how-to-copy-delete-and-move-files-and-folders.md │ │ │ ├── how-to-create-a-file-or-folder.md │ │ │ ├── how-to-create-a-key-in-the-registry.md │ │ │ ├── how-to-get-information-about-files-folders-and-drives.md │ │ │ ├── how-to-iterate-through-a-directory-tree.md │ │ │ ├── how-to-provide-a-progress-dialog-box-for-file-operations.md │ │ │ ├── how-to-read-a-text-file-one-line-at-a-time.md │ │ │ ├── how-to-read-from-a-text-file.md │ │ │ ├── how-to-write-to-a-text-file.md │ │ │ └── index.md │ │ ├── generics │ │ │ ├── constraints-on-type-parameters.md │ │ │ ├── differences-between-cpp-templates-and-csharp-generics.md │ │ │ ├── generic-classes.md │ │ │ ├── generic-delegates.md │ │ │ ├── generic-interfaces.md │ │ │ ├── generic-methods.md │ │ │ ├── generic-type-parameters.md │ │ │ ├── generics-and-arrays.md │ │ │ ├── generics-and-attributes.md │ │ │ ├── generics-and-reflection.md │ │ │ ├── generics-in-the-run-time.md │ │ │ └── index.md │ │ ├── index.md │ │ ├── indexers │ │ │ ├── comparison-between-properties-and-indexers.md │ │ │ ├── index.md │ │ │ ├── indexers-in-interfaces.md │ │ │ └── using-indexers.md │ │ ├── inside-a-program │ │ │ ├── coding-conventions.md │ │ │ ├── general-structure-of-a-csharp-program.md │ │ │ ├── hello-world-your-first-program.md │ │ │ ├── identifier-names.md │ │ │ ├── index.md │ │ │ └── media │ │ │ │ └── hello-world-your-first-program │ │ │ │ ├── visual-studio-mac-new-project.png │ │ │ │ ├── visual-studio-mac-start-screen.png │ │ │ │ ├── visual-studio-windows-new-project.png │ │ │ │ └── visual-studio-windows-start-screen.png │ │ ├── interfaces │ │ │ ├── explicit-interface-implementation.md │ │ │ ├── how-to-explicitly-implement-interface-members.md │ │ │ ├── how-to-explicitly-implement-members-of-two-interfaces.md │ │ │ └── index.md │ │ ├── interop │ │ │ ├── example-com-class.md │ │ │ ├── how-to-access-office-onterop-objects.md │ │ │ ├── how-to-use-indexed-properties-in-com-interop-rogramming.md │ │ │ ├── how-to-use-platform-invoke-to-play-a-wave-file.md │ │ │ ├── index.md │ │ │ ├── interoperability-overview.md │ │ │ └── walkthrough-office-programming.md │ │ ├── main-and-command-args │ │ │ ├── command-line-arguments.md │ │ │ ├── how-to-display-command-line-arguments.md │ │ │ ├── index.md │ │ │ └── main-return-values.md │ │ ├── namespaces │ │ │ ├── how-to-use-the-my-namespace.md │ │ │ ├── index.md │ │ │ └── using-namespaces.md │ │ ├── statements-expressions-operators │ │ │ ├── anonymous-functions.md │ │ │ ├── equality-comparisons.md │ │ │ ├── expression-bodied-members.md │ │ │ ├── expressions.md │ │ │ ├── how-to-define-value-equality-for-a-type.md │ │ │ ├── how-to-test-for-reference-equality-identity.md │ │ │ ├── how-to-use-lambda-expressions-in-a-query.md │ │ │ ├── index.md │ │ │ ├── lambda-expressions.md │ │ │ └── statements.md │ │ ├── strings │ │ │ ├── how-to-determine-whether-a-string-represents-a-numeric-value.md │ │ │ └── index.md │ │ ├── types │ │ │ ├── boxing-and-unboxing.md │ │ │ ├── casting-and-type-conversions.md │ │ │ ├── how-to-convert-a-byte-array-to-an-int.md │ │ │ ├── how-to-convert-a-string-to-a-number.md │ │ │ ├── how-to-convert-between-hexadecimal-strings-and-numeric-types.md │ │ │ ├── index.md │ │ │ ├── media │ │ │ │ ├── boxing-and-unboxing │ │ │ │ │ ├── boxing-operation-i-o-variables.gif │ │ │ │ │ └── unboxing-conversion-operation.gif │ │ │ │ └── index │ │ │ │ │ └── value-reference-types-common-type-system.png │ │ │ ├── using-type-dynamic.md │ │ │ └── walkthrough-creating-and-using-dynamic-objects.md │ │ ├── unsafe-code-pointers │ │ │ ├── fixed-size-buffers.md │ │ │ ├── how-to-use-pointers-to-copy-an-array-of-bytes.md │ │ │ ├── index.md │ │ │ ├── pointer-conversions.md │ │ │ └── pointer-types.md │ │ └── xmldoc │ │ │ ├── code-inline.md │ │ │ ├── code.md │ │ │ ├── cref-attribute.md │ │ │ ├── delimiters-for-documentation-tags.md │ │ │ ├── example.md │ │ │ ├── exception.md │ │ │ ├── how-to-use-the-xml-documentation-features.md │ │ │ ├── include.md │ │ │ ├── index.md │ │ │ ├── list.md │ │ │ ├── para.md │ │ │ ├── param.md │ │ │ ├── paramref.md │ │ │ ├── permission.md │ │ │ ├── processing-the-xml-file.md │ │ │ ├── recommended-tags-for-documentation-comments.md │ │ │ ├── remarks.md │ │ │ ├── returns.md │ │ │ ├── see.md │ │ │ ├── seealso.md │ │ │ ├── summary.md │ │ │ ├── typeparam.md │ │ │ ├── typeparamref.md │ │ │ └── value.md │ ├── properties.md │ ├── roslyn-sdk │ │ ├── compiler-api-model.md │ │ ├── get-started │ │ │ ├── media │ │ │ │ ├── syntax-transformation │ │ │ │ │ └── generate-from-usage.png │ │ │ │ └── walkthrough-csharp-syntax-figure1.png │ │ │ ├── semantic-analysis.md │ │ │ ├── syntax-analysis.md │ │ │ └── syntax-transformation.md │ │ ├── index.md │ │ ├── media │ │ │ ├── compiler-api-model │ │ │ │ ├── api-layers.png │ │ │ │ ├── compiler-pipeline-api.png │ │ │ │ ├── compiler-pipeline-lang-svc.png │ │ │ │ └── compiler-pipeline.png │ │ │ ├── syntax-visualizer │ │ │ │ ├── alias-symbol.png │ │ │ │ ├── constant-value.png │ │ │ │ ├── converted-type-symbol-properties.png │ │ │ │ ├── csharp-syntax-graph.png │ │ │ │ ├── docking-layout.png │ │ │ │ ├── method-symbol.png │ │ │ │ ├── symbol-properties.png │ │ │ │ ├── symbol-visual-basic.png │ │ │ │ ├── syntax-visualizer.png │ │ │ │ ├── type-symbol-properties.png │ │ │ │ ├── visual-basic-syntax-graph.png │ │ │ │ ├── visualize-csharp.png │ │ │ │ └── visualize-visual-basic.png │ │ │ └── work-with-workspace │ │ │ │ └── workspace-obj-relations.png │ │ ├── syntax-visualizer.md │ │ ├── tutorials │ │ │ ├── how-to-write-csharp-analyzer-code-fix.md │ │ │ └── media │ │ │ │ └── how-to-write-csharp-analyzer-code-fix │ │ │ │ ├── make-const-warning.png │ │ │ │ ├── report-warning.png │ │ │ │ └── update-string-resources.png │ │ ├── work-with-semantics.md │ │ ├── work-with-syntax.md │ │ └── work-with-workspace.md │ ├── structs.md │ ├── toc.yml │ ├── tour-of-csharp │ │ ├── arrays.md │ │ ├── attributes.md │ │ ├── classes-and-objects.md │ │ ├── delegates.md │ │ ├── enums.md │ │ ├── expressions.md │ │ ├── index.md │ │ ├── interfaces.md │ │ ├── program-structure.md │ │ ├── statements.md │ │ ├── structs.md │ │ └── types-and-variables.md │ ├── tuples.md │ ├── tutorials │ │ ├── attributes.md │ │ ├── console-teleprompter.md │ │ ├── console-webapiclient.md │ │ ├── default-interface-methods-versions.md │ │ ├── exploration │ │ │ ├── csharp-6.yml │ │ │ ├── interpolated-strings-local.md │ │ │ └── interpolated-strings.yml │ │ ├── generate-consume-asynchronous-stream.md │ │ ├── index.md │ │ ├── inheritance.md │ │ ├── intro-to-csharp │ │ │ ├── arrays-and-collections.md │ │ │ ├── branches-and-loops-local.md │ │ │ ├── branches-and-loops.yml │ │ │ ├── hello-world.yml │ │ │ ├── index.md │ │ │ ├── introduction-to-classes.md │ │ │ ├── list-collection.yml │ │ │ ├── local-environment.md │ │ │ ├── numbers-in-csharp-local.md │ │ │ └── numbers-in-csharp.yml │ │ ├── media │ │ │ ├── book-class.jpg │ │ │ ├── publication-class.jpg │ │ │ └── working-with-linq │ │ │ │ └── console-52-card-application.png │ │ ├── mixins-with-default-interface-methods.md │ │ ├── nullable-reference-types.md │ │ ├── pattern-matching.md │ │ ├── ranges-indexes.md │ │ ├── string-interpolation.md │ │ ├── upgrade-to-nullable-references.md │ │ └── working-with-linq.md │ ├── versioning.md │ ├── walkthroughs.md │ ├── whats-new │ │ ├── csharp-6.md │ │ ├── csharp-7-1.md │ │ ├── csharp-7-2.md │ │ ├── csharp-7-3.md │ │ ├── csharp-7.md │ │ ├── csharp-8.md │ │ ├── csharp-version-history.md │ │ ├── index.md │ │ ├── relationships-between-language-and-library.md │ │ └── version-update-considerations.md │ └── write-safe-efficient-code.md ├── desktop-wpf │ ├── data │ │ ├── data-binding-overview.md │ │ ├── index.md │ │ └── media │ │ │ └── data-binding-overview │ │ │ ├── basic-data-binding-diagram.png │ │ │ ├── data-binding-button-background-example.png │ │ │ ├── data-binding-button-default-conversion.png │ │ │ ├── data-binding-converter-color-example.png │ │ │ ├── data-binding-itemscontrol.png │ │ │ ├── data-binding-updatesource-trigger.png │ │ │ ├── databinding-dataflow.png │ │ │ ├── demo-addproductlisting.png │ │ │ ├── demo-no-template.png │ │ │ ├── demo-validation-date.png │ │ │ ├── demo-validation-price.png │ │ │ └── demo.png │ ├── fundamentals │ │ ├── index.md │ │ ├── media │ │ │ └── styles-and-templates-overview │ │ │ │ ├── create-a-style-explicit-textblock.png │ │ │ │ ├── stylingintro-eventtriggers.png │ │ │ │ ├── stylingintro-listboxbefore.png │ │ │ │ ├── stylingintro-photosasimages.png │ │ │ │ ├── stylingintro-textblocks.png │ │ │ │ ├── stylingintro-textblocksbasestyle.png │ │ │ │ ├── stylingintro-textblocksbefore.png │ │ │ │ └── stylingintro-triggers.png │ │ ├── styles-templates-create-apply-style.md │ │ ├── styles-templates-overview.md │ │ ├── xaml-resources-define.md │ │ └── xaml.md │ ├── getting-started │ │ └── index.md │ ├── index.md │ ├── migration │ │ ├── convert-project-from-net-framework.md │ │ ├── differences-from-net-framework.md │ │ ├── index.md │ │ └── media │ │ │ ├── convert-project-from-net-framework │ │ │ ├── connected-service-dialog.png │ │ │ ├── package-reference-migration.png │ │ │ ├── portability-report.png │ │ │ └── running-on-core.png │ │ │ └── differences-from-net-framework │ │ │ └── package-reference-migration.png │ ├── overview │ │ └── index.md │ └── toc.yml ├── framework │ ├── 64-bit-apps.md │ ├── additional-apis │ │ ├── _autoredirects.md │ │ ├── _httpresponse.md │ │ ├── adodb.connection.md │ │ ├── adodb.eventreasonenum.md │ │ ├── adodb.eventstatusenum.md │ │ ├── connection.md │ │ ├── connectiongroup.md │ │ ├── coreresponsedata.md │ │ ├── coreresponsedata_m_responseheaders.md │ │ ├── coreresponsedata_m_statuscode.md │ │ ├── datamemberfieldeditor-class.md │ │ ├── datamemberlisteditor-class.md │ │ ├── httpwebrequest__coreresponse.md │ │ ├── index.md │ │ ├── m_connectiongrouplist.md │ │ ├── m_connectionlist.md │ │ ├── m_writelist.md │ │ ├── microsoft.sqlserver.server.smiorderproperty.item.md │ │ ├── s-isdebuggercheckdisabledfortestpurposes-field.md │ │ ├── s_servicepointtable.md │ │ ├── stdole.dispparams.md │ │ ├── stdole.excepinfo.md │ │ ├── stdole.ifont.name.md │ │ ├── stdole.ifontdisp.md │ │ ├── stdole.ipicture.handle.md │ │ ├── stdole.ipicturedisp.handle.md │ │ ├── stdole.ipicturedisp.md │ │ ├── stdole.stdfont.md │ │ ├── stdole.stdpicture.md │ │ ├── system.data.sqltypes.sqlchars.stream.md │ │ ├── system.data.sqltypes.sqlstreamchars.-ctor.md │ │ ├── system.data.sqltypes.sqlstreamchars.canseek.md │ │ ├── system.data.sqltypes.sqlstreamchars.close.md │ │ ├── system.data.sqltypes.sqlstreamchars.dispose.md │ │ ├── system.data.sqltypes.sqlstreamchars.flush.md │ │ ├── system.data.sqltypes.sqlstreamchars.isnull.md │ │ ├── system.data.sqltypes.sqlstreamchars.length.md │ │ ├── system.data.sqltypes.sqlstreamchars.read.md │ │ ├── system.data.sqltypes.sqlstreamchars.seek.md │ │ ├── system.data.sqltypes.sqlstreamchars.setlength.md │ │ ├── system.data.sqltypes.sqlstreamchars.write.md │ │ ├── system.exception.prepforremoting.md │ │ ├── system.net.connectstream.connection.md │ │ ├── system.net.pooledstream.networkstream.md │ │ ├── system.net.security.sslstate.sslprotocol.md │ │ ├── system.net.tlsstream.m_worker.md │ │ ├── system.xml.xmlreader.createsqlreader.md │ │ ├── toc.yml │ │ ├── xpsdocumentwriter-raise-writingcancelled-method-system-windows-xps.md │ │ ├── xpsdocumentwriter-raise-writingcompleted-method-system-windows-xps.md │ │ ├── xpsdocumentwriter-raise-writingprintticketrequired-method-system-windows-xps.md │ │ ├── xpsdocumentwriter-raise-writingprogresschanged-method-system-windows-xps.md │ │ ├── xpsdocumentwriter-writingcancelled-event-system-windows-xps.md │ │ ├── xpsdocumentwriter-writingcompleted-event-system-windows-xps.md │ │ └── xpsdocumentwriter-writingprogresschanged-event-system-windows-xps.md │ ├── app-domains │ │ ├── application-domains-and-assemblies-how-to-topics.md │ │ ├── application-domains.md │ │ ├── assembly-placement.md │ │ ├── build-multifile-assembly.md │ │ ├── build-single-file-assembly.md │ │ ├── gac.md │ │ ├── how-to-configure-an-application-domain.md │ │ ├── how-to-create-an-application-domain.md │ │ ├── how-to-load-assemblies-into-an-application-domain.md │ │ ├── how-to-receive-first-chance-exception-notifications.md │ │ ├── how-to-remove-an-assembly-from-the-gac.md │ │ ├── how-to-share-an-assembly-with-other-applications.md │ │ ├── how-to-unload-an-application-domain.md │ │ ├── how-to-view-the-contents-of-the-gac.md │ │ ├── index.md │ │ ├── install-assembly-into-gac.md │ │ ├── multifile-assemblies.md │ │ ├── retrieve-setup-information.md │ │ ├── running-intranet-applications-in-full-trust.md │ │ ├── shadow-copy-assemblies.md │ │ ├── toc.yml │ │ ├── use-serviced-components-with-the-gac.md │ │ ├── use.md │ │ └── working-with-assemblies-and-the-gac.md │ ├── configure-apps │ │ ├── assembly-binding-redirection-security-permission.md │ │ ├── configure-cryptography-classes.md │ │ ├── file-schema │ │ │ ├── add-element-for-custom-2.md │ │ │ ├── application-settings-schema.md │ │ │ ├── appsettings │ │ │ │ ├── add-element-for-appsettings.md │ │ │ │ ├── appsettings-element-for-configuration.md │ │ │ │ ├── clear-element-for-appsettings.md │ │ │ │ ├── index.md │ │ │ │ ├── remove-element-for-appsettings.md │ │ │ │ └── toc.yml │ │ │ ├── assemblybinding-element-for-configuration.md │ │ │ ├── clear-element-for-configsections.md │ │ │ ├── clear-element-for-custom-2.md │ │ │ ├── compiler │ │ │ │ ├── compiler-element.md │ │ │ │ ├── compilers-element.md │ │ │ │ ├── index.md │ │ │ │ ├── provideroption-element.md │ │ │ │ ├── system-codedom-element.md │ │ │ │ └── toc.yml │ │ │ ├── configsections-element-for-configuration.md │ │ │ ├── configuration-element.md │ │ │ ├── configuration-sections-schema.md │ │ │ ├── cryptography │ │ │ │ ├── cryptoclass-element.md │ │ │ │ ├── cryptoclasses-element.md │ │ │ │ ├── cryptographysettings-element.md │ │ │ │ ├── cryptonamemapping-element.md │ │ │ │ ├── index.md │ │ │ │ ├── mscorlib-element-for-cryptography-settings.md │ │ │ │ ├── nameentry-element.md │ │ │ │ ├── oidentry-element.md │ │ │ │ ├── oidmap-element.md │ │ │ │ └── toc.yml │ │ │ ├── custom-element-1.md │ │ │ ├── custom-element-2.md │ │ │ ├── index.md │ │ │ ├── linkedconfiguration-element.md │ │ │ ├── network │ │ │ │ ├── add-element-for-authenticationmodules-network-settings.md │ │ │ │ ├── add-element-for-bypasslist-network-settings.md │ │ │ │ ├── add-element-for-connectionmanagement-network-settings.md │ │ │ │ ├── add-element-for-schemesettings-uri-settings.md │ │ │ │ ├── add-element-for-webrequestmodules-network-settings.md │ │ │ │ ├── authenticationmodules-element-network-settings.md │ │ │ │ ├── bypasslist-element-network-settings.md │ │ │ │ ├── clear-element-for-authenticationmodules-network-settings.md │ │ │ │ ├── clear-element-for-bypasslist-network-settings.md │ │ │ │ ├── clear-element-for-connectionmanagement-network-settings.md │ │ │ │ ├── clear-element-for-schemesettings-uri-settings.md │ │ │ │ ├── clear-element-for-webrequestmodules-network-settings.md │ │ │ │ ├── connectionmanagement-element-network-settings.md │ │ │ │ ├── defaultftpcachepolicy-element-network-settings.md │ │ │ │ ├── defaulthttpcachepolicy-element-network-settings.md │ │ │ │ ├── defaultproxy-element-network-settings.md │ │ │ │ ├── httplistener-element-network-settings.md │ │ │ │ ├── httpwebrequest-element-network-settings.md │ │ │ │ ├── idn-element-uri-settings.md │ │ │ │ ├── index.md │ │ │ │ ├── ipv6-element-network-settings.md │ │ │ │ ├── iriparsing-element-uri-settings.md │ │ │ │ ├── mailsettings-element-network-settings.md │ │ │ │ ├── module-element-network-settings.md │ │ │ │ ├── network-element-network-settings.md │ │ │ │ ├── performancecounter-element-network-settings.md │ │ │ │ ├── proxy-element-network-settings.md │ │ │ │ ├── remove-element-for-authenticationmodules-network-settings.md │ │ │ │ ├── remove-element-for-bypasslist-network-settings.md │ │ │ │ ├── remove-element-for-connectionmanagement-network-settings.md │ │ │ │ ├── remove-element-for-schemesettings-uri-settings.md │ │ │ │ ├── remove-element-for-webrequestmodules-network-settings.md │ │ │ │ ├── requestcaching-element-network-settings.md │ │ │ │ ├── schemesettings-element-uri-settings.md │ │ │ │ ├── servicepointmanager-element-network-settings.md │ │ │ │ ├── settings-element-network-settings.md │ │ │ │ ├── smtp-element-network-settings.md │ │ │ │ ├── socket-element-network-settings.md │ │ │ │ ├── specifiedpickupdirectory-element-network-settings.md │ │ │ │ ├── system-net-element-network-settings.md │ │ │ │ ├── toc.yml │ │ │ │ ├── uri-element-uri-settings.md │ │ │ │ ├── webproxyscript-element-network-settings.md │ │ │ │ └── webrequestmodules-element-network-settings.md │ │ │ ├── remove-element-for-configsections.md │ │ │ ├── remove-element-for-custom-2.md │ │ │ ├── runtime │ │ │ │ ├── add-element-for-namedcaches.md │ │ │ │ ├── alwaysflowimpersonationpolicy-element.md │ │ │ │ ├── appcontextswitchoverrides-element.md │ │ │ │ ├── appdomainmanagerassembly-element.md │ │ │ │ ├── appdomainmanagertype-element.md │ │ │ │ ├── appdomainresourcemonitoring-element.md │ │ │ │ ├── assemblybinding-element-for-runtime.md │ │ │ │ ├── assemblyidentity-element-for-runtime.md │ │ │ │ ├── bindingredirect-element.md │ │ │ │ ├── bypasstrustedappstrongnames-element.md │ │ │ │ ├── clear-element-for-namedcaches.md │ │ │ │ ├── codebase-element.md │ │ │ │ ├── compatsortnlsversion-element.md │ │ │ │ ├── crst-disablespinwait-element.md │ │ │ │ ├── dependentassembly-element.md │ │ │ │ ├── developmentmode-element.md │ │ │ │ ├── disablecachingbindingfailures-element.md │ │ │ │ ├── disablecommitthreadstack-element.md │ │ │ │ ├── disablefusionupdatesfromadmanager-element.md │ │ │ │ ├── enableampmparseadjustment-element.md │ │ │ │ ├── enforcefipspolicy-element.md │ │ │ │ ├── etwenable-element.md │ │ │ │ ├── forceperformancecounteruniquesharedmemoryreads-element.md │ │ │ │ ├── gcallowverylargeobjects-element.md │ │ │ │ ├── gcconcurrent-element.md │ │ │ │ ├── gccpugroup-element.md │ │ │ │ ├── gcheapaffinitizemask-element.md │ │ │ │ ├── gcheapcount-element.md │ │ │ │ ├── gcnoaffinitize-element.md │ │ │ │ ├── gcserver-element.md │ │ │ │ ├── generatepublisherevidence-element.md │ │ │ │ ├── index.md │ │ │ │ ├── legacycorruptedstateexceptionspolicy-element.md │ │ │ │ ├── legacyimpersonationpolicy-element.md │ │ │ │ ├── loadfromremotesources-element.md │ │ │ │ ├── memorycache-element-cache-settings.md │ │ │ │ ├── namedcaches-element-cache-settings.md │ │ │ │ ├── netfx40-legacysecuritypolicy-element.md │ │ │ │ ├── netfx40-pinvokestackresilience-element.md │ │ │ │ ├── netfx45-cultureawarecomparergethashcode-longstrings-element.md │ │ │ │ ├── prefercominsteadofmanagedremoting-element.md │ │ │ │ ├── probing-element.md │ │ │ │ ├── publisherpolicy-element.md │ │ │ │ ├── qualifyassembly-element.md │ │ │ │ ├── relativebindforresources-element.md │ │ │ │ ├── remove-element-for-namedcaches.md │ │ │ │ ├── runtime-element.md │ │ │ │ ├── shadowcopyverifybytimestamp-element.md │ │ │ │ ├── supportportability-element.md │ │ │ │ ├── system-runtime-caching-element-cache-settings.md │ │ │ │ ├── thread-useallcpugroups-element.md │ │ │ │ ├── throwunobservedtaskexceptions-element.md │ │ │ │ ├── timespan-legacyformatmode-element.md │ │ │ │ ├── toc.yml │ │ │ │ ├── uselegacyjit-element.md │ │ │ │ ├── userandomizedstringhashalgorithm-element.md │ │ │ │ └── usesmallinternalthreadstacks-element.md │ │ │ ├── section-element.md │ │ │ ├── sectiongroup-element-for-configsections.md │ │ │ ├── startup │ │ │ │ ├── index.md │ │ │ │ ├── requiredruntime-element.md │ │ │ │ ├── startup-element.md │ │ │ │ ├── supportedruntime-element.md │ │ │ │ └── toc.yml │ │ │ ├── toc.yml │ │ │ ├── trace-debug │ │ │ │ ├── add-element-for-listeners-for-source.md │ │ │ │ ├── add-element-for-listeners-for-trace.md │ │ │ │ ├── add-element-for-sharedlisteners.md │ │ │ │ ├── add-element-for-switches.md │ │ │ │ ├── assert-element.md │ │ │ │ ├── clear-element-for-listeners-for-source.md │ │ │ │ ├── clear-element-for-listeners-for-trace.md │ │ │ │ ├── filter-element-for-add-for-listeners-for-source.md │ │ │ │ ├── filter-element-for-add-for-listeners-for-trace.md │ │ │ │ ├── filter-element-for-add-for-sharedlisteners.md │ │ │ │ ├── index.md │ │ │ │ ├── listeners-element-for-source.md │ │ │ │ ├── listeners-element-for-trace.md │ │ │ │ ├── performancecounters-element.md │ │ │ │ ├── remove-element-for-listeners-for-source.md │ │ │ │ ├── remove-element-for-listeners-for-trace.md │ │ │ │ ├── sharedlisteners-element.md │ │ │ │ ├── source-element.md │ │ │ │ ├── sources-element.md │ │ │ │ ├── switches-element.md │ │ │ │ ├── system-diagnostics-element.md │ │ │ │ ├── toc.yml │ │ │ │ └── trace-element.md │ │ │ ├── wcf-directive │ │ │ │ ├── index.md │ │ │ │ ├── servicehost.md │ │ │ │ └── toc.yml │ │ │ ├── wcf │ │ │ │ ├── activityscheduledqueries-of-wcf.md │ │ │ │ ├── activityscheduledquery-of-wcf.md │ │ │ │ ├── activitystatequeries-of-wcf.md │ │ │ │ ├── activitystatequery-of-wcf.md │ │ │ │ ├── add-of-allowaccounts.md │ │ │ │ ├── add-of-allowedaudienceuris.md │ │ │ │ ├── add-of-authorizationpolicies.md │ │ │ │ ├── add-of-backuplist.md │ │ │ │ ├── add-of-baseaddresses.md │ │ │ │ ├── add-of-baseaddressprefixfilter.md │ │ │ │ ├── add-of-claimtyperequirements-element.md │ │ │ │ ├── add-of-claimtyperequirements.md │ │ │ │ ├── add-of-commonparameters.md │ │ │ │ ├── add-of-contracttypenames.md │ │ │ │ ├── add-of-declaredtypes-element.md │ │ │ │ ├── add-of-defaultports.md │ │ │ │ ├── add-of-entries.md │ │ │ │ ├── add-of-filters.md │ │ │ │ ├── add-of-issuerchannelbehaviors.md │ │ │ │ ├── add-of-knowncertificates.md │ │ │ │ ├── add-of-namespacetable.md │ │ │ │ ├── add-of-protocolmapping.md │ │ │ │ ├── add-of-scopedcertificates-element.md │ │ │ │ ├── add-of-scopes.md │ │ │ │ ├── add-of-serviceactivations.md │ │ │ │ ├── add-of-services.md │ │ │ │ ├── add-of-transportconfigurationtype.md │ │ │ │ ├── add-of-wcf.md │ │ │ │ ├── additionalrequestparameters-element.md │ │ │ │ ├── allowaccounts.md │ │ │ │ ├── allowedaudienceuris.md │ │ │ │ ├── announcementendpoint.md │ │ │ │ ├── authentication-of-clientcertificate-element.md │ │ │ │ ├── authentication-of-servicecertificate-element.md │ │ │ │ ├── authorizationpolicies.md │ │ │ │ ├── backuplist.md │ │ │ │ ├── backuplists.md │ │ │ │ ├── baseaddresses.md │ │ │ │ ├── baseaddressprefixfilters.md │ │ │ │ ├── basichttpbinding.md │ │ │ │ ├── basichttpcontextbinding.md │ │ │ │ ├── behavior-of-endpointbehaviors.md │ │ │ │ ├── behavior-of-servicebehaviors.md │ │ │ │ ├── behaviorextensions.md │ │ │ │ ├── behaviors.md │ │ │ │ ├── binarymessageencoding.md │ │ │ │ ├── bindingelementextensions.md │ │ │ │ ├── bindingextensions.md │ │ │ │ ├── bindings.md │ │ │ │ ├── bookmarkresumptionqueries-of-wcf.md │ │ │ │ ├── bookmarkresumptionquery-of-wcf.md │ │ │ │ ├── bytestreammessageencoding.md │ │ │ │ ├── callbackdebug.md │ │ │ │ ├── callbacktimeouts.md │ │ │ │ ├── cancelrequestedqueries-of-wcf.md │ │ │ │ ├── cancelrequestedquery-of-wcf.md │ │ │ │ ├── certificate-element.md │ │ │ │ ├── certificate-for-identity.md │ │ │ │ ├── certificate-of-clientcertificate-element.md │ │ │ │ ├── certificate-of-peer.md │ │ │ │ ├── certificatereference-for-identity.md │ │ │ │ ├── channelpoolsettings.md │ │ │ │ ├── claimtyperequirements-element.md │ │ │ │ ├── claimtyperequirements-for-message.md │ │ │ │ ├── clear-of-claimtyperequirements-element.md │ │ │ │ ├── client.md │ │ │ │ ├── clientcertificate-of-clientcredentials-element.md │ │ │ │ ├── clientcertificate-of-servicecredentials.md │ │ │ │ ├── clientcredentials.md │ │ │ │ ├── clientvia.md │ │ │ │ ├── comcontract.md │ │ │ │ ├── comcontracts.md │ │ │ │ ├── commonbehaviors.md │ │ │ │ ├── commonparameters.md │ │ │ │ ├── compositeduplex.md │ │ │ │ ├── connectionpoolsettings-of-tcptransport.md │ │ │ │ ├── connectionpoolsettings.md │ │ │ │ ├── contracttypenames.md │ │ │ │ ├── custom.md │ │ │ │ ├── custombinding.md │ │ │ │ ├── customtrackingqueries-of-wcf.md │ │ │ │ ├── customtrackingquery-of-wcf.md │ │ │ │ ├── datacontractserializer-element.md │ │ │ │ ├── datacontractserializer-of-system-runtime-serialization.md │ │ │ │ ├── datacontractserializer.md │ │ │ │ ├── declaredtypes.md │ │ │ │ ├── defaultcertificate-element.md │ │ │ │ ├── defaultports.md │ │ │ │ ├── diagnostics-for-activation.md │ │ │ │ ├── diagnostics.md │ │ │ │ ├── discoveryclient.md │ │ │ │ ├── discoveryclientsettings.md │ │ │ │ ├── discoveryendpoint.md │ │ │ │ ├── dispatchersynchronization.md │ │ │ │ ├── dns.md │ │ │ │ ├── dynamicendpoint.md │ │ │ │ ├── enablewebscript.md │ │ │ │ ├── endpoint-element.md │ │ │ │ ├── endpoint-of-client.md │ │ │ │ ├── endpointbehaviors.md │ │ │ │ ├── endpointdiscovery.md │ │ │ │ ├── endpointextensions.md │ │ │ │ ├── endtoendtracing.md │ │ │ │ ├── entries.md │ │ │ │ ├── exposedmethod.md │ │ │ │ ├── exposedmethods.md │ │ │ │ ├── extensions-section.md │ │ │ │ ├── extensions.md │ │ │ │ ├── faultpropagationqueries-of-wcf.md │ │ │ │ ├── faultpropagationquery-of-wcf.md │ │ │ │ ├── filter.md │ │ │ │ ├── filters-of-routing.md │ │ │ │ ├── filters.md │ │ │ │ ├── filtertable.md │ │ │ │ ├── filtertables.md │ │ │ │ ├── findcriteria.md │ │ │ │ ├── headers-element.md │ │ │ │ ├── headers.md │ │ │ │ ├── host.md │ │ │ │ ├── httpdigest-element.md │ │ │ │ ├── httpstransport.md │ │ │ │ ├── httptransport.md │ │ │ │ ├── identity.md │ │ │ │ ├── index.md │ │ │ │ ├── issuedtoken.md │ │ │ │ ├── issuedtokenauthentication-of-servicecredentials.md │ │ │ │ ├── issuedtokenparameters.md │ │ │ │ ├── issuer-of-issuedtokenparameters.md │ │ │ │ ├── issuer.md │ │ │ │ ├── issuerchannelbehaviors-element.md │ │ │ │ ├── issuermetadata-of-issuedtokenparameters.md │ │ │ │ ├── issuermetadata.md │ │ │ │ ├── knowncertificates.md │ │ │ │ ├── knowntype.md │ │ │ │ ├── localclientsettings-element.md │ │ │ │ ├── localissuer.md │ │ │ │ ├── localservicesettings-element.md │ │ │ │ ├── media │ │ │ │ │ └── index │ │ │ │ │ │ └── windows-communication-foundation-configuration-schema.gif │ │ │ │ ├── message-element-of-nettcpbinding.md │ │ │ │ ├── message-element-of-ws2007federationhttpbinding.md │ │ │ │ ├── message-element-of-wsfederationhttpbinding.md │ │ │ │ ├── message-encoding.md │ │ │ │ ├── message-of-basichttpbinding.md │ │ │ │ ├── message-of-nethttpbinding.md │ │ │ │ ├── message-of-netmsmqbinding.md │ │ │ │ ├── message-of-ws2007httpbinding.md │ │ │ │ ├── message-of-wsdualhttpbinding.md │ │ │ │ ├── message-of-wshttpbinding.md │ │ │ │ ├── messagelogging.md │ │ │ │ ├── messagesenderauthentication-element.md │ │ │ │ ├── messagesenderauthentication.md │ │ │ │ ├── metadata.md │ │ │ │ ├── mexendpoint.md │ │ │ │ ├── mexhttpbinding.md │ │ │ │ ├── mexhttpsbinding.md │ │ │ │ ├── mexnamedpipebinding.md │ │ │ │ ├── mextcpbinding.md │ │ │ │ ├── msmqintegration.md │ │ │ │ ├── msmqintegrationbinding.md │ │ │ │ ├── msmqtransport.md │ │ │ │ ├── msmqtransportsecurity.md │ │ │ │ ├── mtommessageencoding.md │ │ │ │ ├── namedpipetransport.md │ │ │ │ ├── namespacetable.md │ │ │ │ ├── net-pipe.md │ │ │ │ ├── net-tcp.md │ │ │ │ ├── nethttpbinding.md │ │ │ │ ├── nethttpsbinding.md │ │ │ │ ├── netmsmqbinding.md │ │ │ │ ├── netnamedpipebinding.md │ │ │ │ ├── netpeertcpbinding.md │ │ │ │ ├── nettcpbinding.md │ │ │ │ ├── nettcpcontextbinding.md │ │ │ │ ├── oneway.md │ │ │ │ ├── parameter.md │ │ │ │ ├── participants-of-wcf.md │ │ │ │ ├── peer-of-clientcredentials-element.md │ │ │ │ ├── peer-of-servicecredentials.md │ │ │ │ ├── peerauthentication-element.md │ │ │ │ ├── peerauthentication.md │ │ │ │ ├── peertransport.md │ │ │ │ ├── persistabletype.md │ │ │ │ ├── persistabletypes.md │ │ │ │ ├── persistenceprovider.md │ │ │ │ ├── pnrppeerresolver.md │ │ │ │ ├── policyimporter.md │ │ │ │ ├── policyimporters.md │ │ │ │ ├── privacynoticeat.md │ │ │ │ ├── protocolmapping.md │ │ │ │ ├── reliablesession.md │ │ │ │ ├── remove-of-claimtyperequirements-element.md │ │ │ │ ├── resolver.md │ │ │ │ ├── routing-of-servicebehavior.md │ │ │ │ ├── routing.md │ │ │ │ ├── rsa.md │ │ │ │ ├── scopedcertificates-element.md │ │ │ │ ├── scopes.md │ │ │ │ ├── secureconversationauthentication-of-servicecredential.md │ │ │ │ ├── secureconversationbootstrap.md │ │ │ │ ├── security-element-of-ws2007federationhttpbinding.md │ │ │ │ ├── security-of-basichttpbinding.md │ │ │ │ ├── security-of-custombinding.md │ │ │ │ ├── security-of-msmqintegrationbinding.md │ │ │ │ ├── security-of-nethttpbinding.md │ │ │ │ ├── security-of-netmsmqbinding.md │ │ │ │ ├── security-of-netnamedpipebinding.md │ │ │ │ ├── security-of-netpeerbinding.md │ │ │ │ ├── security-of-nettcpbinding.md │ │ │ │ ├── security-of-peertransport.md │ │ │ │ ├── security-of-webhttpbinding.md │ │ │ │ ├── security-of-ws2007httpbinding.md │ │ │ │ ├── security-of-wsdualhttpbinding.md │ │ │ │ ├── security-of-wsfederationhttpbinding.md │ │ │ │ ├── security-of-wshttpbinding.md │ │ │ │ ├── service.md │ │ │ │ ├── serviceactivations.md │ │ │ │ ├── serviceauthenticationmanager.md │ │ │ │ ├── serviceauthorization-element.md │ │ │ │ ├── servicebehaviors.md │ │ │ │ ├── servicecertificate-of-clientcredentials-element.md │ │ │ │ ├── servicecertificate-of-servicecredentials.md │ │ │ │ ├── servicecredentials.md │ │ │ │ ├── servicedebug.md │ │ │ │ ├── servicediscovery.md │ │ │ │ ├── servicehostingenvironment.md │ │ │ │ ├── servicemetadata.md │ │ │ │ ├── serviceprincipalname.md │ │ │ │ ├── services-of-workflowruntime.md │ │ │ │ ├── services.md │ │ │ │ ├── servicesecurityaudit.md │ │ │ │ ├── servicethrottling.md │ │ │ │ ├── servicetimeouts.md │ │ │ │ ├── soapprocessing.md │ │ │ │ ├── sslstreamsecurity.md │ │ │ │ ├── standardendpoints.md │ │ │ │ ├── state-of-wcf-workflowinstancequery.md │ │ │ │ ├── states-of-wcf-workflowinstancequery.md │ │ │ │ ├── synchronousreceive-element.md │ │ │ │ ├── system-runtime-serialization.md │ │ │ │ ├── system-servicemodel-activation.md │ │ │ │ ├── system-servicemodel.md │ │ │ │ ├── tcptransport.md │ │ │ │ ├── textmessageencoding.md │ │ │ │ ├── timeouts.md │ │ │ │ ├── toc.yml │ │ │ │ ├── tokenrequestparameters.md │ │ │ │ ├── tracking-of-wcf.md │ │ │ │ ├── trackingprofile-of-wcf.md │ │ │ │ ├── transactedbatching.md │ │ │ │ ├── transactionflow.md │ │ │ │ ├── transport-of-basichttpbinding.md │ │ │ │ ├── transport-of-msmqintegrationbinding.md │ │ │ │ ├── transport-of-nethttpbinding.md │ │ │ │ ├── transport-of-netmsmqbinding.md │ │ │ │ ├── transport-of-netnamedpipebinding.md │ │ │ │ ├── transport-of-netpeertcpbinding.md │ │ │ │ ├── transport-of-nettcpbinding.md │ │ │ │ ├── transport-of-peertransport.md │ │ │ │ ├── transport-of-webhttpbinding.md │ │ │ │ ├── transport-of-ws2007httpbinding.md │ │ │ │ ├── transport-of-wshttpbinding.md │ │ │ │ ├── transportconfigurationtypes.md │ │ │ │ ├── transports.md │ │ │ │ ├── udpannouncementendpoint.md │ │ │ │ ├── udpbinding.md │ │ │ │ ├── udpdiscoveryendpoint.md │ │ │ │ ├── udptransportsettings-of-udpannouncementendpoint.md │ │ │ │ ├── udptransportsettings.md │ │ │ │ ├── unrecognizedpolicyassertion.md │ │ │ │ ├── usemanagedpresentation.md │ │ │ │ ├── userdefinedtype.md │ │ │ │ ├── userdefinedtypes.md │ │ │ │ ├── userequestheadersformetadataaddress.md │ │ │ │ ├── usernameauthentication.md │ │ │ │ ├── userprincipalname.md │ │ │ │ ├── webhttp.md │ │ │ │ ├── webhttpbinding.md │ │ │ │ ├── webhttpendpoint.md │ │ │ │ ├── webmessageencoding.md │ │ │ │ ├── webscriptendpoint.md │ │ │ │ ├── websocketsettings.md │ │ │ │ ├── windows-of-clientcredentials-element.md │ │ │ │ ├── windowsauthentication-of-servicecredentials.md │ │ │ │ ├── windowsstreamsecurity.md │ │ │ │ ├── workflow-of-wcf.md │ │ │ │ ├── workflowcontrolendpoint.md │ │ │ │ ├── workflowinstancequeries-of-wcf.md │ │ │ │ ├── workflowinstancequery-of-wcf.md │ │ │ │ ├── workflowruntime.md │ │ │ │ ├── ws2007federationhttpbinding.md │ │ │ │ ├── ws2007httpbinding.md │ │ │ │ ├── wsdlimporter.md │ │ │ │ ├── wsdlimporters.md │ │ │ │ ├── wsdualhttpbinding.md │ │ │ │ ├── wsfederationhttpbinding.md │ │ │ │ ├── wshttpbinding.md │ │ │ │ ├── wshttpcontextbinding.md │ │ │ │ └── xmlelement.md │ │ │ ├── web │ │ │ │ ├── applicationpool-element-web-settings.md │ │ │ │ ├── index.md │ │ │ │ ├── system-web-element-web-settings.md │ │ │ │ └── toc.yml │ │ │ ├── windows-identity-foundation │ │ │ │ ├── add.md │ │ │ │ ├── audienceuris.md │ │ │ │ ├── caches.md │ │ │ │ ├── certificatereference.md │ │ │ │ ├── certificatevalidation.md │ │ │ │ ├── certificatevalidator.md │ │ │ │ ├── chunkedcookiehandler.md │ │ │ │ ├── claimsauthenticationmanager.md │ │ │ │ ├── claimsauthorizationmanager.md │ │ │ │ ├── claimtype.md │ │ │ │ ├── claimtyperequired.md │ │ │ │ ├── clear.md │ │ │ │ ├── cookiehandler.md │ │ │ │ ├── customcookiehandler.md │ │ │ │ ├── federationconfiguration.md │ │ │ │ ├── identityconfiguration.md │ │ │ │ ├── index.md │ │ │ │ ├── issuernameregistry.md │ │ │ │ ├── issuertokenresolver.md │ │ │ │ ├── nameclaimtype.md │ │ │ │ ├── remove.md │ │ │ │ ├── roleclaimtype.md │ │ │ │ ├── samlsecuritytokenrequirement.md │ │ │ │ ├── securitytokenhandlerconfiguration.md │ │ │ │ ├── securitytokenhandlers.md │ │ │ │ ├── servicecertificate.md │ │ │ │ ├── servicetokenresolver.md │ │ │ │ ├── sessionsecuritytokencache.md │ │ │ │ ├── sessiontokenrequirement.md │ │ │ │ ├── system-identitymodel-services.md │ │ │ │ ├── system-identitymodel.md │ │ │ │ ├── toc.yml │ │ │ │ ├── tokenreplaycache.md │ │ │ │ ├── tokenreplaydetection.md │ │ │ │ ├── trustedissuers.md │ │ │ │ ├── usernamesecuritytokenhandlerrequirement.md │ │ │ │ ├── wsfederation.md │ │ │ │ └── x509securitytokenhandlerrequirement.md │ │ │ ├── windows-workflow-foundation │ │ │ │ ├── activityscheduledqueries.md │ │ │ │ ├── activityscheduledquery.md │ │ │ │ ├── activitystatequeries.md │ │ │ │ ├── activitystatequery.md │ │ │ │ ├── add-of-participants.md │ │ │ │ ├── additional-managed-reference.md │ │ │ │ ├── argument.md │ │ │ │ ├── arguments.md │ │ │ │ ├── behavior-of-servicebehaviors-of-workflow.md │ │ │ │ ├── behaviors-of-workflow.md │ │ │ │ ├── bookmarkresumptionqueries.md │ │ │ │ ├── bookmarkresumptionquery.md │ │ │ │ ├── bufferreceive.md │ │ │ │ ├── cancelrequestedqueries.md │ │ │ │ ├── cancelrequestedquery.md │ │ │ │ ├── channelsettings.md │ │ │ │ ├── customtrackingqueries.md │ │ │ │ ├── customtrackingquery.md │ │ │ │ ├── etwtracking.md │ │ │ │ ├── factorysettings.md │ │ │ │ ├── faultpropagationqueries.md │ │ │ │ ├── faultpropagationquery.md │ │ │ │ ├── index.md │ │ │ │ ├── microsoft-visualstudio-activities-asr-clientactivitybuilder-build.md │ │ │ │ ├── microsoft-visualstudio-activities-asr-clientactivitybuilder-ctor.md │ │ │ │ ├── microsoft-visualstudio-activities-asr-clientactivitybuilder.md │ │ │ │ ├── participants.md │ │ │ │ ├── sendmessagechannelcache.md │ │ │ │ ├── servicebehaviors-of-workflow.md │ │ │ │ ├── sqlworkflowinstancestore.md │ │ │ │ ├── state-of-states.md │ │ │ │ ├── state.md │ │ │ │ ├── states-of-activitystatequery.md │ │ │ │ ├── states.md │ │ │ │ ├── system-servicemodel-of-workflow.md │ │ │ │ ├── toc.yml │ │ │ │ ├── tracking.md │ │ │ │ ├── trackingprofile.md │ │ │ │ ├── using-annotation-in-queries.md │ │ │ │ ├── variable.md │ │ │ │ ├── variables.md │ │ │ │ ├── workflow.md │ │ │ │ ├── workflowidle.md │ │ │ │ ├── workflowinstancemanagement.md │ │ │ │ ├── workflowinstancequeries.md │ │ │ │ ├── workflowinstancequery.md │ │ │ │ └── workflowunhandledexception.md │ │ │ └── winforms │ │ │ │ ├── index.md │ │ │ │ ├── toc.yml │ │ │ │ └── windows-forms-add-configuration-element.md │ │ ├── how-to-create-a-publisher-policy.md │ │ ├── how-to-enable-and-disable-automatic-binding-redirection.md │ │ ├── how-to-locate-assemblies-by-using-devpath.md │ │ ├── index.md │ │ ├── map-algorithm-names-to-cryptography-classes.md │ │ ├── map-object-identifiers-to-cryptography-algorithms.md │ │ ├── media │ │ │ ├── clr-addbindingredirect.png │ │ │ └── clr-assemblyrefwarning.png │ │ ├── redirect-assembly-versions.md │ │ ├── specify-assembly-location.md │ │ └── toc.yml │ ├── data │ │ ├── adonet │ │ │ ├── adding-existing-constraints-to-a-dataset.md │ │ │ ├── ado-net-architecture.md │ │ │ ├── ado-net-code-examples.md │ │ │ ├── ado-net-datasets.md │ │ │ ├── ado-net-overview.md │ │ │ ├── ado-net-technology-options-and-guidelines.md │ │ │ ├── association-end-multiplicity.md │ │ │ ├── association-end.md │ │ │ ├── association-set-end.md │ │ │ ├── association-set.md │ │ │ ├── association-type.md │ │ │ ├── asynchronous-programming.md │ │ │ ├── code-access-security.md │ │ │ ├── commands-and-parameters.md │ │ │ ├── common-schema-collections.md │ │ │ ├── comparing-datarows-linq-to-dataset.md │ │ │ ├── complex-type.md │ │ │ ├── configuring-parameters-and-parameter-data-types.md │ │ │ ├── connecting-to-a-data-source.md │ │ │ ├── connection-events.md │ │ │ ├── connection-pooling.md │ │ │ ├── connection-string-builders.md │ │ │ ├── connection-string-syntax.md │ │ │ ├── connection-strings-and-configuration-files.md │ │ │ ├── connection-strings.md │ │ │ ├── creating-a-datatable-from-a-query-linq-to-dataset.md │ │ │ ├── creating-a-dataview-object-linq-to-dataset.md │ │ │ ├── cross-table-queries-linq-to-dataset.md │ │ │ ├── data-binding-and-linq-to-dataset.md │ │ │ ├── data-providers.md │ │ │ ├── data-tracing.md │ │ │ ├── data-type-mappings-in-ado-net.md │ │ │ ├── dataadapter-datatable-and-datacolumn-mappings.md │ │ │ ├── dataadapter-parameters.md │ │ │ ├── dataadapters-and-datareaders.md │ │ │ ├── dataset-datatable-dataview │ │ │ │ ├── acceptchanges-and-rejectchanges.md │ │ │ │ ├── adding-a-datatable-to-a-dataset.md │ │ │ │ ├── adding-columns-to-a-datatable.md │ │ │ │ ├── adding-data-to-a-datatable.md │ │ │ │ ├── adding-datarelations.md │ │ │ │ ├── annotating-typed-datasets.md │ │ │ │ ├── applying-an-xslt-transform-to-a-dataset.md │ │ │ │ ├── childviews-and-relations.md │ │ │ │ ├── consuming-a-dataset-from-an-xml-web-service.md │ │ │ │ ├── copying-dataset-contents.md │ │ │ │ ├── creating-a-datareader.md │ │ │ │ ├── creating-a-dataset.md │ │ │ │ ├── creating-a-datatable-from-a-dataview.md │ │ │ │ ├── creating-a-datatable.md │ │ │ │ ├── creating-a-dataview.md │ │ │ │ ├── creating-autoincrement-columns.md │ │ │ │ ├── creating-expression-columns.md │ │ │ │ ├── datarow-deletion.md │ │ │ │ ├── datarows-and-datarowviews.md │ │ │ │ ├── dataset-and-xmldatadocument-synchronization.md │ │ │ │ ├── datatable-constraints.md │ │ │ │ ├── datatable-edits.md │ │ │ │ ├── datatable-schema-definition.md │ │ │ │ ├── datatablereaders.md │ │ │ │ ├── datatables.md │ │ │ │ ├── dataviews.md │ │ │ │ ├── defining-primary-keys.md │ │ │ │ ├── deriving-dataset-relational-structure-from-xml-schema-xsd.md │ │ │ │ ├── diffgrams.md │ │ │ │ ├── finding-rows.md │ │ │ │ ├── generating-dataset-relations-from-xml-schema-xsd.md │ │ │ │ ├── generating-strongly-typed-datasets.md │ │ │ │ ├── handling-dataset-events.md │ │ │ │ ├── handling-datatable-events.md │ │ │ │ ├── handling-dataview-events.md │ │ │ │ ├── index.md │ │ │ │ ├── inference-limitations.md │ │ │ │ ├── inferring-columns.md │ │ │ │ ├── inferring-dataset-relational-structure-from-xml.md │ │ │ │ ├── inferring-element-text.md │ │ │ │ ├── inferring-relationships.md │ │ │ │ ├── inferring-tables.md │ │ │ │ ├── loading-a-dataset-from-xml.md │ │ │ │ ├── loading-dataset-schema-information-from-xml.md │ │ │ │ ├── managing-dataviews.md │ │ │ │ ├── manipulating-data-in-a-datatable.md │ │ │ │ ├── map-implicit-relations-between-nested-schema-elements.md │ │ │ │ ├── map-key-xml-schema-xsd-constraints-to-dataset-constraints.md │ │ │ │ ├── map-keyref-xml-schema-xsd-constraints-to-dataset-constraints.md │ │ │ │ ├── map-relations-specified-for-nested-elements.md │ │ │ │ ├── map-unique-xml-schema-xsd-constraints-to-dataset-constraints.md │ │ │ │ ├── mapping-xml-schema-xsd-constraints-to-dataset-constraints.md │ │ │ │ ├── merging-dataset-contents.md │ │ │ │ ├── modifying-dataviews.md │ │ │ │ ├── navigating-datarelations.md │ │ │ │ ├── navigating-datatables.md │ │ │ │ ├── nesting-datarelations.md │ │ │ │ ├── performing-an-xpath-query-on-a-dataset.md │ │ │ │ ├── row-error-information.md │ │ │ │ ├── row-states-and-row-versions.md │ │ │ │ ├── sorting-and-filtering-data.md │ │ │ │ ├── specify-relations-between-elements-with-no-nesting.md │ │ │ │ ├── summary-of-the-dataset-schema-inference-process.md │ │ │ │ ├── synchronizing-a-dataset-with-an-xmldatadocument.md │ │ │ │ ├── the-load-method.md │ │ │ │ ├── toc.yml │ │ │ │ ├── typed-datasets.md │ │ │ │ ├── using-xml-in-a-dataset.md │ │ │ │ ├── viewing-data-in-a-datatable.md │ │ │ │ ├── writing-dataset-contents-as-xml-data.md │ │ │ │ ├── writing-dataset-schema-information-as-xsd.md │ │ │ │ └── xml-schema-constraints-and-relationships.md │ │ │ ├── dataset-specific-operator-examples-linq-to-dataset.md │ │ │ ├── dataview-performance.md │ │ │ ├── dbconnection-dbcommand-and-dbexception.md │ │ │ ├── dbproviderfactories.md │ │ │ ├── debugging-linq-to-dataset-queries.md │ │ │ ├── distributed-transactions.md │ │ │ ├── downloading-sample-databases-linq-to-dataset.md │ │ │ ├── ef │ │ │ │ ├── aggregate-functions-sqlclient-for-entity-framework.md │ │ │ │ ├── architecture-and-design.md │ │ │ │ ├── conceptual-model-canonical-to-sql-server-functions-mapping.md │ │ │ │ ├── connection-strings.md │ │ │ │ ├── data-providers.md │ │ │ │ ├── date-and-time-functions.md │ │ │ │ ├── deployment-considerations.md │ │ │ │ ├── development-and-deployment-considerations.md │ │ │ │ ├── edm-generator-edmgen-exe.md │ │ │ │ ├── entityclient-provider-for-the-entity-framework.md │ │ │ │ ├── generating-sql-from-command-trees-best-practices.md │ │ │ │ ├── getting-started.md │ │ │ │ ├── how-to-build-an-entityconnection-connection-string.md │ │ │ │ ├── how-to-define-the-connection-string.md │ │ │ │ ├── how-to-execute-a-parameterized-entity-sql-query-using-entitycommand.md │ │ │ │ ├── how-to-execute-a-parameterized-stored-procedure-using-entitycommand.md │ │ │ │ ├── how-to-execute-a-polymorphic-query.md │ │ │ │ ├── how-to-execute-a-query-that-returns-complex-types.md │ │ │ │ ├── how-to-execute-a-query-that-returns-nested-collections.md │ │ │ │ ├── how-to-execute-a-query-that-returns-primitivetype-results.md │ │ │ │ ├── how-to-execute-a-query-that-returns-reftype-results.md │ │ │ │ ├── how-to-execute-a-query-that-returns-structuraltype-results.md │ │ │ │ ├── how-to-make-model-and-mapping-files-embedded-resources.md │ │ │ │ ├── how-to-navigate-relationships-with-the-navigate-operator.md │ │ │ │ ├── how-to-use-edmgen-exe-to-generate-object-layer-code.md │ │ │ │ ├── how-to-use-edmgen-exe-to-generate-the-model-and-mapping-files.md │ │ │ │ ├── how-to-use-edmgen-exe-to-validate-model-and-mapping-files.md │ │ │ │ ├── index.md │ │ │ │ ├── known-issues-in-sqlclient-for-entity-framework.md │ │ │ │ ├── language-reference │ │ │ │ │ ├── add.md │ │ │ │ │ ├── aggregate-canonical-functions.md │ │ │ │ │ ├── aggregate-functions-entity-sql.md │ │ │ │ │ ├── and-entity-sql.md │ │ │ │ │ ├── anyelement-entity-sql.md │ │ │ │ │ ├── between-entity-sql.md │ │ │ │ │ ├── bitwise-canonical-functions.md │ │ │ │ │ ├── calling-functions-in-linq-to-entities-queries.md │ │ │ │ │ ├── canonical-functions.md │ │ │ │ │ ├── case-entity-sql.md │ │ │ │ │ ├── cast-entity-sql.md │ │ │ │ │ ├── clr-method-to-canonical-function-mapping.md │ │ │ │ │ ├── collection-entity-sql.md │ │ │ │ │ ├── comment-entity-sql.md │ │ │ │ │ ├── comparison-expressions.md │ │ │ │ │ ├── comparison-semantics-entity-sql.md │ │ │ │ │ ├── compiled-queries-linq-to-entities.md │ │ │ │ │ ├── composing-nested-entity-sql-queries.md │ │ │ │ │ ├── constant-expressions.md │ │ │ │ │ ├── constructing-types-entity-sql.md │ │ │ │ │ ├── createref-entity-sql.md │ │ │ │ │ ├── date-and-time-canonical-functions.md │ │ │ │ │ ├── deref-entity-sql.md │ │ │ │ │ ├── divide-entity-sql.md │ │ │ │ │ ├── entity-sql-language.md │ │ │ │ │ ├── entity-sql-overview.md │ │ │ │ │ ├── entity-sql-quick-reference.md │ │ │ │ │ ├── entity-sql-reference.md │ │ │ │ │ ├── equals-entity-sql.md │ │ │ │ │ ├── except-entity-sql.md │ │ │ │ │ ├── exists-entity-sql.md │ │ │ │ │ ├── expressions-in-linq-to-entities-queries.md │ │ │ │ │ ├── flatten-entity-sql.md │ │ │ │ │ ├── from-entity-sql.md │ │ │ │ │ ├── function-entity-sql.md │ │ │ │ │ ├── function-overload-resolution-entity-sql.md │ │ │ │ │ ├── functions-entity-sql.md │ │ │ │ │ ├── greater-than-entity-sql.md │ │ │ │ │ ├── greater-than-or-equal-to-entity-sql.md │ │ │ │ │ ├── group-by-entity-sql.md │ │ │ │ │ ├── grouppartition-entity-sql.md │ │ │ │ │ ├── having-entity-sql.md │ │ │ │ │ ├── how-entity-sql-differs-from-transact-sql.md │ │ │ │ │ ├── how-to-call-canonical-functions.md │ │ │ │ │ ├── how-to-call-custom-database-functions.md │ │ │ │ │ ├── how-to-call-database-functions.md │ │ │ │ │ ├── how-to-call-model-defined-functions-as-object-methods.md │ │ │ │ │ ├── how-to-call-model-defined-functions-in-queries.md │ │ │ │ │ ├── identifiers-entity-sql.md │ │ │ │ │ ├── in-entity-sql.md │ │ │ │ │ ├── index.md │ │ │ │ │ ├── initialization-expressions.md │ │ │ │ │ ├── input-character-set-entity-sql.md │ │ │ │ │ ├── intersect-entity-sql.md │ │ │ │ │ ├── isnull-entity-sql.md │ │ │ │ │ ├── isof-entity-sql.md │ │ │ │ │ ├── key-entity-sql.md │ │ │ │ │ ├── known-issues-and-considerations-in-linq-to-entities.md │ │ │ │ │ ├── less-than-entity-sql.md │ │ │ │ │ ├── less-than-or-equal-to-entity-sql.md │ │ │ │ │ ├── like-entity-sql.md │ │ │ │ │ ├── limit-entity-sql.md │ │ │ │ │ ├── linq-to-entities.md │ │ │ │ │ ├── literals-entity-sql.md │ │ │ │ │ ├── math-canonical-functions.md │ │ │ │ │ ├── member-access-entity-sql.md │ │ │ │ │ ├── method-based-query-syntax-examples-aggregate-operators.md │ │ │ │ │ ├── method-based-query-syntax-examples-conversion.md │ │ │ │ │ ├── method-based-query-syntax-examples-element-operators.md │ │ │ │ │ ├── method-based-query-syntax-examples-filtering.md │ │ │ │ │ ├── method-based-query-syntax-examples-grouping.md │ │ │ │ │ ├── method-based-query-syntax-examples-join-operators.md │ │ │ │ │ ├── method-based-query-syntax-examples-navigating-relationships.md │ │ │ │ │ ├── method-based-query-syntax-examples-ordering.md │ │ │ │ │ ├── method-based-query-syntax-examples-partitioning.md │ │ │ │ │ ├── method-based-query-syntax-examples-projection.md │ │ │ │ │ ├── modulo-entity-sql.md │ │ │ │ │ ├── multiply-entity-sql.md │ │ │ │ │ ├── multiset-entity-sql.md │ │ │ │ │ ├── named-type-constructor-entity-sql.md │ │ │ │ │ ├── namespaces-entity-sql.md │ │ │ │ │ ├── navigate-entity-sql.md │ │ │ │ │ ├── negative-entity-sql.md │ │ │ │ │ ├── not-entity-sql.md │ │ │ │ │ ├── not-equal-to-entity-sql.md │ │ │ │ │ ├── null-comparisons.md │ │ │ │ │ ├── null-literals-and-type-inference-entity-sql.md │ │ │ │ │ ├── nullable-structured-types-entity-sql.md │ │ │ │ │ ├── oftype-entity-sql.md │ │ │ │ │ ├── operator-precedence-entity-sql.md │ │ │ │ │ ├── or-entity-sql.md │ │ │ │ │ ├── order-by-entity-sql.md │ │ │ │ │ ├── other-canonical-functions.md │ │ │ │ │ ├── overlaps-entity-sql.md │ │ │ │ │ ├── paging-entity-sql.md │ │ │ │ │ ├── parameters-entity-sql.md │ │ │ │ │ ├── queries-in-linq-to-entities.md │ │ │ │ │ ├── query-execution.md │ │ │ │ │ ├── query-expression-syntax-examples-aggregate-operators.md │ │ │ │ │ ├── query-expression-syntax-examples-element-operators.md │ │ │ │ │ ├── query-expression-syntax-examples-filtering.md │ │ │ │ │ ├── query-expression-syntax-examples-grouping.md │ │ │ │ │ ├── query-expression-syntax-examples-join-operators.md │ │ │ │ │ ├── query-expression-syntax-examples-navigating-relationships.md │ │ │ │ │ ├── query-expression-syntax-examples-ordering.md │ │ │ │ │ ├── query-expression-syntax-examples-partitioning.md │ │ │ │ │ ├── query-expression-syntax-examples-projection.md │ │ │ │ │ ├── query-expressions-entity-sql.md │ │ │ │ │ ├── query-plan-caching-entity-sql.md │ │ │ │ │ ├── query-results.md │ │ │ │ │ ├── ref-entity-sql.md │ │ │ │ │ ├── row-entity-sql.md │ │ │ │ │ ├── select-entity-sql.md │ │ │ │ │ ├── set-entity-sql.md │ │ │ │ │ ├── skip-entity-sql.md │ │ │ │ │ ├── spatial-functions.md │ │ │ │ │ ├── standard-query-operators-in-linq-to-entities-queries.md │ │ │ │ │ ├── string-canonical-functions.md │ │ │ │ │ ├── string-concatenation-entity-sql.md │ │ │ │ │ ├── subtract-entity-sql.md │ │ │ │ │ ├── supported-and-unsupported-linq-methods-linq-to-entities.md │ │ │ │ │ ├── then-entity-sql.md │ │ │ │ │ ├── toc.yml │ │ │ │ │ ├── top-entity-sql.md │ │ │ │ │ ├── treat-entity-sql.md │ │ │ │ │ ├── type-definitions-entity-sql.md │ │ │ │ │ ├── type-system-entity-sql.md │ │ │ │ │ ├── union-entity-sql.md │ │ │ │ │ ├── unsupported-expressions-entity-sql.md │ │ │ │ │ ├── user-defined-functions-entity-sql.md │ │ │ │ │ ├── using-entity-sql.md │ │ │ │ │ ├── variables-entity-sql.md │ │ │ │ │ └── where-entity-sql.md │ │ │ │ ├── mathematical-functions.md │ │ │ │ ├── media │ │ │ │ │ ├── 1ec61ed3-fcdd-4649-9089-24385be7e423.gif │ │ │ │ │ ├── 406d4f5f-6166-44ea-8e74-c5001d5d5d79.gif │ │ │ │ │ ├── 430180f5-4fb9-4bc3-8589-d566512d9703.gif │ │ │ │ │ ├── 558ba7b3-dd19-48d0-b91e-30a76415bf5f.gif │ │ │ │ │ ├── 7510346f-8b09-4c99-b411-40af239c3c4d.gif │ │ │ │ │ ├── 9456d6a9-ea2e-40ae-accc-a10e18e28b81.gif │ │ │ │ │ ├── b42a7a5c-0ac0-4911-86be-0460a78760ba.gif │ │ │ │ │ ├── ca62c31b-7ff6-4836-b209-e16166304fdc.gif │ │ │ │ │ ├── cd2afa99-7256-4c63-aaa9-c2d13f18a3d8.gif │ │ │ │ │ ├── d541eba3-2ee6-4cd1-88f5-89d0b2582a6c.gif │ │ │ │ │ ├── de1ca705-4f7c-4d2d-ace5-afefc6d3cefa.gif │ │ │ │ │ ├── dfb3d02b-7a8c-4d51-ac5a-a73d8aa145e6.gif │ │ │ │ │ └── wd-efarchdiagram.gif │ │ │ │ ├── migration-considerations.md │ │ │ │ ├── modeling-and-mapping.md │ │ │ │ ├── modification-sql-generation.md │ │ │ │ ├── overview.md │ │ │ │ ├── performance-considerations.md │ │ │ │ ├── provider-manifest-specification.md │ │ │ │ ├── querying-a-conceptual-model.md │ │ │ │ ├── resources.md │ │ │ │ ├── security-considerations.md │ │ │ │ ├── sql-generation-in-the-sample-provider.md │ │ │ │ ├── sql-generation.md │ │ │ │ ├── sqlclient-for-ef-functions.md │ │ │ │ ├── sqlclient-for-ef-types.md │ │ │ │ ├── sqlclient-for-the-entity-framework.md │ │ │ │ ├── string-functions.md │ │ │ │ ├── system-functions.md │ │ │ │ ├── terminology.md │ │ │ │ ├── the-shape-of-the-command-trees.md │ │ │ │ ├── toc.yml │ │ │ │ ├── walkthrough-sql-generation.md │ │ │ │ ├── working-with-data-definition-language.md │ │ │ │ ├── working-with-data-providers.md │ │ │ │ ├── working-with-objects.md │ │ │ │ └── writing-an-ef-data-provider.md │ │ │ ├── entity-container.md │ │ │ ├── entity-data-model-inheritance.md │ │ │ ├── entity-data-model-key-concepts.md │ │ │ ├── entity-data-model-namespaces.md │ │ │ ├── entity-data-model-primitive-data-types.md │ │ │ ├── entity-data-model.md │ │ │ ├── entity-key.md │ │ │ ├── entity-set.md │ │ │ ├── entity-type.md │ │ │ ├── establishing-the-connection.md │ │ │ ├── executing-a-command.md │ │ │ ├── facet.md │ │ │ ├── factory-model-overview.md │ │ │ ├── filling-a-dataset-using-one-or-more-ref-cursors.md │ │ │ ├── filtering-with-dataview-linq-to-dataset.md │ │ │ ├── floating-point-numbers.md │ │ │ ├── foreign-key-property.md │ │ │ ├── generating-commands-with-commandbuilders.md │ │ │ ├── generic-field-and-setfield-methods-linq-to-dataset.md │ │ │ ├── getschema-and-schema-collections.md │ │ │ ├── getting-started-linq-to-dataset.md │ │ │ ├── handling-dataadapter-events.md │ │ │ ├── how-to-bind-a-dataview-object-to-a-winforms-datagridview-control.md │ │ │ ├── how-to-create-a-linq-to-dataset-project-in-vs.md │ │ │ ├── implement-copytodatatable-where-type-not-a-datarow.md │ │ │ ├── index.md │ │ │ ├── linq-and-ado-net.md │ │ │ ├── linq-to-dataset-examples.md │ │ │ ├── linq-to-dataset-overview.md │ │ │ ├── linq-to-dataset.md │ │ │ ├── loading-data-into-a-dataset.md │ │ │ ├── local-transactions.md │ │ │ ├── media │ │ │ │ ├── ado-1-bpuedev11.png │ │ │ │ ├── association-end-multiplicity │ │ │ │ │ └── example-model-three-entity-types.gif │ │ │ │ ├── association-end │ │ │ │ │ └── example-model-three-entity-types.gif │ │ │ │ ├── association-set-end │ │ │ │ │ ├── example-model-three-entity-types.gif │ │ │ │ │ └── sets-example-association.gif │ │ │ │ ├── association-set │ │ │ │ │ ├── example-model-three-entity-types.gif │ │ │ │ │ └── sets-example-association.gif │ │ │ │ ├── association-type │ │ │ │ │ └── example-model-three-entity-types.gif │ │ │ │ ├── dpue-linqtoadonetoverview-bpuedev11.gif │ │ │ │ ├── entity-container │ │ │ │ │ └── example-model-three-entity-types.gif │ │ │ │ ├── entity-data-model-inheritance │ │ │ │ │ └── entity-type-inheritance.gif │ │ │ │ ├── entity-data-model-key-concepts │ │ │ │ │ └── conceptual-model-entity-types-associations.gif │ │ │ │ ├── entity-key │ │ │ │ │ └── example-model-three-entity-types.gif │ │ │ │ ├── entity-set │ │ │ │ │ ├── example-model-three-entity-types.gif │ │ │ │ │ └── sets-example-association.gif │ │ │ │ ├── entity-type │ │ │ │ │ └── example-model-three-entity-types.gif │ │ │ │ ├── foreign-key-property │ │ │ │ │ └── reference-constraint-model.gif │ │ │ │ ├── linq-to-dataset │ │ │ │ │ └── linq-dataset-ado-dotnet-provider.gif │ │ │ │ ├── model-defined-function │ │ │ │ │ └── model-published-date-three-entity-types.gif │ │ │ │ ├── navigation-property │ │ │ │ │ └── conceptual-model-entity-types-associations.gif │ │ │ │ ├── netdataproviders-bpuedev11.gif │ │ │ │ ├── property │ │ │ │ │ └── example-model-three-entity-types.gif │ │ │ │ └── referential-integrity-constraint │ │ │ │ │ └── reference-constraint-model.gif │ │ │ ├── method-based-query-examples-linq-to-dataset.md │ │ │ ├── method-based-query-syntax-examples-aggregate-operators.md │ │ │ ├── method-based-query-syntax-examples-conversion-operators.md │ │ │ ├── method-based-query-syntax-examples-element-operators.md │ │ │ ├── method-based-query-syntax-examples-join-linq-to-dataset.md │ │ │ ├── method-based-query-syntax-examples-ordering-linq-to-dataset.md │ │ │ ├── method-based-query-syntax-examples-partitioning-linq.md │ │ │ ├── method-based-query-syntax-examples-projection.md │ │ │ ├── method-based-query-syntax-examples-set-operators.md │ │ │ ├── model-declared-function.md │ │ │ ├── model-defined-function.md │ │ │ ├── modifying-data-with-a-dbdataadapter.md │ │ │ ├── modifying-data-with-stored-procedures.md │ │ │ ├── navigation-property.md │ │ │ ├── obtaining-a-dbproviderfactory.md │ │ │ ├── obtaining-a-single-value-from-a-database.md │ │ │ ├── odbc-data-type-mappings.md │ │ │ ├── odbc-schema-collections.md │ │ │ ├── ole-db-data-type-mappings.md │ │ │ ├── ole-db-odbc-and-oracle-connection-pooling.md │ │ │ ├── ole-db-schema-collections.md │ │ │ ├── optimistic-concurrency.md │ │ │ ├── oracle-and-adonet.md │ │ │ ├── oracle-bfiles.md │ │ │ ├── oracle-data-type-mappings.md │ │ │ ├── oracle-distributed-transactions.md │ │ │ ├── oracle-lobs.md │ │ │ ├── oracle-ref-cursors.md │ │ │ ├── oracle-schema-collections.md │ │ │ ├── oracle-sequences.md │ │ │ ├── oracletypes.md │ │ │ ├── paging-through-a-query-result.md │ │ │ ├── performance-counters.md │ │ │ ├── performing-batch-operations-using-dataadapters.md │ │ │ ├── performing-catalog-operations.md │ │ │ ├── populating-a-dataset-from-a-dataadapter.md │ │ │ ├── privacy-and-data-security.md │ │ │ ├── programming-guide-linq-to-dataset.md │ │ │ ├── property.md │ │ │ ├── protecting-connection-information.md │ │ │ ├── queries-in-linq-to-dataset.md │ │ │ ├── query-expression-examples-linq-to-dataset.md │ │ │ ├── query-expression-syntax-examples-aggregate-operators.md │ │ │ ├── query-expression-syntax-examples-element-operators.md │ │ │ ├── query-expression-syntax-examples-join-operators.md │ │ │ ├── query-expression-syntax-examples-ordering-linq-to-dataset.md │ │ │ ├── query-expression-syntax-examples-partitioning.md │ │ │ ├── query-expression-syntax-examples-projection-linq-to-dataset.md │ │ │ ├── query-expression-syntax-examples-restriction-linq-to-dataset.md │ │ │ ├── querying-datasets-linq-to-dataset.md │ │ │ ├── querying-the-datarowview-collection-in-a-dataview.md │ │ │ ├── querying-typed-datasets.md │ │ │ ├── ref-cursor-examples.md │ │ │ ├── ref-cursor-parameters-in-an-oracledatareader.md │ │ │ ├── referential-integrity-constraint.md │ │ │ ├── retrieving-and-modifying-data.md │ │ │ ├── retrieving-binary-data.md │ │ │ ├── retrieving-data-from-multiple-ref-cursors.md │ │ │ ├── retrieving-data-using-a-datareader.md │ │ │ ├── retrieving-database-schema-information.md │ │ │ ├── retrieving-identity-or-autonumber-values.md │ │ │ ├── schema-restrictions.md │ │ │ ├── secure-client-applications.md │ │ │ ├── secure-data-access.md │ │ │ ├── securing-ado-net-applications.md │ │ │ ├── security-linq-to-dataset.md │ │ │ ├── security-overview.md │ │ │ ├── side-by-side-execution.md │ │ │ ├── single-table-queries-linq-to-dataset.md │ │ │ ├── sorting-with-dataview-linq-to-dataset.md │ │ │ ├── sql-server-connection-pooling.md │ │ │ ├── sql-server-data-type-mappings.md │ │ │ ├── sql-server-schema-collections.md │ │ │ ├── sql │ │ │ │ ├── application-security-scenarios-in-sql-server.md │ │ │ │ ├── aspnet-apps-using-wait-handles.md │ │ │ │ ├── asynchronous-operations.md │ │ │ │ ├── authentication-in-sql-server.md │ │ │ │ ├── authorization-and-permissions-in-sql-server.md │ │ │ │ ├── bulk-copy-example-setup.md │ │ │ │ ├── bulk-copy-operations-in-sql-server.md │ │ │ │ ├── clr-integration-security-in-sql-server.md │ │ │ │ ├── clr-stored-procedures.md │ │ │ │ ├── clr-triggers.md │ │ │ │ ├── clr-user-defined-functions.md │ │ │ │ ├── clr-user-defined-types.md │ │ │ │ ├── comparing-guid-and-uniqueidentifier-values.md │ │ │ │ ├── creating-application-roles-in-sql-server.md │ │ │ │ ├── customizing-permissions-with-impersonation-in-sql-server.md │ │ │ │ ├── data-encryption-in-sql-server.md │ │ │ │ ├── database-mirroring-in-sql-server.md │ │ │ │ ├── date-and-time-data.md │ │ │ │ ├── detecting-changes-with-sqldependency.md │ │ │ │ ├── enabling-cross-database-access-in-sql-server.md │ │ │ │ ├── enabling-multiple-active-result-sets.md │ │ │ │ ├── enabling-query-notifications.md │ │ │ │ ├── enumerating-instances-of-sql-server.md │ │ │ │ ├── filestream-data.md │ │ │ │ ├── granting-row-level-permissions-in-sql-server.md │ │ │ │ ├── handling-null-values.md │ │ │ │ ├── index.md │ │ │ │ ├── inserting-an-image-from-a-file.md │ │ │ │ ├── introduction-to-sql-server-clr-integration.md │ │ │ │ ├── large-udts.md │ │ │ │ ├── linq │ │ │ │ │ ├── adding-business-logic-by-using-partial-methods.md │ │ │ │ │ ├── ado-net-and-linq-to-sql.md │ │ │ │ │ ├── aggregate-queries.md │ │ │ │ │ ├── analyzing-linq-to-sql-source-code.md │ │ │ │ │ ├── attribute-based-mapping.md │ │ │ │ │ ├── background-information.md │ │ │ │ │ ├── basic-data-types.md │ │ │ │ │ ├── boolean-data-types.md │ │ │ │ │ ├── code-generation-in-linq-to-sql.md │ │ │ │ │ ├── communicating-with-the-database.md │ │ │ │ │ ├── compute-the-sum-of-values-in-a-numeric-sequence.md │ │ │ │ │ ├── concatenate-two-sequences.md │ │ │ │ │ ├── convert-a-sequence-to-a-generic-list.md │ │ │ │ │ ├── convert-a-sequence-to-an-array.md │ │ │ │ │ ├── convert-a-type-to-a-generic-ienumerable.md │ │ │ │ │ ├── count-the-number-of-elements-in-a-sequence.md │ │ │ │ │ ├── creating-the-object-model.md │ │ │ │ │ ├── customizing-insert-update-and-delete-operations.md │ │ │ │ │ ├── customizing-operations-by-using-stored-procedures-exclusively.md │ │ │ │ │ ├── customizing-operations-by-using-stored-procedures.md │ │ │ │ │ ├── customizing-operations-overview.md │ │ │ │ │ ├── data-binding.md │ │ │ │ │ ├── data-retrieval-and-cud-operations-in-n-tier-applications.md │ │ │ │ │ ├── data-types-and-functions.md │ │ │ │ │ ├── debugging-support.md │ │ │ │ │ ├── deferred-versus-immediate-loading.md │ │ │ │ │ ├── determine-if-any-or-all-elements-in-a-sequence-satisfy-a-condition.md │ │ │ │ │ ├── downloading-sample-databases.md │ │ │ │ │ ├── eliminate-duplicate-elements-from-a-sequence.md │ │ │ │ │ ├── external-mapping.md │ │ │ │ │ ├── find-the-maximum-value-in-a-numeric-sequence.md │ │ │ │ │ ├── find-the-minimum-value-in-a-numeric-sequence.md │ │ │ │ │ ├── formulate-joins-and-cross-product-queries.md │ │ │ │ │ ├── formulate-projections.md │ │ │ │ │ ├── frequently-asked-questions.md │ │ │ │ │ ├── getting-started.md │ │ │ │ │ ├── group-elements-in-a-sequence.md │ │ │ │ │ ├── how-to-bracket-data-submissions-by-using-transactions.md │ │ │ │ │ ├── how-to-call-user-defined-functions-inline.md │ │ │ │ │ ├── how-to-connect-to-a-database.md │ │ │ │ │ ├── how-to-control-how-much-related-data-is-retrieved.md │ │ │ │ │ ├── how-to-customize-entity-classes-by-using-the-code-editor.md │ │ │ │ │ ├── how-to-delete-rows-from-the-database.md │ │ │ │ │ ├── how-to-detect-and-resolve-conflicting-submissions.md │ │ │ │ │ ├── how-to-directly-execute-sql-commands.md │ │ │ │ │ ├── how-to-directly-execute-sql-queries.md │ │ │ │ │ ├── how-to-display-a-changeset.md │ │ │ │ │ ├── how-to-display-generated-sql.md │ │ │ │ │ ├── how-to-display-linq-to-sql-commands.md │ │ │ │ │ ├── how-to-dynamically-create-a-database.md │ │ │ │ │ ├── how-to-filter-at-the-datacontext-level.md │ │ │ │ │ ├── how-to-filter-related-data.md │ │ │ │ │ ├── how-to-generate-customized-code-by-modifying-a-dbml-file.md │ │ │ │ │ ├── how-to-generate-the-object-model-as-an-external-file.md │ │ │ │ │ ├── how-to-generate-the-object-model-in-visual-basic-or-csharp.md │ │ │ │ │ ├── how-to-handle-composite-keys-in-queries.md │ │ │ │ │ ├── how-to-insert-rows-into-the-database.md │ │ │ │ │ ├── how-to-make-entities-serializable.md │ │ │ │ │ ├── how-to-manage-change-conflicts.md │ │ │ │ │ ├── how-to-map-database-relationships.md │ │ │ │ │ ├── how-to-map-inheritance-hierarchies.md │ │ │ │ │ ├── how-to-query-for-information.md │ │ │ │ │ ├── how-to-represent-columns-as-allowing-null-values.md │ │ │ │ │ ├── how-to-represent-columns-as-class-members.md │ │ │ │ │ ├── how-to-represent-columns-as-database-generated.md │ │ │ │ │ ├── how-to-represent-columns-as-timestamp-or-version-columns.md │ │ │ │ │ ├── how-to-represent-computed-columns.md │ │ │ │ │ ├── how-to-represent-primary-keys.md │ │ │ │ │ ├── how-to-represent-tables-as-classes.md │ │ │ │ │ ├── how-to-resolve-conflicts-by-merging-with-database-values.md │ │ │ │ │ ├── how-to-resolve-conflicts-by-overwriting-database-values.md │ │ │ │ │ ├── how-to-resolve-conflicts-by-retaining-database-values.md │ │ │ │ │ ├── how-to-retrieve-entity-conflict-information.md │ │ │ │ │ ├── how-to-retrieve-information-as-read-only.md │ │ │ │ │ ├── how-to-retrieve-many-objects-at-once.md │ │ │ │ │ ├── how-to-retrieve-member-conflict-information.md │ │ │ │ │ ├── how-to-return-rowsets.md │ │ │ │ │ ├── how-to-reuse-a-connection-between-an-ado-net-command-and-a-datacontext.md │ │ │ │ │ ├── how-to-specify-concurrency-conflict-checking.md │ │ │ │ │ ├── how-to-specify-database-data-types.md │ │ │ │ │ ├── how-to-specify-database-names.md │ │ │ │ │ ├── how-to-specify-private-storage-fields.md │ │ │ │ │ ├── how-to-specify-when-concurrency-exceptions-are-thrown.md │ │ │ │ │ ├── how-to-specify-which-members-are-tested-for-concurrency-conflicts.md │ │ │ │ │ ├── how-to-store-and-reuse-queries.md │ │ │ │ │ ├── how-to-submit-changes-to-the-database.md │ │ │ │ │ ├── how-to-turn-off-deferred-loading.md │ │ │ │ │ ├── how-to-update-rows-in-the-database.md │ │ │ │ │ ├── how-to-use-scalar-valued-user-defined-functions.md │ │ │ │ │ ├── how-to-use-stored-procedures-mapped-for-multiple-result-shapes.md │ │ │ │ │ ├── how-to-use-stored-procedures-mapped-for-sequential-result-shapes.md │ │ │ │ │ ├── how-to-use-stored-procedures-that-take-parameters.md │ │ │ │ │ ├── how-to-use-table-valued-user-defined-functions.md │ │ │ │ │ ├── how-to-validate-dbml-and-external-mapping-files.md │ │ │ │ │ ├── implementing-business-logic-linq-to-sql.md │ │ │ │ │ ├── index.md │ │ │ │ │ ├── inheritance-support.md │ │ │ │ │ ├── insert-update-and-delete-operations.md │ │ │ │ │ ├── learning-by-walkthroughs.md │ │ │ │ │ ├── linq-to-sql-n-tier-with-aspnet.md │ │ │ │ │ ├── linq-to-sql-n-tier-with-web-services.md │ │ │ │ │ ├── linq-to-sql-queries.md │ │ │ │ │ ├── local-method-calls.md │ │ │ │ │ ├── making-and-submitting-data-changes.md │ │ │ │ │ ├── media │ │ │ │ │ │ ├── dlinq-3.png │ │ │ │ │ │ ├── sql-clr-type-mapping.png │ │ │ │ │ │ └── the-linq-to-sql-object-model │ │ │ │ │ │ │ └── linq-object-model-two-tier.png │ │ │ │ │ ├── n-tier-and-remote-applications-with-linq-to-sql.md │ │ │ │ │ ├── null-semantics.md │ │ │ │ │ ├── numeric-and-comparison-operators.md │ │ │ │ │ ├── object-identity.md │ │ │ │ │ ├── object-states-and-change-tracking.md │ │ │ │ │ ├── optimistic-concurrency-overview.md │ │ │ │ │ ├── programming-guide.md │ │ │ │ │ ├── query-concepts.md │ │ │ │ │ ├── query-examples.md │ │ │ │ │ ├── querying-across-relationships.md │ │ │ │ │ ├── querying-the-database.md │ │ │ │ │ ├── reference.md │ │ │ │ │ ├── remote-vs-local-execution.md │ │ │ │ │ ├── responsibilities-of-the-developer-in-overriding-default-behavior.md │ │ │ │ │ ├── retrieving-objects-from-the-identity-cache.md │ │ │ │ │ ├── return-or-skip-elements-in-a-sequence.md │ │ │ │ │ ├── return-the-average-value-from-a-numeric-sequence.md │ │ │ │ │ ├── return-the-first-element-in-a-sequence.md │ │ │ │ │ ├── return-the-set-difference-between-two-sequences.md │ │ │ │ │ ├── return-the-set-intersection-of-two-sequences.md │ │ │ │ │ ├── return-the-set-union-of-two-sequences.md │ │ │ │ │ ├── samples.md │ │ │ │ │ ├── security-in-linq-to-sql.md │ │ │ │ │ ├── sequence-operators.md │ │ │ │ │ ├── serialization.md │ │ │ │ │ ├── sort-elements-in-a-sequence.md │ │ │ │ │ ├── sql-clr-custom-type-mappings.md │ │ │ │ │ ├── sql-clr-type-mapping.md │ │ │ │ │ ├── sql-clr-type-mismatches.md │ │ │ │ │ ├── sql-server-compact-and-linq-to-sql.md │ │ │ │ │ ├── standard-query-operator-translation.md │ │ │ │ │ ├── stored-procedures.md │ │ │ │ │ ├── system-convert-methods.md │ │ │ │ │ ├── system-datetime-methods.md │ │ │ │ │ ├── system-datetimeoffset-methods.md │ │ │ │ │ ├── system-math-methods.md │ │ │ │ │ ├── system-object-methods.md │ │ │ │ │ ├── system-string-methods.md │ │ │ │ │ ├── system-timespan-methods.md │ │ │ │ │ ├── the-linq-to-sql-object-model.md │ │ │ │ │ ├── toc.yml │ │ │ │ │ ├── transaction-support.md │ │ │ │ │ ├── troubleshooting.md │ │ │ │ │ ├── typical-steps-for-using-linq-to-sql.md │ │ │ │ │ ├── unsupported-functionality.md │ │ │ │ │ ├── user-defined-functions.md │ │ │ │ │ ├── walkthrough-manipulating-data-csharp.md │ │ │ │ │ ├── walkthrough-manipulating-data-visual-basic.md │ │ │ │ │ ├── walkthrough-querying-across-relationships-csharp.md │ │ │ │ │ ├── walkthrough-querying-across-relationships-visual-basic.md │ │ │ │ │ ├── walkthrough-simple-object-model-and-query-csharp.md │ │ │ │ │ ├── walkthrough-simple-object-model-and-query-visual-basic.md │ │ │ │ │ ├── walkthrough-using-only-stored-procedures-csharp.md │ │ │ │ │ ├── walkthrough-using-only-stored-procedures-visual-basic.md │ │ │ │ │ └── what-you-can-do-with-linq-to-sql.md │ │ │ │ ├── managing-permissions-with-stored-procedures-in-sql-server.md │ │ │ │ ├── manipulating-data.md │ │ │ │ ├── media │ │ │ │ │ └── truthtable-bpuedev11.gif │ │ │ │ ├── modifying-large-value-max-data.md │ │ │ │ ├── multiple-active-result-sets-mars.md │ │ │ │ ├── multiple-bulk-copy-operations.md │ │ │ │ ├── overview-of-sql-server-security.md │ │ │ │ ├── ownership-and-user-schema-separation-in-sql-server.md │ │ │ │ ├── polling-in-console-applications.md │ │ │ │ ├── provider-statistics-for-sql-server.md │ │ │ │ ├── query-notifications-in-sql-server.md │ │ │ │ ├── server-and-database-roles-in-sql-server.md │ │ │ │ ├── signing-stored-procedures-in-sql-server.md │ │ │ │ ├── single-bulk-copy-operations.md │ │ │ │ ├── snapshot-isolation-in-sql-server.md │ │ │ │ ├── specifying-xml-values-as-parameters.md │ │ │ │ ├── sql-server-binary-and-large-value-data.md │ │ │ │ ├── sql-server-common-language-runtime-integration.md │ │ │ │ ├── sql-server-data-operations.md │ │ │ │ ├── sql-server-data-types.md │ │ │ │ ├── sql-server-express-security.md │ │ │ │ ├── sql-server-express-user-instances.md │ │ │ │ ├── sql-server-features-and-adonet.md │ │ │ │ ├── sql-server-in-process-specific-behavior-of-adonet.md │ │ │ │ ├── sql-server-security.md │ │ │ │ ├── sql-xml-column-values.md │ │ │ │ ├── sqlclient-support-for-high-availability-disaster-recovery.md │ │ │ │ ├── sqlclient-support-for-localdb.md │ │ │ │ ├── sqlcommand-execution-with-a-sqlnotificationrequest.md │ │ │ │ ├── sqldependency-in-an-aspnet-app.md │ │ │ │ ├── sqltypes-and-the-dataset.md │ │ │ │ ├── table-valued-parameters.md │ │ │ │ ├── the-context-connection.md │ │ │ │ ├── toc.yml │ │ │ │ ├── transaction-and-bulk-copy-operations.md │ │ │ │ ├── windows-applications-using-callbacks.md │ │ │ │ ├── writing-secure-dynamic-sql-in-sql-server.md │ │ │ │ └── xml-data-in-sql-server.md │ │ │ ├── sqlclient-streaming-support.md │ │ │ ├── system-requirements-for-the-dotnet-data-provider-for-oracle.md │ │ │ ├── system-transactions-integration-with-sql-server.md │ │ │ ├── toc.yml │ │ │ ├── transactions-and-concurrency.md │ │ │ ├── updating-data-in-a-data-source.md │ │ │ ├── updating-data-sources-with-dataadapters.md │ │ │ ├── using-commands-to-modify-data.md │ │ │ └── whats-new.md │ │ ├── index.md │ │ ├── toc.yml │ │ ├── transactions │ │ │ ├── committing-a-transaction-in-single-phase-and-multi-phase.md │ │ │ ├── diagnostic-traces.md │ │ │ ├── enlisting-resources-as-participants-in-a-transaction.md │ │ │ ├── features-provided-by-system-transactions.md │ │ │ ├── implementing-a-resource-manager.md │ │ │ ├── implementing-an-explicit-transaction-using-committabletransaction.md │ │ │ ├── implementing-an-implicit-transaction-using-transaction-scope.md │ │ │ ├── index.md │ │ │ ├── interoperability-with-enterprise-services-and-com-transactions.md │ │ │ ├── managing-concurrency-with-dependenttransaction.md │ │ │ ├── optimization-spc-and-promotable-spn.md │ │ │ ├── performing-recovery.md │ │ │ ├── security-trust-levels-in-accessing-resources.md │ │ │ ├── toc.yml │ │ │ ├── transaction-fundamentals.md │ │ │ ├── transaction-management-escalation.md │ │ │ ├── using-system-transactions-in-aspnet.md │ │ │ └── writing-a-transactional-application.md │ │ └── wcf │ │ │ ├── accessing-data-service-resources-wcf-data-services.md │ │ │ ├── accessing-the-service-from-a-web-browser-wcf-data-services-quickstart.md │ │ │ ├── application-scenarios-wcf-data-services.md │ │ │ ├── asynchronous-operations-wcf-data-services.md │ │ │ ├── attach-an-existing-entity-to-dc-wcf-data.md │ │ │ ├── batching-operations-wcf-data-services.md │ │ │ ├── bind-data-to-wpf-elements-wcf-data-services.md │ │ │ ├── binding-data-to-controls-wcf-data-services.md │ │ │ ├── calling-service-operations-wcf-data-services.md │ │ │ ├── configuring-the-data-service-wcf-data-services.md │ │ │ ├── create-a-data-service-using-an-adonet-ef-data-wcf.md │ │ │ ├── create-a-data-service-using-linq-to-sql-wcf.md │ │ │ ├── create-a-data-service-using-rp-wcf-data-services.md │ │ │ ├── create-an-asynchronous-wpf-application-wcf-data-services.md │ │ │ ├── creating-the-data-service.md │ │ │ ├── creating-the-dotnet-client-application-wcf-data-services-quickstart.md │ │ │ ├── custom-data-service-providers-wcf-data-services.md │ │ │ ├── data-service-versioning-wcf-data-services.md │ │ │ ├── data-services-providers-wcf-data-services.md │ │ │ ├── defining-wcf-data-services.md │ │ │ ├── developing-and-deploying-wcf-data-services.md │ │ │ ├── entity-framework-provider-wcf-data-services.md │ │ │ ├── exposing-your-data-as-a-service-wcf-data-services.md │ │ │ ├── feed-customization-wcf-data-services.md │ │ │ ├── generating-the-data-service-client-library-wcf-data-services.md │ │ │ ├── getting-started-with-wcf-data-services.md │ │ │ ├── hosting-the-data-service-wcf-data-services.md │ │ │ ├── how-to-add-a-data-service-reference-wcf-data-services.md │ │ │ ├── how-to-add-modify-and-delete-entities-wcf-data-services.md │ │ │ ├── how-to-add-query-options-to-a-data-service-query-wcf-data-services.md │ │ │ ├── how-to-bind-data-using-a-project-data-source-wcf-data-services.md │ │ │ ├── how-to-customize-data-binding-behaviors-wcf-data-services.md │ │ │ ├── how-to-customize-feeds-with-ef-provider-wcf-data-services.md │ │ │ ├── how-to-customize-feeds-with-the-reflection-provider-wcf-data-services.md │ │ │ ├── how-to-define-a-service-operation-wcf-data-services.md │ │ │ ├── how-to-define-entity-relationships-wcf-data-services.md │ │ │ ├── how-to-develop-a-wcf-data-service-running-on-iis.md │ │ │ ├── how-to-enable-access-to-the-data-service-wcf-data-services.md │ │ │ ├── how-to-enable-paging-of-data-service-results-wcf-data-services.md │ │ │ ├── how-to-execute-asynchronous-data-service-queries-wcf-data-services.md │ │ │ ├── how-to-execute-data-service-queries-wcf-data-services.md │ │ │ ├── how-to-execute-queries-in-a-batch-wcf-data-services.md │ │ │ ├── how-to-intercept-data-service-messages-wcf-data-services.md │ │ │ ├── how-to-load-paged-results-wcf-data-services.md │ │ │ ├── how-to-load-related-entities-wcf-data-services.md │ │ │ ├── how-to-manually-generate-client-data-service-classes-wcf-data-services.md │ │ │ ├── how-to-project-query-results-wcf-data-services.md │ │ │ ├── how-to-set-headers-in-the-client-request-wcf-data-services.md │ │ │ ├── index.md │ │ │ ├── interceptors-wcf-data-services.md │ │ │ ├── linq-considerations-wcf-data-services.md │ │ │ ├── loading-deferred-content-wcf-data-services.md │ │ │ ├── managing-the-data-service-context-wcf-data-services.md │ │ │ ├── media │ │ │ ├── wcf-data-service-item-template.png │ │ │ └── wcf-data-services-overview │ │ │ │ └── windows-communication-foundation-data-services-architecture.gif │ │ │ ├── number-of-entities-returned-by-a-query-wcf.md │ │ │ ├── object-materialization-wcf-data-services.md │ │ │ ├── query-projections-wcf-data-services.md │ │ │ ├── querying-the-data-service-wcf-data-services.md │ │ │ ├── quickstart-wcf-data-services.md │ │ │ ├── reflection-provider-wcf-data-services.md │ │ │ ├── securing-wcf-data-services.md │ │ │ ├── service-operations-wcf-data-services.md │ │ │ ├── specify-client-creds-for-a-data-service-request-wcf.md │ │ │ ├── streaming-provider-wcf-data-services.md │ │ │ ├── toc.yml │ │ │ ├── updating-the-data-service-wcf-data-services.md │ │ │ ├── using-a-data-service-in-a-client-application-wcf-data-services.md │ │ │ ├── using-actions-to-implement-server-side-behavior.md │ │ │ ├── wcf-data-service-client-utility-datasvcutil-exe.md │ │ │ ├── wcf-data-services-client-library.md │ │ │ ├── wcf-data-services-overview.md │ │ │ ├── wcf-data-services-protocol-implementation-details.md │ │ │ ├── wcf-data-services-resources.md │ │ │ └── working-with-binary-data-wcf-data-services.md │ ├── debug-trace-profile │ │ ├── asynchronousthreadabort-mda.md │ │ ├── bindingfailure-mda.md │ │ ├── callbackoncollecteddelegate-mda.md │ │ ├── code-contracts.md │ │ ├── contextswitchdeadlock-mda.md │ │ ├── dangerousthreadingapi-mda.md │ │ ├── datetimeinvalidlocalformat-mda.md │ │ ├── diagnosing-errors-with-managed-debugging-assistants.md │ │ ├── dirtycastandcalloninterface-mda.md │ │ ├── disconnectedcontext-mda.md │ │ ├── dllmainreturnsfalse-mda.md │ │ ├── enabling-jit-attach-debugging.md │ │ ├── enhancing-debugging-with-the-debugger-display-attributes.md │ │ ├── exceptionswallowedoncallfromcom-mda.md │ │ ├── failedqi-mda.md │ │ ├── fatalexecutionengineerror-mda.md │ │ ├── gcmanagedtounmanaged-mda.md │ │ ├── gcunmanagedtomanaged-mda.md │ │ ├── how-to-add-trace-statements-to-application-code.md │ │ ├── how-to-compile-conditionally-with-trace-and-debug.md │ │ ├── how-to-create-and-initialize-trace-listeners.md │ │ ├── how-to-create-and-initialize-trace-sources.md │ │ ├── how-to-create-initialize-and-configure-trace-switches.md │ │ ├── how-to-use-tracesource-and-filters-with-trace-listeners.md │ │ ├── illegalprepareconstrainedregion-mda.md │ │ ├── index.md │ │ ├── invalidapartmentstatechange-mda.md │ │ ├── invalidcercall-mda.md │ │ ├── invalidfunctionpointerindelegate-mda.md │ │ ├── invalidgchandlecookie-mda.md │ │ ├── invalidiunknown-mda.md │ │ ├── invalidmemberdeclaration-mda.md │ │ ├── invalidoverlappedtopinvoke-mda.md │ │ ├── invalidvariant-mda.md │ │ ├── jitcompilationstart-mda.md │ │ ├── loaderlock-mda.md │ │ ├── loadfromcontext-mda.md │ │ ├── making-an-image-easier-to-debug.md │ │ ├── marshalcleanuperror-mda.md │ │ ├── marshaling-mda.md │ │ ├── media │ │ │ └── diagnosing-errors-with-managed-debugging-assistants │ │ │ │ └── exception-settings-mdas.png │ │ ├── memberinfocachecreation-mda.md │ │ ├── moduloobjecthashcode-mda.md │ │ ├── noncomvisiblebaseclass-mda.md │ │ ├── notmarshalable-mda.md │ │ ├── opengenericcercall-mda.md │ │ ├── overlappedfreeerror-mda.md │ │ ├── performance-counters-and-in-process-side-by-side-applications.md │ │ ├── performance-counters.md │ │ ├── pinvokelog-mda.md │ │ ├── pinvokestackimbalance-mda.md │ │ ├── raceonrcwcleanup-mda.md │ │ ├── reentrancy-mda.md │ │ ├── releasehandlefailed-mda.md │ │ ├── reportavoncomrelease-mda.md │ │ ├── runtime-profiling.md │ │ ├── streamwriterbuffereddatalost-mda.md │ │ ├── toc.yml │ │ ├── trace-listeners.md │ │ ├── trace-switches.md │ │ ├── tracing-and-instrumenting-applications.md │ │ └── virtualcercall-mda.md │ ├── deployment │ │ ├── best-practices-for-assembly-loading.md │ │ ├── client-profile.md │ │ ├── configuring-assembly-binding-redirection.md │ │ ├── deploying-the-net-framework.md │ │ ├── deployment-guide-for-developers.md │ │ ├── guide-for-administrators.md │ │ ├── guidelines-for-creating-components-for-side-by-side-execution.md │ │ ├── how-the-runtime-locates-assemblies.md │ │ ├── how-to-debug-clr-activation-issues.md │ │ ├── how-to-get-progress-from-the-dotnet-installer.md │ │ ├── in-process-side-by-side-execution.md │ │ ├── index.md │ │ ├── initialization-errors-managing-the-user-experience.md │ │ ├── media │ │ │ ├── initialization-errors-managing-the-user-experience │ │ │ │ ├── initialization-error-dialog.png │ │ │ │ └── install-framework-on-demand-dialog.png │ │ │ ├── reducing-system-restarts │ │ │ │ └── close-application-dialog.png │ │ │ └── side-by-side-execution │ │ │ │ ├── side-by-side-component-execution.gif │ │ │ │ └── side-by-side-runtime-execution.gif │ │ ├── net-framework-applications.md │ │ ├── reducing-system-restarts.md │ │ ├── side-by-side-execution.md │ │ └── toc.yml │ ├── develop-client-apps.md │ ├── develop-web-apps-with-aspnet.md │ ├── development-guide.md │ ├── get-started │ │ ├── index.md │ │ ├── media │ │ │ ├── overview │ │ │ │ └── language-runtime-class-library-relationship.gif │ │ │ └── the-net-framework-and-out-of-band-releases │ │ │ │ └── nuget-package-manager-dialog.png │ │ ├── net-core-and-open-source.md │ │ ├── overview.md │ │ ├── system-requirements.md │ │ ├── the-net-framework-and-out-of-band-releases.md │ │ └── toc.yml │ ├── index.md │ ├── install │ │ ├── application-not-started.md │ │ ├── dotnet-35-windows-10.md │ │ ├── guide-for-developers.md │ │ ├── index.md │ │ ├── media │ │ │ ├── application-not-started │ │ │ │ ├── app-could-not-be-started.png │ │ │ │ ├── install-3-5.png │ │ │ │ ├── repair-tool-changes-complete.png │ │ │ │ ├── repair-tool-no-resolution.png │ │ │ │ └── repair-tool-recommended-changes.png │ │ │ ├── dotnet-35-windows-10 │ │ │ │ ├── dotnet-control-panel.png │ │ │ │ ├── dotnet-framework-installation-dialog.png │ │ │ │ └── windows-keyboard-logo.png │ │ │ ├── this-application-could-not-be-started.png │ │ │ └── visual-studio-installer.jpg │ │ ├── on-windows-10.md │ │ ├── on-windows-7.md │ │ ├── on-windows-8-1.md │ │ ├── on-windows-8.md │ │ ├── on-windows-vista.md │ │ ├── on-windows-xp.md │ │ ├── repair.md │ │ ├── run-net-framework-1-1-apps.md │ │ ├── toc.yml │ │ └── troubleshoot-blocked-installations-and-uninstallations.md │ ├── interop │ │ ├── blittable-and-non-blittable-types.md │ │ ├── callback-functions.md │ │ ├── calling-a-dll-function.md │ │ ├── com-interop-sample-com-client-and-net-server.md │ │ ├── com-interop-sample-net-client-and-com-server.md │ │ ├── compiling-an-interop-project.md │ │ ├── configure-net-framework-based-com-components-for-reg.md │ │ ├── consuming-unmanaged-dll-functions.md │ │ ├── copying-and-pinning.md │ │ ├── creating-a-class-to-hold-dll-functions.md │ │ ├── creating-prototypes-in-managed-code.md │ │ ├── default-marshaling-behavior.md │ │ ├── default-marshaling-for-arrays.md │ │ ├── default-marshaling-for-objects.md │ │ ├── default-marshaling-for-strings.md │ │ ├── deploying-an-interop-application.md │ │ ├── exposing-com-components.md │ │ ├── exposing-dotnet-components-to-com.md │ │ ├── how-to-add-references-to-type-libraries.md │ │ ├── how-to-create-com-wrappers.md │ │ ├── how-to-create-wrappers-manually.md │ │ ├── how-to-generate-interop-assemblies-from-type-libraries.md │ │ ├── how-to-generate-primary-interop-assemblies-using-tlbimp-exe.md │ │ ├── how-to-implement-callback-functions.md │ │ ├── how-to-map-hresults-and-exceptions.md │ │ ├── how-to-migrate-managed-code-dcom-to-wcf.md │ │ ├── how-to-reference-net-types-from-com.md │ │ ├── how-to-register-primary-interop-assemblies.md │ │ ├── identifying-functions-in-dlls.md │ │ ├── importing-a-type-library-as-an-assembly.md │ │ ├── index.md │ │ ├── interop-marshaling.md │ │ ├── marshaling-a-delegate-as-a-callback-method.md │ │ ├── marshaling-classes-structures-and-unions.md │ │ ├── marshaling-data-with-com-interop.md │ │ ├── marshaling-data-with-platform-invoke.md │ │ ├── marshaling-different-types-of-arrays.md │ │ ├── marshaling-strings.md │ │ ├── media │ │ │ ├── callback-functions │ │ │ │ └── platform-invoke-callback-process.gif │ │ │ ├── consuming-unmanaged-dll-functions │ │ │ │ └── platform-invoke-call.gif │ │ │ ├── copying-and-pinning │ │ │ │ ├── interop-marshal-copy.gif │ │ │ │ └── interop-marshal-reference-pin.gif │ │ │ ├── default-marshaling-for-objects │ │ │ │ └── interop-variant-passed-value-reference.gif │ │ │ ├── deploying-an-interop-application │ │ │ │ └── com-private-deployment.gif │ │ │ └── interop-marshaling │ │ │ │ ├── interop-and-com-marshaling.gif │ │ │ │ ├── interop-direct-ref-across-process.gif │ │ │ │ ├── interop-heaps-managed-and-unmanaged.gif │ │ │ │ ├── interop-marshaling-invoke-and-com.png │ │ │ │ ├── interop-remote-soap-or-tcp.gif │ │ │ │ └── single-process-across-multi-apartment.gif │ │ ├── msgbox-sample.md │ │ ├── packaging-an-assembly-for-com.md │ │ ├── passing-structures.md │ │ ├── platform-invoke-examples.md │ │ ├── registering-assemblies-with-com.md │ │ ├── registration-free-com-interop.md │ │ ├── specifying-a-character-set.md │ │ ├── specifying-an-entry-point.md │ │ ├── toc.yml │ │ └── type-equivalence-and-embedded-interop-types.md │ ├── mef │ │ ├── attributed-programming-model-overview-mef.md │ │ ├── composition-analysis-tool-mefx.md │ │ ├── index.md │ │ ├── mef-for-net-for-windows-store-apps.md │ │ └── toc.yml │ ├── migration-guide │ │ ├── application-compatibility.md │ │ ├── how-to-configure-an-app-to-support-net-framework-4-or-4-5.md │ │ ├── how-to-determine-which-net-framework-updates-are-installed.md │ │ ├── how-to-determine-which-versions-are-installed.md │ │ ├── index.md │ │ ├── media │ │ │ ├── clr-installdir.png │ │ │ ├── how-to-determine-which-net-framework-updates-are-installed │ │ │ │ └── windows-keyboard-logo.png │ │ │ └── net-4-and-earlier.png │ │ ├── migrating-from-the-net-framework-1-1.md │ │ ├── mitigation-custom-imessagefilter-prefiltermessage-implementations.md │ │ ├── mitigation-deserialization-of-objects-across-app-domains.md │ │ ├── mitigation-new-64-bit-jit-compiler.md │ │ ├── mitigation-path-colon-checks.md │ │ ├── mitigation-path-normalization.md │ │ ├── mitigation-png-frames-in-icon-objects.md │ │ ├── mitigation-pointer-based-touch-and-stylus-support.md │ │ ├── mitigation-pool-blocking-period.md │ │ ├── mitigation-product-versioning.md │ │ ├── mitigation-serialization-control-characters.md │ │ ├── mitigation-tls-protocols.md │ │ ├── mitigation-wcf-services-and-certificate-authentication.md │ │ ├── mitigation-wpf-layout.md │ │ ├── mitigation-wpf-window-rendering.md │ │ ├── mitigation-x509certificateclaimset-findclaims-method.md │ │ ├── mitigation-xml-schema-validation.md │ │ ├── mitigation-ziparchiveentry-fullname-path-separator.md │ │ ├── net-framework-4-migration-issues.md │ │ ├── retargeting │ │ │ ├── 4.0-4.5.1.md │ │ │ ├── 4.0-4.5.2.md │ │ │ ├── 4.0-4.5.md │ │ │ ├── 4.0-4.6.1.md │ │ │ ├── 4.0-4.6.2.md │ │ │ ├── 4.0-4.6.md │ │ │ ├── 4.0-4.7.1.md │ │ │ ├── 4.0-4.7.2.md │ │ │ ├── 4.0-4.7.md │ │ │ ├── 4.0-4.8.md │ │ │ ├── 4.5-4.5.1.md │ │ │ ├── 4.5-4.5.2.md │ │ │ ├── 4.5-4.6.1.md │ │ │ ├── 4.5-4.6.2.md │ │ │ ├── 4.5-4.6.md │ │ │ ├── 4.5-4.7.1.md │ │ │ ├── 4.5-4.7.2.md │ │ │ ├── 4.5-4.7.md │ │ │ ├── 4.5-4.8.md │ │ │ ├── 4.5.1-4.5.2.md │ │ │ ├── 4.5.1-4.6.1.md │ │ │ ├── 4.5.1-4.6.2.md │ │ │ ├── 4.5.1-4.6.md │ │ │ ├── 4.5.1-4.7.1.md │ │ │ ├── 4.5.1-4.7.2.md │ │ │ ├── 4.5.1-4.7.md │ │ │ ├── 4.5.1-4.8.md │ │ │ ├── 4.5.2-4.6.1.md │ │ │ ├── 4.5.2-4.6.2.md │ │ │ ├── 4.5.2-4.6.md │ │ │ ├── 4.5.2-4.7.1.md │ │ │ ├── 4.5.2-4.7.2.md │ │ │ ├── 4.5.2-4.7.md │ │ │ ├── 4.5.2-4.8.md │ │ │ ├── 4.6-4.6.1.md │ │ │ ├── 4.6-4.6.2.md │ │ │ ├── 4.6-4.7.1.md │ │ │ ├── 4.6-4.7.2.md │ │ │ ├── 4.6-4.7.md │ │ │ ├── 4.6-4.8.md │ │ │ ├── 4.6.1-4.6.2.md │ │ │ ├── 4.6.1-4.7.1.md │ │ │ ├── 4.6.1-4.7.2.md │ │ │ ├── 4.6.1-4.7.md │ │ │ ├── 4.6.1-4.8.md │ │ │ ├── 4.6.2-4.7.1.md │ │ │ ├── 4.6.2-4.7.2.md │ │ │ ├── 4.6.2-4.7.md │ │ │ ├── 4.6.2-4.8.md │ │ │ ├── 4.7-4.7.1.md │ │ │ ├── 4.7-4.7.2.md │ │ │ ├── 4.7-4.8.md │ │ │ ├── 4.7.1-4.7.2.md │ │ │ ├── 4.7.1-4.8.md │ │ │ └── 4.7.2-4.8.md │ │ ├── runtime │ │ │ ├── 4.0-4.5.1.md │ │ │ ├── 4.0-4.5.2.md │ │ │ ├── 4.0-4.5.md │ │ │ ├── 4.0-4.6.1.md │ │ │ ├── 4.0-4.6.2.md │ │ │ ├── 4.0-4.6.md │ │ │ ├── 4.0-4.7.1.md │ │ │ ├── 4.0-4.7.2.md │ │ │ ├── 4.0-4.7.md │ │ │ ├── 4.0-4.8.md │ │ │ ├── 4.5-4.5.1.md │ │ │ ├── 4.5-4.5.2.md │ │ │ ├── 4.5-4.6.1.md │ │ │ ├── 4.5-4.6.2.md │ │ │ ├── 4.5-4.6.md │ │ │ ├── 4.5-4.7.1.md │ │ │ ├── 4.5-4.7.2.md │ │ │ ├── 4.5-4.7.md │ │ │ ├── 4.5-4.8.md │ │ │ ├── 4.5.1-4.5.2.md │ │ │ ├── 4.5.1-4.6.1.md │ │ │ ├── 4.5.1-4.6.2.md │ │ │ ├── 4.5.1-4.6.md │ │ │ ├── 4.5.1-4.7.1.md │ │ │ ├── 4.5.1-4.7.2.md │ │ │ ├── 4.5.1-4.7.md │ │ │ ├── 4.5.1-4.8.md │ │ │ ├── 4.5.2-4.6.1.md │ │ │ ├── 4.5.2-4.6.2.md │ │ │ ├── 4.5.2-4.6.md │ │ │ ├── 4.5.2-4.7.1.md │ │ │ ├── 4.5.2-4.7.2.md │ │ │ ├── 4.5.2-4.7.md │ │ │ ├── 4.5.2-4.8.md │ │ │ ├── 4.6-4.6.1.md │ │ │ ├── 4.6-4.6.2.md │ │ │ ├── 4.6-4.7.1.md │ │ │ ├── 4.6-4.7.2.md │ │ │ ├── 4.6-4.7.md │ │ │ ├── 4.6-4.8.md │ │ │ ├── 4.6.1-4.6.2.md │ │ │ ├── 4.6.1-4.7.1.md │ │ │ ├── 4.6.1-4.7.2.md │ │ │ ├── 4.6.1-4.7.md │ │ │ ├── 4.6.1-4.8.md │ │ │ ├── 4.6.2-4.7.1.md │ │ │ ├── 4.6.2-4.7.2.md │ │ │ ├── 4.6.2-4.7.md │ │ │ ├── 4.6.2-4.8.md │ │ │ ├── 4.7-4.7.1.md │ │ │ ├── 4.7-4.7.2.md │ │ │ ├── 4.7-4.8.md │ │ │ ├── 4.7.1-4.7.2.md │ │ │ ├── 4.7.1-4.8.md │ │ │ └── 4.7.2-4.8.md │ │ ├── toc.yml │ │ ├── version-compatibility.md │ │ └── versions-and-dependencies.md │ ├── misc │ │ ├── code-access-security-basics.md │ │ ├── code-access-security-policy-compatibility-and-migration.md │ │ ├── code-access-security.md │ │ ├── dangerous-permissions-and-policy-administration.md │ │ ├── how-to-run-partially-trusted-code-in-a-sandbox.md │ │ ├── link-demands.md │ │ ├── media │ │ │ ├── slide-10a.gif │ │ │ └── using-the-assert-method │ │ │ │ └── assert-method-assemblies.gif │ │ ├── securing-exception-handling.md │ │ ├── securing-method-access.md │ │ ├── securing-wrapper-code.md │ │ ├── security-and-public-read-only-array-fields.md │ │ ├── security-and-remoting-considerations.md │ │ ├── security-and-serialization.md │ │ ├── security-transparent-code-level-1.md │ │ ├── security-transparent-code-level-2.md │ │ ├── security-transparent-code.md │ │ ├── using-libraries-from-partially-trusted-code.md │ │ └── using-the-assert-method.md │ ├── net-native │ │ ├── apis-that-rely-on-reflection.md │ │ ├── application-element-net-native.md │ │ ├── assembly-element-net-native.md │ │ ├── attributeimplies-element-net-native.md │ │ ├── directives-element-net-native.md │ │ ├── event-element-net-native.md │ │ ├── example-handling-exceptions-when-binding-data.md │ │ ├── example-troubleshooting-dynamic-programming.md │ │ ├── field-element-net-native.md │ │ ├── genericparameter-element-net-native.md │ │ ├── getting-started-with-net-native.md │ │ ├── impliestype-element-net-native.md │ │ ├── index.md │ │ ├── library-element-net-native.md │ │ ├── measuring-startup-improvement-with-net-native.md │ │ ├── method-element-net-native.md │ │ ├── methodinstantiation-element-net-native.md │ │ ├── migrating-your-windows-store-app-to-net-native.md │ │ ├── missinginteropdataexception-class-net-native.md │ │ ├── missingmetadataexception-class-net-native.md │ │ ├── missingruntimeartifactexception-class-net-native.md │ │ ├── namespace-element-net-native.md │ │ ├── net-native-and-compilation.md │ │ ├── net-native-general-troubleshooting.md │ │ ├── net-native-reflection-api-reference.md │ │ ├── parameter-element-net-native.md │ │ ├── property-element-net-native.md │ │ ├── reflection-and-net-native.md │ │ ├── runtime-directive-elements.md │ │ ├── runtime-directive-policy-settings.md │ │ ├── runtime-directives-rd-xml-configuration-file-reference.md │ │ ├── runtime-exceptions-in-net-native-apps.md │ │ ├── serialization-and-metadata.md │ │ ├── subtypes-element-net-native.md │ │ ├── toc.yml │ │ ├── type-element-net-native.md │ │ ├── typeinstantiation-element-net-native.md │ │ └── typeparameter-element-net-native.md │ ├── network-programming │ │ ├── about-the-system-net-peertopeer-collaboration-namespace.md │ │ ├── accessing-the-internet-through-a-proxy.md │ │ ├── asynchronous-client-socket-example.md │ │ ├── asynchronous-server-socket-example.md │ │ ├── automatic-proxy-detection.md │ │ ├── basic-and-digest-authentication.md │ │ ├── best-practices-for-system-net-classes.md │ │ ├── cache-management-for-network-applications.md │ │ ├── cache-policy-interaction-maximum-age-and-maximum-staleness.md │ │ ├── cache-policy-interaction-maximum-age-and-minimum-freshness.md │ │ ├── cache-policy.md │ │ ├── certificate-selection-and-validation.md │ │ ├── changes-to-ntlm-authentication-for-httpwebrequest-in-version-3-5-sp1.md │ │ ├── changes-to-the-system-uri-namespace-in-version-2-0.md │ │ ├── configuring-caching-in-network-applications.md │ │ ├── configuring-internet-applications.md │ │ ├── connection-grouping.md │ │ ├── creating-internet-requests.md │ │ ├── deriving-from-webrequest.md │ │ ├── deriving-from-webresponse.md │ │ ├── enabling-and-disabling-ipv6.md │ │ ├── enabling-network-tracing.md │ │ ├── ftp.md │ │ ├── handling-errors.md │ │ ├── how-to-access-http-specific-properties.md │ │ ├── how-to-assign-user-information-to-group-connections.md │ │ ├── how-to-configure-network-tracing.md │ │ ├── how-to-create-a-socket.md │ │ ├── how-to-customize-a-time-based-cache-policy.md │ │ ├── how-to-detect-network-availability-and-address-changes.md │ │ ├── how-to-download-files-with-ftp.md │ │ ├── how-to-enable-a-webrequest-to-use-a-proxy-to-communicate-with-the-internet.md │ │ ├── how-to-get-interface-and-protocol-information.md │ │ ├── how-to-list-directory-contents-with-ftp.md │ │ ├── how-to-modify-the-computer-configuration-file-to-enable-ipv6-support.md │ │ ├── how-to-override-a-global-proxy-selection.md │ │ ├── how-to-ping-a-host.md │ │ ├── how-to-register-a-custom-protocol-using-webrequest.md │ │ ├── how-to-request-a-web-page-and-retrieve-the-results-as-a-stream.md │ │ ├── how-to-request-data-using-the-webrequest-class.md │ │ ├── how-to-retrieve-a-protocol-specific-webresponse-that-matches-a-webrequest.md │ │ ├── how-to-send-data-using-the-webrequest-class.md │ │ ├── how-to-set-a-location-based-cache-policy-for-an-application.md │ │ ├── how-to-set-cache-policy-for-a-request.md │ │ ├── how-to-set-the-default-time-based-cache-policy-for-an-application.md │ │ ├── how-to-typecast-a-webrequest-to-access-protocol-specific-properties.md │ │ ├── how-to-upload-files-with-ftp.md │ │ ├── http.md │ │ ├── index.md │ │ ├── integrated-windows-authentication-with-extended-protection.md │ │ ├── international-resource-identifier-support-in-system-uri.md │ │ ├── internet-authentication.md │ │ ├── internet-protocol-version-6.md │ │ ├── interpreting-network-tracing.md │ │ ├── introducing-pluggable-protocols.md │ │ ├── ipv6-addressing.md │ │ ├── ipv6-auto-configuration.md │ │ ├── ipv6-routing.md │ │ ├── listening-with-sockets.md │ │ ├── location-based-cache-policies.md │ │ ├── making-asynchronous-requests.md │ │ ├── managing-connections.md │ │ ├── media │ │ │ └── fdc9e8a0-4a1c-488d-a019-bc3a1973220c.gif │ │ ├── nat-traversal-using-ipv6-and-teredo.md │ │ ├── network-isolation-for-windows-store-apps.md │ │ ├── network-programming-how-to-topics.md │ │ ├── network-programming-samples.md │ │ ├── network-tracing.md │ │ ├── networkinformation.md │ │ ├── ntlm-and-kerberos-authentication.md │ │ ├── peer-name-publication-and-resolution.md │ │ ├── peer-name-resolution-protocol.md │ │ ├── peer-names-and-pnrp-ids.md │ │ ├── peer-to-peer-collaboration.md │ │ ├── peer-to-peer-networking-scenarios.md │ │ ├── pnrp-caches.md │ │ ├── pnrp-clouds.md │ │ ├── pnrp-in-application-development.md │ │ ├── programming-pluggable-protocols.md │ │ ├── proxy-configuration.md │ │ ├── requesting-data.md │ │ ├── security-in-network-programming.md │ │ ├── socket-code-examples.md │ │ ├── socket-performance-enhancements-in-version-3-5.md │ │ ├── sockets.md │ │ ├── synchronous-client-socket-example.md │ │ ├── synchronous-server-socket-example.md │ │ ├── tcp-udp.md │ │ ├── time-based-cache-policies.md │ │ ├── tls.md │ │ ├── toc.yml │ │ ├── understanding-webrequest-problems-and-exceptions.md │ │ ├── using-a-synchronous-client-socket.md │ │ ├── using-a-synchronous-server-socket.md │ │ ├── using-an-asynchronous-client-socket.md │ │ ├── using-an-asynchronous-server-socket.md │ │ ├── using-application-protocols.md │ │ ├── using-client-sockets.md │ │ ├── using-secure-sockets-layer.md │ │ ├── using-streams-on-the-network.md │ │ ├── using-tcp-services.md │ │ ├── using-udp-services.md │ │ └── web-and-socket-permissions.md │ ├── performance │ │ ├── application-domain-resource-monitoring-arm-etw-events.md │ │ ├── caching-in-net-framework-applications.md │ │ ├── clr-etw-events.md │ │ ├── clr-etw-keywords-and-levels.md │ │ ├── clr-etw-providers.md │ │ ├── constrained-execution-regions.md │ │ ├── contention-etw-events.md │ │ ├── controlling-logging.md │ │ ├── etw-events-in-task-parallel-library-and-plinq.md │ │ ├── etw-events-in-the-common-language-runtime.md │ │ ├── etw-events.md │ │ ├── exception-thrown-v1-etw-event.md │ │ ├── garbage-collection-etw-events.md │ │ ├── how-to-perform-lazy-initialization-of-objects.md │ │ ├── index.md │ │ ├── interop-etw-events.md │ │ ├── jit-tracing-etw-events.md │ │ ├── lazy-initialization.md │ │ ├── loader-etw-events.md │ │ ├── method-etw-events.md │ │ ├── performance-tips.md │ │ ├── reliability-best-practices.md │ │ ├── reliability.md │ │ ├── runtime-information-etw-events.md │ │ ├── security-etw-events.md │ │ ├── sql-server-programming-and-host-protection-attributes.md │ │ ├── stack-etw-event.md │ │ ├── thread-pool-etw-events.md │ │ ├── toc.yml │ │ └── writing-large-responsive-apps.md │ ├── reflection-and-codedom │ │ ├── accessing-custom-attributes.md │ │ ├── collectible-assemblies.md │ │ ├── dynamic-language-runtime-overview.md │ │ ├── dynamic-source-code-generation-and-compilation.md │ │ ├── dynamically-loading-and-using-types.md │ │ ├── emitting-dynamic-methods-and-assemblies.md │ │ ├── generating-and-compiling-source-code-from-a-codedom-graph.md │ │ ├── get-type-member-information.md │ │ ├── how-to-create-a-class-using-codedom.md │ │ ├── how-to-create-an-xml-documentation-file-using-codedom.md │ │ ├── how-to-define-a-generic-method-with-reflection-emit.md │ │ ├── how-to-define-a-generic-type-with-reflection-emit.md │ │ ├── how-to-define-and-execute-dynamic-methods.md │ │ ├── how-to-examine-and-instantiate-generic-types-with-reflection.md │ │ ├── how-to-hook-up-a-delegate-using-reflection.md │ │ ├── how-to-load-assemblies-into-the-reflection-only-context.md │ │ ├── index.md │ │ ├── media │ │ │ └── dlr-archoverview.png │ │ ├── reflection-and-generic-types.md │ │ ├── reflection-for-windows-store-apps.md │ │ ├── reflection.md │ │ ├── security-considerations-for-reflection.md │ │ ├── security-issues-in-reflection-emit.md │ │ ├── specifying-fully-qualified-type-names.md │ │ ├── toc.yml │ │ ├── using-the-codedom.md │ │ ├── viewing-type-information.md │ │ └── walkthrough-emitting-code-in-partial-trust-scenarios.md │ ├── resources │ │ ├── creating-resource-files-for-desktop-apps.md │ │ ├── creating-satellite-assemblies-for-desktop-apps.md │ │ ├── index.md │ │ ├── media │ │ │ ├── creating-satellite-assemblies-for-desktop-apps │ │ │ │ └── satellite-assembly-directory.gif │ │ │ └── retrieving-resources-in-desktop-apps │ │ │ │ └── resource-application-directory.gif │ │ ├── packaging-and-deploying-resources-in-desktop-apps.md │ │ ├── retrieving-resources-in-desktop-apps.md │ │ ├── toc.yml │ │ └── working-with-resx-files-programmatically.md │ ├── security │ │ ├── building-my-first-claims-aware-aspnet-web-app.md │ │ ├── building-my-first-claims-aware-wcf-service.md │ │ ├── claims-aware-aspnet-app-forms-authentication.md │ │ ├── claims-based-authorization-using-wif.md │ │ ├── claims-based-identity-model.md │ │ ├── custom-token-handlers.md │ │ ├── downloading-the-json-web-token-handler-package.md │ │ ├── downloading-the-validating-issuer-name-registry-package.md │ │ ├── getting-started-with-wif.md │ │ ├── guidelines-for-migrating-an-application-built-using-wif-3-5-to-wif-4-5.md │ │ ├── how-to-build-claims-aware-aspnet-app-using-windows-authentication.md │ │ ├── how-to-build-claims-aware-aspnet-mvc-web-app-using-wif.md │ │ ├── how-to-build-claims-aware-aspnet-web-forms-app-using-wif.md │ │ ├── how-to-debug-claims-aware-applications-and-services-using-wif-tracing.md │ │ ├── how-to-display-signed-in-status-using-wif.md │ │ ├── how-to-enable-token-replay-detection.md │ │ ├── how-to-enable-wif-for-a-wcf-web-service-application.md │ │ ├── how-to-enable-wif-tracing.md │ │ ├── how-to-transform-incoming-claims.md │ │ ├── identity-and-access-tool-for-vs.md │ │ ├── index.md │ │ ├── json-web-token-handler.md │ │ ├── media │ │ │ ├── building-my-first-claims-aware-aspnet-web-app │ │ │ │ └── windows-identity-foundation-basic-web-application.gif │ │ │ ├── building-my-first-claims-aware-wcf-service │ │ │ │ └── windows-identify-foundation-basic-claims-aware-windows-communication-foundation-service.gif │ │ │ ├── conc-relying-partner-processc.png │ │ │ ├── signinusingconrols-sam.gif │ │ │ ├── signinusingpassiveredirect-tokenprocessing.gif │ │ │ ├── wif-claims-programming-model │ │ │ │ └── wif-claims-programming-model.png │ │ │ └── wsfederation-authentication-module-overview │ │ │ │ ├── federated-authentication.gif │ │ │ │ └── sign-in-using-passive-redirect.gif │ │ ├── namespace-mapping-between-wif-3-5-and-wif-4-5.md │ │ ├── secure-coding-guidelines-for-unmanaged-code.md │ │ ├── security-changes.md │ │ ├── toc.yml │ │ ├── validating-issuer-name-registry-api-reference.md │ │ ├── validating-issuer-name-registry.md │ │ ├── whats-new-in-wif.md │ │ ├── wif-and-web-farms.md │ │ ├── wif-api-reference.md │ │ ├── wif-claims-programming-model.md │ │ ├── wif-code-sample-index.md │ │ ├── wif-configuration-reference.md │ │ ├── wif-configuration-schema-conventions.md │ │ ├── wif-extensions.md │ │ ├── wif-features.md │ │ ├── wif-guidelines.md │ │ ├── wif-how-tos-index.md │ │ ├── wif-overview.md │ │ ├── wif-session-management.md │ │ ├── wsfederation-authentication-module-overview.md │ │ └── wstrustchannelfactory-and-wstrustchannel.md │ ├── toc.yml │ ├── tools │ │ ├── al-exe-assembly-linker.md │ │ ├── aximp-exe-windows-forms-activex-control-importer.md │ │ ├── caspol-exe-code-access-security-policy-tool.md │ │ ├── cert2spc-exe-software-publisher-certificate-test-tool.md │ │ ├── certmgr-exe-certificate-manager-tool.md │ │ ├── clrver-exe-clr-version-tool.md │ │ ├── corflags-exe-corflags-conversion-tool.md │ │ ├── developer-command-prompt-for-vs.md │ │ ├── fuslogvw-exe-assembly-binding-log-viewer.md │ │ ├── gacutil-exe-gac-tool.md │ │ ├── ilasm-exe-il-assembler.md │ │ ├── ildasm-exe-il-disassembler.md │ │ ├── index.md │ │ ├── installutil-exe-installer-tool.md │ │ ├── lc-exe-license-compiler.md │ │ ├── mage-exe-manifest-generation-and-editing-tool.md │ │ ├── mageui-exe-manifest-generation-and-editing-tool-graphical-client.md │ │ ├── mdbg-exe.md │ │ ├── media │ │ │ ├── command-prompt-vs-menu.png │ │ │ └── developer-command-prompt-for-vs │ │ │ │ └── windows-logo-key-graphic.png │ │ ├── mgmtclassgen-exe.md │ │ ├── mpgo-exe-managed-profile-guided-optimization-tool.md │ │ ├── ngen-exe-native-image-generator.md │ │ ├── peverify-exe-peverify-tool.md │ │ ├── regasm-exe-assembly-registration-tool.md │ │ ├── regsvcs-exe-net-services-installation-tool.md │ │ ├── resgen-exe-resource-file-generator.md │ │ ├── secannotate-exe-net-security-annotator-tool.md │ │ ├── signtool-exe.md │ │ ├── sn-exe-strong-name-tool.md │ │ ├── sos-dll-sos-debugging-extension.md │ │ ├── sqlmetal-exe-code-generation-tool.md │ │ ├── storeadm-exe-isolated-storage-tool.md │ │ ├── tlbexp-exe-type-library-exporter.md │ │ ├── tlbimp-exe-type-library-importer.md │ │ ├── toc.yml │ │ ├── winmdexp-exe-error-messages.md │ │ ├── winmdexp-exe-windows-runtime-metadata-export-tool.md │ │ └── winres-exe-windows-forms-resource-editor.md │ ├── ui-automation │ │ ├── access-embedded-objects-using-ui-automation.md │ │ ├── accessibility-best-practices.md │ │ ├── add-content-to-a-text-box-using-ui-automation.md │ │ ├── caching-in-ui-automation-clients.md │ │ ├── client-side-ui-automation-provider-implementation.md │ │ ├── control-pattern-mapping-for-ui-automation-clients.md │ │ ├── create-a-client-side-ui-automation-provider.md │ │ ├── enable-navigation-in-a-ui-automation-fragment-provider.md │ │ ├── expose-a-server-side-ui-automation-provider.md │ │ ├── expose-the-content-of-a-table-using-ui-automation.md │ │ ├── find-a-ui-automation-element-based-on-a-property-condition.md │ │ ├── find-a-ui-automation-element-for-a-list-item.md │ │ ├── find-and-highlight-text-using-ui-automation.md │ │ ├── get-supported-ui-automation-control-patterns.md │ │ ├── get-the-toggle-state-of-a-check-box-using-ui-automation.md │ │ ├── get-ui-automation-element-properties.md │ │ ├── implement-ui-automation-providers-in-a-client-application.md │ │ ├── implementing-the-ui-automation-dock-control-pattern.md │ │ ├── implementing-the-ui-automation-expandcollapse-control-pattern.md │ │ ├── implementing-the-ui-automation-grid-control-pattern.md │ │ ├── implementing-the-ui-automation-griditem-control-pattern.md │ │ ├── implementing-the-ui-automation-invoke-control-pattern.md │ │ ├── implementing-the-ui-automation-multipleview-control-pattern.md │ │ ├── implementing-the-ui-automation-rangevalue-control-pattern.md │ │ ├── implementing-the-ui-automation-scroll-control-pattern.md │ │ ├── implementing-the-ui-automation-scrollitem-control-pattern.md │ │ ├── implementing-the-ui-automation-selection-control-pattern.md │ │ ├── implementing-the-ui-automation-selectionitem-control-pattern.md │ │ ├── implementing-the-ui-automation-table-control-pattern.md │ │ ├── implementing-the-ui-automation-tableitem-control-pattern.md │ │ ├── implementing-the-ui-automation-toggle-control-pattern.md │ │ ├── implementing-the-ui-automation-transform-control-pattern.md │ │ ├── implementing-the-ui-automation-value-control-pattern.md │ │ ├── implementing-the-ui-automation-window-control-pattern.md │ │ ├── index.md │ │ ├── invoke-a-control-using-ui-automation.md │ │ ├── media │ │ │ ├── uia-dockpattern-dockingexample.PNG │ │ │ ├── uia-gridpattern-ragged-array.PNG │ │ │ ├── uia-rangevaluepattern-progress-bar.PNG │ │ │ ├── uia-scrollpattern-without-scrollbars.PNG │ │ │ ├── uia-tablepattern-complex-column-headers.PNG │ │ │ ├── uia-tablepattern-roworcolumnmajorproperty.PNG │ │ │ ├── uia-textpattern-embedded-objects-overview-example1.png │ │ │ ├── uia-textpattern-embedded-objects-overview-example2.PNG │ │ │ ├── uia-textpattern-embedded-objects-overview-imageexample.PNG │ │ │ ├── uia-textpattern-embedded-objects-overview-imageexample2.PNG │ │ │ ├── uia-textpattern-embedded-objects-overview-imageexample3.PNG │ │ │ ├── uia-textpattern-embeddedobjects.PNG │ │ │ ├── uia-textpattern-embeddedobjecttextranges.png │ │ │ ├── uia-textpattern-endpoints.PNG │ │ │ ├── uia-textpattern-moveandexpand-examples.png │ │ │ ├── uia-valuepattern-colorpicker.png │ │ │ ├── uia-valuepattern-editable-listitem.PNG │ │ │ ├── uiauto-data-grid-detailed.GIF │ │ │ ├── uiauto-pane.GIF │ │ │ └── uiauto-splitbutton-detailed.gif │ │ ├── move-a-ui-automation-element.md │ │ ├── navigate-among-ui-automation-elements-with-treewalker.md │ │ ├── obtain-mixed-text-attribute-details-using-ui-automation.md │ │ ├── obtain-text-attributes-using-ui-automation.md │ │ ├── obtaining-ui-automation-elements.md │ │ ├── raise-events-from-a-ui-automation-provider.md │ │ ├── register-a-client-side-provider-assembly.md │ │ ├── return-properties-from-a-ui-automation-provider.md │ │ ├── server-side-ui-automation-provider-implementation.md │ │ ├── subscribe-to-ui-automation-events.md │ │ ├── support-control-patterns-in-a-ui-automation-provider.md │ │ ├── textpattern-and-embedded-objects-overview.md │ │ ├── toc.yml │ │ ├── traverse-text-using-ui-automation.md │ │ ├── ui-automation-and-microsoft-active-accessibility.md │ │ ├── ui-automation-and-screen-scaling.md │ │ ├── ui-automation-clients-for-managed-code-how-to-topics.md │ │ ├── ui-automation-clients-for-managed-code.md │ │ ├── ui-automation-control-patterns-for-clients.md │ │ ├── ui-automation-control-patterns-how-to-topics.md │ │ ├── ui-automation-control-patterns-overview.md │ │ ├── ui-automation-control-patterns.md │ │ ├── ui-automation-control-types-overview.md │ │ ├── ui-automation-control-types.md │ │ ├── ui-automation-events-for-clients.md │ │ ├── ui-automation-events-overview.md │ │ ├── ui-automation-fundamentals.md │ │ ├── ui-automation-overview.md │ │ ├── ui-automation-properties-for-clients.md │ │ ├── ui-automation-properties-overview.md │ │ ├── ui-automation-providers-for-managed-code-how-to-topics.md │ │ ├── ui-automation-providers-for-managed-code.md │ │ ├── ui-automation-providers-overview.md │ │ ├── ui-automation-security-overview.md │ │ ├── ui-automation-specification-and-community-promise.md │ │ ├── ui-automation-support-for-standard-controls.md │ │ ├── ui-automation-support-for-the-button-control-type.md │ │ ├── ui-automation-support-for-the-calendar-control-type.md │ │ ├── ui-automation-support-for-the-checkbox-control-type.md │ │ ├── ui-automation-support-for-the-combobox-control-type.md │ │ ├── ui-automation-support-for-the-datagrid-control-type.md │ │ ├── ui-automation-support-for-the-dataitem-control-type.md │ │ ├── ui-automation-support-for-the-document-control-type.md │ │ ├── ui-automation-support-for-the-edit-control-type.md │ │ ├── ui-automation-support-for-the-group-control-type.md │ │ ├── ui-automation-support-for-the-header-control-type.md │ │ ├── ui-automation-support-for-the-headeritem-control-type.md │ │ ├── ui-automation-support-for-the-hyperlink-control-type.md │ │ ├── ui-automation-support-for-the-image-control-type.md │ │ ├── ui-automation-support-for-the-list-control-type.md │ │ ├── ui-automation-support-for-the-listitem-control-type.md │ │ ├── ui-automation-support-for-the-menu-control-type.md │ │ ├── ui-automation-support-for-the-menubar-control-type.md │ │ ├── ui-automation-support-for-the-menuitem-control-type.md │ │ ├── ui-automation-support-for-the-pane-control-type.md │ │ ├── ui-automation-support-for-the-progressbar-control-type.md │ │ ├── ui-automation-support-for-the-radiobutton-control-type.md │ │ ├── ui-automation-support-for-the-scrollbar-control-type.md │ │ ├── ui-automation-support-for-the-separator-control-type.md │ │ ├── ui-automation-support-for-the-slider-control-type.md │ │ ├── ui-automation-support-for-the-spinner-control-type.md │ │ ├── ui-automation-support-for-the-splitbutton-control-type.md │ │ ├── ui-automation-support-for-the-statusbar-control-type.md │ │ ├── ui-automation-support-for-the-tab-control-type.md │ │ ├── ui-automation-support-for-the-tabitem-control-type.md │ │ ├── ui-automation-support-for-the-table-control-type.md │ │ ├── ui-automation-support-for-the-text-control-type.md │ │ ├── ui-automation-support-for-the-thumb-control-type.md │ │ ├── ui-automation-support-for-the-titlebar-control-type.md │ │ ├── ui-automation-support-for-the-toolbar-control-type.md │ │ ├── ui-automation-support-for-the-tooltip-control-type.md │ │ ├── ui-automation-support-for-the-tree-control-type.md │ │ ├── ui-automation-support-for-the-treeitem-control-type.md │ │ ├── ui-automation-support-for-the-window-control-type.md │ │ ├── ui-automation-text-pattern-how-to-topics.md │ │ ├── ui-automation-text-pattern.md │ │ ├── ui-automation-textpattern-overview.md │ │ ├── ui-automation-threading-issues.md │ │ ├── ui-automation-tree-overview.md │ │ ├── use-caching-in-ui-automation.md │ │ ├── use-the-automationid-property.md │ │ └── using-ui-automation-for-automated-testing.md │ ├── unmanaged-api │ │ ├── alink │ │ │ ├── addfile-method.md │ │ │ ├── addfile2-method.md │ │ │ ├── addimport-method.md │ │ │ ├── assemblyattributesgohere.md │ │ │ ├── assemblyattributesgoherem.md │ │ │ ├── assemblyattributesgoheres.md │ │ │ ├── assemblyattributesgoheresm.md │ │ │ ├── assemblyoptions-enumeration.md │ │ │ ├── closeassembly-method.md │ │ │ ├── closeenum-method.md │ │ │ ├── createalink-function.md │ │ │ ├── embedresource-method.md │ │ │ ├── emitassembly-method.md │ │ │ ├── emitassemblycustomattribute-method.md │ │ │ ├── emitinternalexportedtypes-method.md │ │ │ ├── emitmanifest-method.md │ │ │ ├── endmerge-method.md │ │ │ ├── enumcustomattributes-method.md │ │ │ ├── enumimporttypes-method.md │ │ │ ├── exportnestedtype-method.md │ │ │ ├── exportnestedtypeforwarder-method.md │ │ │ ├── exporttype-method.md │ │ │ ├── exporttypeforwarder-method.md │ │ │ ├── freewin32resblob-method.md │ │ │ ├── getalinkmessagedll-function.md │ │ │ ├── getassemblyrefhash-method.md │ │ │ ├── getfiledef-method.md │ │ │ ├── getpublickeytoken-method.md │ │ │ ├── getresolutionscope-method.md │ │ │ ├── getscope-method.md │ │ │ ├── getscope2-method.md │ │ │ ├── getwin32resblob-method.md │ │ │ ├── ialink-interface.md │ │ │ ├── ialink2-interface.md │ │ │ ├── ialink3-interface.md │ │ │ ├── importfile-method.md │ │ │ ├── importfile2-method.md │ │ │ ├── importfileex-method.md │ │ │ ├── importfileex2-method.md │ │ │ ├── importtypes-method.md │ │ │ ├── importtypes2-method.md │ │ │ ├── index.md │ │ │ ├── init-method.md │ │ │ ├── linkresource-method.md │ │ │ ├── precloseassembly-method.md │ │ │ ├── setassemblyfile-method.md │ │ │ ├── setassemblyfile2-method.md │ │ │ ├── setassemblyprops-method.md │ │ │ ├── setmanifestfile-method.md │ │ │ ├── setnonassemblyflags-method.md │ │ │ ├── setpekind-method.md │ │ │ └── toc.yml │ │ ├── authenticode │ │ │ ├── axl-authenticode-signer-info-structure.md │ │ │ ├── axl-authenticode-timestamper-info-structure.md │ │ │ ├── axlgetissuerpublickeyhash-function.md │ │ │ ├── axlpublickeyblobtopublickeytoken-function.md │ │ │ ├── axlrsakeyvaluetopublickeytoken-function.md │ │ │ ├── certfreeauthenticodesignerinfo-function.md │ │ │ ├── certfreeauthenticodetimestamperinfo-function.md │ │ │ ├── certtimestampauthenticodelicense-function.md │ │ │ ├── certverifyauthenticodelicense-function.md │ │ │ ├── index.md │ │ │ └── toc.yml │ │ ├── common-data-types-unmanaged-api-reference.md │ │ ├── constants-unmanaged-api-reference.md │ │ ├── debugging │ │ │ ├── closeclrenumeration-function.md │ │ │ ├── clr-debugging-process-flags-enumeration.md │ │ │ ├── clr-debugging-version-structure.md │ │ │ ├── clrdata-address-range-structure.md │ │ │ ├── clrdata-il-address-map-structure.md │ │ │ ├── clrdatacreateinstance-function.md │ │ │ ├── clrdataenummemoryflags-enumeration.md │ │ │ ├── clrdatasourcetype-enumeration.md │ │ │ ├── codechunkinfo-structure.md │ │ │ ├── cor-active-function-structure.md │ │ │ ├── cor-array-layout-structure.md │ │ │ ├── cor-debug-il-to-native-map-structure.md │ │ │ ├── cor-debug-step-range-structure.md │ │ │ ├── cor-field-structure.md │ │ │ ├── cor-gc-reference-structure.md │ │ │ ├── cor-heapinfo-structure.md │ │ │ ├── cor-heapobject-structure.md │ │ │ ├── cor-il-map-structure.md │ │ │ ├── cor-pub-enumprocess-enumeration.md │ │ │ ├── cor-segment-structure.md │ │ │ ├── cor-type-layout-structure.md │ │ │ ├── cor-typeid-structure.md │ │ │ ├── cor-version-structure.md │ │ │ ├── cordebugblockingobject-structure.md │ │ │ ├── cordebugblockingreason-enumeration.md │ │ │ ├── cordebugchainreason-enumeration.md │ │ │ ├── cordebugcodeinvokekind-enumeration.md │ │ │ ├── cordebugcodeinvokepurpose-enumeration.md │ │ │ ├── cordebugcreateprocessflags-enumeration.md │ │ │ ├── cordebugdebugeventkind-enumeration.md │ │ │ ├── cordebugdecodeeventflagswindows-enumeration.md │ │ │ ├── cordebugehclause-structure.md │ │ │ ├── cordebugexceptioncallbacktype-enumeration.md │ │ │ ├── cordebugexceptionflags-enumeration.md │ │ │ ├── cordebugexceptionobjectstackframe-structure.md │ │ │ ├── cordebugexceptionunwindcallbacktype-enumeration.md │ │ │ ├── cordebuggctype-enumeration.md │ │ │ ├── cordebuggenerationtypes-enumeration.md │ │ │ ├── cordebugguidtotypemapping-structure.md │ │ │ ├── cordebughandletype-enumeration.md │ │ │ ├── cordebugiltonativemappingtypes-enumeration.md │ │ │ ├── cordebugintercept-enumeration.md │ │ │ ├── cordebuginterfaceversion-enumeration.md │ │ │ ├── cordebuginternalframetype-enumeration.md │ │ │ ├── cordebugjitcompilerflags-enumeration.md │ │ │ ├── cordebugjitcompilerflagsdeprecated-enumeration.md │ │ │ ├── cordebugmappingresult-enumeration.md │ │ │ ├── cordebugmdaflags-enumeration.md │ │ │ ├── cordebugngenpolicy-enumeration.md │ │ │ ├── cordebugplatform-enumeration.md │ │ │ ├── cordebugrecordformat-enumeration.md │ │ │ ├── cordebugregister-enumeration.md │ │ │ ├── cordebugsetcontextflag-enumeration.md │ │ │ ├── cordebugstatechange-enumeration.md │ │ │ ├── cordebugstepreason-enumeration.md │ │ │ ├── cordebugthreadstate-enumeration.md │ │ │ ├── cordebugunmappedstop-enumeration.md │ │ │ ├── cordebuguserstate-enumeration.md │ │ │ ├── coreclrdebugprocinfo-structure.md │ │ │ ├── coreclrdebugruntimeinfo-structure.md │ │ │ ├── corgcreferencetype-enumeration.md │ │ │ ├── corpubpublish-coclass.md │ │ │ ├── createcordbobject-function.md │ │ │ ├── createcoreclrdebugtarget-function.md │ │ │ ├── createdebugginginterfacefromversion-function-for-silverlight.md │ │ │ ├── createversionstringfrommodule-function.md │ │ │ ├── dacpgetmoduleaddress-request-method.md │ │ │ ├── dacpgetmoduleaddress-structure.md │ │ │ ├── dacpmethoddescdata-structure.md │ │ │ ├── dacpmoduledata-structure.md │ │ │ ├── dacprejitdata-structure.md │ │ │ ├── debugging-coclasses.md │ │ │ ├── debugging-enumerations.md │ │ │ ├── debugging-global-static-functions.md │ │ │ ├── debugging-interfaces.md │ │ │ ├── debugging-structures.md │ │ │ ├── efn-getmanagedexcepstack-function.md │ │ │ ├── efn-getmanagedobjectfieldinfo-function.md │ │ │ ├── efn-getmanagedobjectname-function.md │ │ │ ├── efn-stacktrace-function.md │ │ │ ├── enumerateclrs-function.md │ │ │ ├── getstartupnotificationevent-function.md │ │ │ ├── iclrdataenummemoryregions-enummemoryregions-method.md │ │ │ ├── iclrdataenummemoryregions-interface.md │ │ │ ├── iclrdataenummemoryregionscallback-enummemoryregion-method.md │ │ │ ├── iclrdataenummemoryregionscallback-interface.md │ │ │ ├── iclrdatatarget-getcurrentthreadid-method.md │ │ │ ├── iclrdatatarget-getimagebase-method.md │ │ │ ├── iclrdatatarget-getmachinetype-method.md │ │ │ ├── iclrdatatarget-getpointersize-method.md │ │ │ ├── iclrdatatarget-getthreadcontext-method.md │ │ │ ├── iclrdatatarget-gettlsvalue-method.md │ │ │ ├── iclrdatatarget-interface.md │ │ │ ├── iclrdatatarget-readvirtual-method.md │ │ │ ├── iclrdatatarget-request-method.md │ │ │ ├── iclrdatatarget-setthreadcontext-method.md │ │ │ ├── iclrdatatarget-settlsvalue-method.md │ │ │ ├── iclrdatatarget-writevirtual-method.md │ │ │ ├── iclrdatatarget2-allocvirtual-method.md │ │ │ ├── iclrdatatarget2-freevirtual-method.md │ │ │ ├── iclrdatatarget2-interface.md │ │ │ ├── iclrdatatarget3-getexceptioncontextrecord-method.md │ │ │ ├── iclrdatatarget3-getexceptionrecord-method.md │ │ │ ├── iclrdatatarget3-getexceptionthreadid-method.md │ │ │ ├── iclrdatatarget3-interface.md │ │ │ ├── iclrdebugging-canunloadnow-method.md │ │ │ ├── iclrdebugging-interface.md │ │ │ ├── iclrdebugging-openvirtualprocess-method.md │ │ │ ├── iclrdebugginglibraryprovider-interface.md │ │ │ ├── iclrdebugginglibraryprovider-providelibrary-method.md │ │ │ ├── iclrmetadatalocator-getmetadata-method.md │ │ │ ├── iclrmetadatalocator-interface.md │ │ │ ├── icordebug-canlaunchorattach-method.md │ │ │ ├── icordebug-createprocess-method.md │ │ │ ├── icordebug-debugactiveprocess-method.md │ │ │ ├── icordebug-enumerateprocesses-method.md │ │ │ ├── icordebug-getprocess-method.md │ │ │ ├── icordebug-initialize-method.md │ │ │ ├── icordebug-interface.md │ │ │ ├── icordebug-setmanagedhandler-method.md │ │ │ ├── icordebug-setunmanagedhandler-method.md │ │ │ ├── icordebug-terminate-method.md │ │ │ ├── icordebugappdomain-attach-method.md │ │ │ ├── icordebugappdomain-enumerateassemblies-method.md │ │ │ ├── icordebugappdomain-enumeratebreakpoints-method.md │ │ │ ├── icordebugappdomain-enumeratesteppers-method.md │ │ │ ├── icordebugappdomain-getid-method.md │ │ │ ├── icordebugappdomain-getmodulefrommetadatainterface-method.md │ │ │ ├── icordebugappdomain-getname-method.md │ │ │ ├── icordebugappdomain-getobject-method.md │ │ │ ├── icordebugappdomain-getprocess-method.md │ │ │ ├── icordebugappdomain-interface.md │ │ │ ├── icordebugappdomain-isattached-method.md │ │ │ ├── icordebugappdomain2-getarrayorpointertype-method.md │ │ │ ├── icordebugappdomain2-getfunctionpointertype-method.md │ │ │ ├── icordebugappdomain2-interface.md │ │ │ ├── icordebugappdomain3-getcachedwinrttypes-method.md │ │ │ ├── icordebugappdomain3-getcachedwinrttypesforiids-method.md │ │ │ ├── icordebugappdomain3-interface.md │ │ │ ├── icordebugappdomain4-getobjectforccw-method.md │ │ │ ├── icordebugappdomain4-interface.md │ │ │ ├── icordebugappdomainenum-interface.md │ │ │ ├── icordebugappdomainenum-next-method.md │ │ │ ├── icordebugarrayvalue-getbaseindicies-method.md │ │ │ ├── icordebugarrayvalue-getcount-method.md │ │ │ ├── icordebugarrayvalue-getdimensions-method.md │ │ │ ├── icordebugarrayvalue-getelement-method.md │ │ │ ├── icordebugarrayvalue-getelementatposition-method.md │ │ │ ├── icordebugarrayvalue-getelementtype-method.md │ │ │ ├── icordebugarrayvalue-getrank-method.md │ │ │ ├── icordebugarrayvalue-hasbaseindicies-method.md │ │ │ ├── icordebugarrayvalue-interface.md │ │ │ ├── icordebugassembly-enumeratemodules-method.md │ │ │ ├── icordebugassembly-getappdomain-method.md │ │ │ ├── icordebugassembly-getcodebase-method.md │ │ │ ├── icordebugassembly-getname-method.md │ │ │ ├── icordebugassembly-getprocess-method.md │ │ │ ├── icordebugassembly-interface.md │ │ │ ├── icordebugassembly2-interface.md │ │ │ ├── icordebugassembly2-isfullytrusted-method.md │ │ │ ├── icordebugassembly3-enumeratecontainedassemblies-method.md │ │ │ ├── icordebugassembly3-getcontainerassembly-method.md │ │ │ ├── icordebugassembly3-interface.md │ │ │ ├── icordebugassemblyenum-interface.md │ │ │ ├── icordebugassemblyenum-next-method.md │ │ │ ├── icordebugblockingobjectenum-interface.md │ │ │ ├── icordebugblockingobjectenum-next-method.md │ │ │ ├── icordebugboxvalue-getobject-method.md │ │ │ ├── icordebugboxvalue-interface.md │ │ │ ├── icordebugbreakpoint-activate-method.md │ │ │ ├── icordebugbreakpoint-interface.md │ │ │ ├── icordebugbreakpoint-isactive-method.md │ │ │ ├── icordebugbreakpointenum-interface.md │ │ │ ├── icordebugbreakpointenum-next-method.md │ │ │ ├── icordebugchain-enumerateframes-method.md │ │ │ ├── icordebugchain-getactiveframe-method.md │ │ │ ├── icordebugchain-getcallee-method.md │ │ │ ├── icordebugchain-getcaller-method.md │ │ │ ├── icordebugchain-getcontext-method.md │ │ │ ├── icordebugchain-getnext-method.md │ │ │ ├── icordebugchain-getprevious-method.md │ │ │ ├── icordebugchain-getreason-method.md │ │ │ ├── icordebugchain-getregisterset-method.md │ │ │ ├── icordebugchain-getstackrange-method.md │ │ │ ├── icordebugchain-getthread-method.md │ │ │ ├── icordebugchain-interface.md │ │ │ ├── icordebugchain-ismanaged-method.md │ │ │ ├── icordebugchainenum-interface.md │ │ │ ├── icordebugchainenum-next-method.md │ │ │ ├── icordebugclass-getmodule-method.md │ │ │ ├── icordebugclass-getstaticfieldvalue-method.md │ │ │ ├── icordebugclass-gettoken-method.md │ │ │ ├── icordebugclass-interface.md │ │ │ ├── icordebugclass2-getparameterizedtype-method.md │ │ │ ├── icordebugclass2-interface.md │ │ │ ├── icordebugclass2-setjmcstatus-method.md │ │ │ ├── icordebugcode-createbreakpoint-method.md │ │ │ ├── icordebugcode-getaddress-method.md │ │ │ ├── icordebugcode-getcode-method.md │ │ │ ├── icordebugcode-getencremapsequencepoints-method.md │ │ │ ├── icordebugcode-getfunction-method.md │ │ │ ├── icordebugcode-getiltonativemapping-method.md │ │ │ ├── icordebugcode-getsize-method.md │ │ │ ├── icordebugcode-getversionnumber-method.md │ │ │ ├── icordebugcode-interface1.md │ │ │ ├── icordebugcode-isil-method.md │ │ │ ├── icordebugcode2-getcodechunks-method.md │ │ │ ├── icordebugcode2-getcompilerflags-method.md │ │ │ ├── icordebugcode2-interface.md │ │ │ ├── icordebugcode3-getreturnvalueliveoffset-method.md │ │ │ ├── icordebugcode3-interface.md │ │ │ ├── icordebugcode4-enumeratevariablehomes-method.md │ │ │ ├── icordebugcode4-interface.md │ │ │ ├── icordebugcodeenum-interface.md │ │ │ ├── icordebugcodeenum-next-method.md │ │ │ ├── icordebugcomobjectvalue-getcachedinterfacepointers-method.md │ │ │ ├── icordebugcomobjectvalue-getcachedinterfacetypes-method.md │ │ │ ├── icordebugcomobjectvalue-interface.md │ │ │ ├── icordebugcontext-interface.md │ │ │ ├── icordebugcontroller-cancommitchanges-method.md │ │ │ ├── icordebugcontroller-commitchanges-method.md │ │ │ ├── icordebugcontroller-continue-method.md │ │ │ ├── icordebugcontroller-detach-method.md │ │ │ ├── icordebugcontroller-enumeratethreads-method.md │ │ │ ├── icordebugcontroller-hasqueuedcallbacks-method.md │ │ │ ├── icordebugcontroller-interface.md │ │ │ ├── icordebugcontroller-isrunning-method.md │ │ │ ├── icordebugcontroller-setallthreadsdebugstate-method.md │ │ │ ├── icordebugcontroller-stop-method.md │ │ │ ├── icordebugcontroller-terminate-method.md │ │ │ ├── icordebugdatatarget-getplatform-method.md │ │ │ ├── icordebugdatatarget-getthreadcontext-method.md │ │ │ ├── icordebugdatatarget-interface.md │ │ │ ├── icordebugdatatarget-readvirtual-method.md │ │ │ ├── icordebugdatatarget2-createvirtualunwinder-method.md │ │ │ ├── icordebugdatatarget2-enumeratethreadids-method.md │ │ │ ├── icordebugdatatarget2-getimagefrompointer-method.md │ │ │ ├── icordebugdatatarget2-getimagelocation-method.md │ │ │ ├── icordebugdatatarget2-getsymbolproviderforimage-method.md │ │ │ ├── icordebugdatatarget2-interface.md │ │ │ ├── icordebugdatatarget3-getloadedmodules-method.md │ │ │ ├── icordebugdatatarget3-interface.md │ │ │ ├── icordebugdebugevent-geteventkind-method.md │ │ │ ├── icordebugdebugevent-getthread-method.md │ │ │ ├── icordebugdebugevent-interface.md │ │ │ ├── icordebugeditandcontinueerrorinfo-geterrorcode-method.md │ │ │ ├── icordebugeditandcontinueerrorinfo-getmodule-method.md │ │ │ ├── icordebugeditandcontinueerrorinfo-getstring-method.md │ │ │ ├── icordebugeditandcontinueerrorinfo-gettoken-method.md │ │ │ ├── icordebugeditandcontinueerrorinfo-interface.md │ │ │ ├── icordebugeditandcontinuesnapshot-copymetadata-method.md │ │ │ ├── icordebugeditandcontinuesnapshot-getmvid-method.md │ │ │ ├── icordebugeditandcontinuesnapshot-getrodatarva-method.md │ │ │ ├── icordebugeditandcontinuesnapshot-getrwdatarva-method.md │ │ │ ├── icordebugeditandcontinuesnapshot-interface.md │ │ │ ├── icordebugeditandcontinuesnapshot-setilmap-method.md │ │ │ ├── icordebugeditandcontinuesnapshot-setpebytes-method.md │ │ │ ├── icordebugeditandcontinuesnapshot-setpesymbolbytes-method.md │ │ │ ├── icordebugenum-clone-method.md │ │ │ ├── icordebugenum-getcount-method.md │ │ │ ├── icordebugenum-interface1.md │ │ │ ├── icordebugenum-reset-method.md │ │ │ ├── icordebugenum-skip-method.md │ │ │ ├── icordebugerrorinfoenum-interface.md │ │ │ ├── icordebugerrorinfoenum-next-method.md │ │ │ ├── icordebugeval-abort-method.md │ │ │ ├── icordebugeval-callfunction-method.md │ │ │ ├── icordebugeval-createvalue-method.md │ │ │ ├── icordebugeval-getresult-method.md │ │ │ ├── icordebugeval-getthread-method.md │ │ │ ├── icordebugeval-interface.md │ │ │ ├── icordebugeval-isactive-method.md │ │ │ ├── icordebugeval-newarray-method.md │ │ │ ├── icordebugeval-newobject-method.md │ │ │ ├── icordebugeval-newobjectnoconstructor-method.md │ │ │ ├── icordebugeval-newstring-method.md │ │ │ ├── icordebugeval2-callparameterizedfunction-method.md │ │ │ ├── icordebugeval2-createvaluefortype-method.md │ │ │ ├── icordebugeval2-interface.md │ │ │ ├── icordebugeval2-newparameterizedarray-method.md │ │ │ ├── icordebugeval2-newparameterizedobject-method.md │ │ │ ├── icordebugeval2-newparameterizedobjectnoconstructor-method.md │ │ │ ├── icordebugeval2-newstringwithlength-method.md │ │ │ ├── icordebugeval2-rudeabort-method.md │ │ │ ├── icordebugexceptiondebugevent-getflags-method.md │ │ │ ├── icordebugexceptiondebugevent-getnativeip-method.md │ │ │ ├── icordebugexceptiondebugevent-getstackpointer-method.md │ │ │ ├── icordebugexceptiondebugevent-interface.md │ │ │ ├── icordebugexceptionobjectcallstackenum-interface.md │ │ │ ├── icordebugexceptionobjectcallstackenum-next-method.md │ │ │ ├── icordebugexceptionobjectvalue-enumerateexceptioncallstack-method.md │ │ │ ├── icordebugexceptionobjectvalue-interface.md │ │ │ ├── icordebugframe-createstepper-method.md │ │ │ ├── icordebugframe-getcallee-method.md │ │ │ ├── icordebugframe-getcaller-method.md │ │ │ ├── icordebugframe-getchain-method.md │ │ │ ├── icordebugframe-getcode-method.md │ │ │ ├── icordebugframe-getfunction-method.md │ │ │ ├── icordebugframe-getfunctiontoken-method.md │ │ │ ├── icordebugframe-getstackrange-method.md │ │ │ ├── icordebugframe-interface.md │ │ │ ├── icordebugframeenum-interface.md │ │ │ ├── icordebugframeenum-next-method.md │ │ │ ├── icordebugfunction-createbreakpoint-method.md │ │ │ ├── icordebugfunction-getclass-method.md │ │ │ ├── icordebugfunction-getcurrentversionnumber-method.md │ │ │ ├── icordebugfunction-getilcode-method.md │ │ │ ├── icordebugfunction-getlocalvarsigtoken-method.md │ │ │ ├── icordebugfunction-getmodule-method.md │ │ │ ├── icordebugfunction-getnativecode-method.md │ │ │ ├── icordebugfunction-gettoken-method.md │ │ │ ├── icordebugfunction-interface1.md │ │ │ ├── icordebugfunction2-enumeratenativecode-method.md │ │ │ ├── icordebugfunction2-getjmcstatus-method.md │ │ │ ├── icordebugfunction2-getversionnumber-method.md │ │ │ ├── icordebugfunction2-interface.md │ │ │ ├── icordebugfunction2-setjmcstatus-method.md │ │ │ ├── icordebugfunction3-getactiverejitrequestilcode-method.md │ │ │ ├── icordebugfunction3-interface.md │ │ │ ├── icordebugfunctionbreakpoint-getfunction-method.md │ │ │ ├── icordebugfunctionbreakpoint-getoffset-method.md │ │ │ ├── icordebugfunctionbreakpoint-interface.md │ │ │ ├── icordebuggcreferenceenum-interface.md │ │ │ ├── icordebuggcreferenceenum-next-method.md │ │ │ ├── icordebuggenericvalue-getvalue-method.md │ │ │ ├── icordebuggenericvalue-interface.md │ │ │ ├── icordebuggenericvalue-setvalue-method.md │ │ │ ├── icordebugguidtotypeenum-interface.md │ │ │ ├── icordebugguidtotypeenum-next-method.md │ │ │ ├── icordebughandlevalue-dispose-method.md │ │ │ ├── icordebughandlevalue-gethandletype-method.md │ │ │ ├── icordebughandlevalue-interface.md │ │ │ ├── icordebugheapenum-interface.md │ │ │ ├── icordebugheapenum-next-method.md │ │ │ ├── icordebugheapsegmentenum-interface.md │ │ │ ├── icordebugheapsegmentenum-next-method.md │ │ │ ├── icordebugheapvalue-createrelocbreakpoint-method.md │ │ │ ├── icordebugheapvalue-interface.md │ │ │ ├── icordebugheapvalue-isvalid-method.md │ │ │ ├── icordebugheapvalue2-createhandle-method.md │ │ │ ├── icordebugheapvalue2-interface1.md │ │ │ ├── icordebugheapvalue3-getmonitoreventwaitlist-method.md │ │ │ ├── icordebugheapvalue3-getthreadowningmonitorlock-method.md │ │ │ ├── icordebugheapvalue3-interface.md │ │ │ ├── icordebugilcode-getehclauses-method.md │ │ │ ├── icordebugilcode-interface.md │ │ │ ├── icordebugilcode2-getinstrumentedilmap-method.md │ │ │ ├── icordebugilcode2-getlocalvarsigtoken-method.md │ │ │ ├── icordebugilcode2-interface.md │ │ │ ├── icordebugilframe-cansetip-method.md │ │ │ ├── icordebugilframe-enumeratearguments-method.md │ │ │ ├── icordebugilframe-enumeratelocalvariables-method.md │ │ │ ├── icordebugilframe-getargument-method.md │ │ │ ├── icordebugilframe-getip-method.md │ │ │ ├── icordebugilframe-getlocalvariable-method.md │ │ │ ├── icordebugilframe-getstackdepth-method.md │ │ │ ├── icordebugilframe-getstackvalue-method.md │ │ │ ├── icordebugilframe-interface.md │ │ │ ├── icordebugilframe-setip-method.md │ │ │ ├── icordebugilframe2-enumeratetypeparameters-method.md │ │ │ ├── icordebugilframe2-interface.md │ │ │ ├── icordebugilframe2-remapfunction-method.md │ │ │ ├── icordebugilframe3-getreturnvalueforiloffset-method.md │ │ │ ├── icordebugilframe3-interface.md │ │ │ ├── icordebugilframe4-enumeratelocalvariablesex-method.md │ │ │ ├── icordebugilframe4-getcodeex-method.md │ │ │ ├── icordebugilframe4-getlocalvariableex-method.md │ │ │ ├── icordebugilframe4-interface.md │ │ │ ├── icordebuginstancefieldsymbol-getname-method.md │ │ │ ├── icordebuginstancefieldsymbol-getoffset-method.md │ │ │ ├── icordebuginstancefieldsymbol-getsize-method.md │ │ │ ├── icordebuginstancefieldsymbol-interface.md │ │ │ ├── icordebuginternalframe-getframetype-method.md │ │ │ ├── icordebuginternalframe-interface.md │ │ │ ├── icordebuginternalframe2-getframeaddress-method.md │ │ │ ├── icordebuginternalframe2-interface.md │ │ │ ├── icordebuginternalframe2-isclosertoleaf-method.md │ │ │ ├── icordebugloadedmodule-getbaseaddress-method.md │ │ │ ├── icordebugloadedmodule-getname-method.md │ │ │ ├── icordebugloadedmodule-getsize-method.md │ │ │ ├── icordebugloadedmodule-interface.md │ │ │ ├── icordebugmanagedcallback-break-method.md │ │ │ ├── icordebugmanagedcallback-breakpoint-method.md │ │ │ ├── icordebugmanagedcallback-breakpointseterror-method.md │ │ │ ├── icordebugmanagedcallback-controlctrap-method.md │ │ │ ├── icordebugmanagedcallback-createappdomain-method.md │ │ │ ├── icordebugmanagedcallback-createprocess-method.md │ │ │ ├── icordebugmanagedcallback-createthread-method.md │ │ │ ├── icordebugmanagedcallback-debuggererror-method.md │ │ │ ├── icordebugmanagedcallback-editandcontinueremap-method.md │ │ │ ├── icordebugmanagedcallback-evalcomplete-method.md │ │ │ ├── icordebugmanagedcallback-evalexception-method.md │ │ │ ├── icordebugmanagedcallback-exception-method.md │ │ │ ├── icordebugmanagedcallback-exitappdomain-method.md │ │ │ ├── icordebugmanagedcallback-exitprocess-method.md │ │ │ ├── icordebugmanagedcallback-exitthread-method.md │ │ │ ├── icordebugmanagedcallback-interface.md │ │ │ ├── icordebugmanagedcallback-loadassembly-method.md │ │ │ ├── icordebugmanagedcallback-loadclass-method.md │ │ │ ├── icordebugmanagedcallback-loadmodule-method.md │ │ │ ├── icordebugmanagedcallback-logmessage-method.md │ │ │ ├── icordebugmanagedcallback-logswitch-method.md │ │ │ ├── icordebugmanagedcallback-namechange-method.md │ │ │ ├── icordebugmanagedcallback-stepcomplete-method.md │ │ │ ├── icordebugmanagedcallback-unloadassembly-method.md │ │ │ ├── icordebugmanagedcallback-unloadclass-method.md │ │ │ ├── icordebugmanagedcallback-unloadmodule-method.md │ │ │ ├── icordebugmanagedcallback-updatemodulesymbols-method.md │ │ │ ├── icordebugmanagedcallback2-changeconnection-method.md │ │ │ ├── icordebugmanagedcallback2-createconnection-method.md │ │ │ ├── icordebugmanagedcallback2-destroyconnection-method.md │ │ │ ├── icordebugmanagedcallback2-exception-method.md │ │ │ ├── icordebugmanagedcallback2-exceptionunwind-method.md │ │ │ ├── icordebugmanagedcallback2-functionremapcomplete-method.md │ │ │ ├── icordebugmanagedcallback2-functionremapopportunity-method.md │ │ │ ├── icordebugmanagedcallback2-interface.md │ │ │ ├── icordebugmanagedcallback2-mdanotification-method.md │ │ │ ├── icordebugmanagedcallback3-customnotification-method.md │ │ │ ├── icordebugmanagedcallback3-interface.md │ │ │ ├── icordebugmda-getdescription-method.md │ │ │ ├── icordebugmda-getflags-method.md │ │ │ ├── icordebugmda-getname-method.md │ │ │ ├── icordebugmda-getosthreadid-method.md │ │ │ ├── icordebugmda-getxml-method.md │ │ │ ├── icordebugmda-interface.md │ │ │ ├── icordebugmemorybuffer-getsize-method.md │ │ │ ├── icordebugmemorybuffer-getstartaddress-method.md │ │ │ ├── icordebugmemorybuffer-interface.md │ │ │ ├── icordebugmergedassemblyrecord-getculture-method.md │ │ │ ├── icordebugmergedassemblyrecord-getindex-method.md │ │ │ ├── icordebugmergedassemblyrecord-getpublickey-method.md │ │ │ ├── icordebugmergedassemblyrecord-getpublickeytoken-method.md │ │ │ ├── icordebugmergedassemblyrecord-getsimplename-method.md │ │ │ ├── icordebugmergedassemblyrecord-getversion-method.md │ │ │ ├── icordebugmergedassemblyrecord-interface.md │ │ │ ├── icordebugmetadatalocator-getmetadata-method.md │ │ │ ├── icordebugmetadatalocator-interface.md │ │ │ ├── icordebugmodule-createbreakpoint-method.md │ │ │ ├── icordebugmodule-enableclassloadcallbacks-method.md │ │ │ ├── icordebugmodule-enablejitdebugging-method.md │ │ │ ├── icordebugmodule-getassembly-method.md │ │ │ ├── icordebugmodule-getbaseaddress-method.md │ │ │ ├── icordebugmodule-getclassfromtoken-method.md │ │ │ ├── icordebugmodule-geteditandcontinuesnapshot-method.md │ │ │ ├── icordebugmodule-getfunctionfromrva-method.md │ │ │ ├── icordebugmodule-getfunctionfromtoken-method.md │ │ │ ├── icordebugmodule-getglobalvariablevalue-method.md │ │ │ ├── icordebugmodule-getmetadatainterface-method.md │ │ │ ├── icordebugmodule-getname-method.md │ │ │ ├── icordebugmodule-getprocess-method.md │ │ │ ├── icordebugmodule-getsize-method.md │ │ │ ├── icordebugmodule-gettoken-method.md │ │ │ ├── icordebugmodule-interface.md │ │ │ ├── icordebugmodule-isdynamic-method.md │ │ │ ├── icordebugmodule-isinmemory-method.md │ │ │ ├── icordebugmodule2-applychanges-method.md │ │ │ ├── icordebugmodule2-getjitcompilerflags-method.md │ │ │ ├── icordebugmodule2-interface.md │ │ │ ├── icordebugmodule2-resolveassembly-method.md │ │ │ ├── icordebugmodule2-setjitcompilerflags-method.md │ │ │ ├── icordebugmodule2-setjmcstatus-method.md │ │ │ ├── icordebugmodule3-createreaderforinmemorysymbols-method.md │ │ │ ├── icordebugmodule3-interface.md │ │ │ ├── icordebugmodulebreakpoint-getmodule-method.md │ │ │ ├── icordebugmodulebreakpoint-interface.md │ │ │ ├── icordebugmoduledebugevent-getmodule-method.md │ │ │ ├── icordebugmoduledebugevent-interface.md │ │ │ ├── icordebugmoduleenum-interface.md │ │ │ ├── icordebugmoduleenum-next-method.md │ │ │ ├── icordebugmutabledatatarget-continuestatuschanged-method.md │ │ │ ├── icordebugmutabledatatarget-interface.md │ │ │ ├── icordebugmutabledatatarget-setthreadcontext-method.md │ │ │ ├── icordebugmutabledatatarget-writevirtual-method.md │ │ │ ├── icordebugnativeframe-cansetip-method.md │ │ │ ├── icordebugnativeframe-getip-method.md │ │ │ ├── icordebugnativeframe-getlocaldoubleregistervalue-method.md │ │ │ ├── icordebugnativeframe-getlocalmemoryregistervalue-method.md │ │ │ ├── icordebugnativeframe-getlocalmemoryvalue-method.md │ │ │ ├── icordebugnativeframe-getlocalregistermemoryvalue-method.md │ │ │ ├── icordebugnativeframe-getlocalregistervalue-method.md │ │ │ ├── icordebugnativeframe-getregisterset-method.md │ │ │ ├── icordebugnativeframe-interface.md │ │ │ ├── icordebugnativeframe-setip-method.md │ │ │ ├── icordebugnativeframe2-getstackparametersize-method.md │ │ │ ├── icordebugnativeframe2-interface.md │ │ │ ├── icordebugnativeframe2-ischild-method.md │ │ │ ├── icordebugnativeframe2-ismatchingparentframe-method.md │ │ │ ├── icordebugobjectenum-interface.md │ │ │ ├── icordebugobjectenum-next-method.md │ │ │ ├── icordebugobjectvalue-getclass-method.md │ │ │ ├── icordebugobjectvalue-getcontext-method.md │ │ │ ├── icordebugobjectvalue-getfieldvalue-method.md │ │ │ ├── icordebugobjectvalue-getmanagedcopy-method.md │ │ │ ├── icordebugobjectvalue-getvirtualmethod-method.md │ │ │ ├── icordebugobjectvalue-interface.md │ │ │ ├── icordebugobjectvalue-isvalueclass-method.md │ │ │ ├── icordebugobjectvalue-setfrommanagedcopy-method.md │ │ │ ├── icordebugobjectvalue2-getvirtualmethodandtype-method.md │ │ │ ├── icordebugobjectvalue2-interface.md │ │ │ ├── icordebugprocess-clearcurrentexception-method.md │ │ │ ├── icordebugprocess-enablelogmessages-method.md │ │ │ ├── icordebugprocess-enumerateappdomains-method.md │ │ │ ├── icordebugprocess-enumerateobjects-method.md │ │ │ ├── icordebugprocess-gethandle-method.md │ │ │ ├── icordebugprocess-gethelperthreadid-method.md │ │ │ ├── icordebugprocess-getid-method.md │ │ │ ├── icordebugprocess-getobject-method.md │ │ │ ├── icordebugprocess-getthread-method.md │ │ │ ├── icordebugprocess-getthreadcontext-method.md │ │ │ ├── icordebugprocess-interface.md │ │ │ ├── icordebugprocess-isossuspended-method.md │ │ │ ├── icordebugprocess-istransitionstub-method.md │ │ │ ├── icordebugprocess-modifylogswitch-method.md │ │ │ ├── icordebugprocess-readmemory-method.md │ │ │ ├── icordebugprocess-setthreadcontext-method.md │ │ │ ├── icordebugprocess-threadforfibercookie-method.md │ │ │ ├── icordebugprocess-writememory-method.md │ │ │ ├── icordebugprocess2-clearunmanagedbreakpoint-method.md │ │ │ ├── icordebugprocess2-getdesiredngencompilerflags-method.md │ │ │ ├── icordebugprocess2-getreferencevaluefromgchandle-method.md │ │ │ ├── icordebugprocess2-getthreadfortaskid-method.md │ │ │ ├── icordebugprocess2-getversion-method.md │ │ │ ├── icordebugprocess2-interface1.md │ │ │ ├── icordebugprocess2-setdesiredngencompilerflags-method.md │ │ │ ├── icordebugprocess2-setunmanagedbreakpoint-method.md │ │ │ ├── icordebugprocess3-interface.md │ │ │ ├── icordebugprocess3-setenablecustomnotification-method.md │ │ │ ├── icordebugprocess4-interface.md │ │ │ ├── icordebugprocess4-processstatechanged-method.md │ │ │ ├── icordebugprocess5-enablengenpolicy-method.md │ │ │ ├── icordebugprocess5-enumerategcreferences-method.md │ │ │ ├── icordebugprocess5-enumeratehandles-method.md │ │ │ ├── icordebugprocess5-enumerateheap-method.md │ │ │ ├── icordebugprocess5-enumerateheapregions-method.md │ │ │ ├── icordebugprocess5-getarraylayout-method.md │ │ │ ├── icordebugprocess5-getgcheapinformation-method.md │ │ │ ├── icordebugprocess5-getobject-method.md │ │ │ ├── icordebugprocess5-gettypefields-method.md │ │ │ ├── icordebugprocess5-gettypefortypeid-method.md │ │ │ ├── icordebugprocess5-gettypeid-method.md │ │ │ ├── icordebugprocess5-gettypelayout-method.md │ │ │ ├── icordebugprocess5-interface.md │ │ │ ├── icordebugprocess6-decodeevent-method.md │ │ │ ├── icordebugprocess6-enablevirtualmodulesplitting-method.md │ │ │ ├── icordebugprocess6-getcode-method.md │ │ │ ├── icordebugprocess6-getexportstepinfo-method.md │ │ │ ├── icordebugprocess6-interface.md │ │ │ ├── icordebugprocess6-markdebuggerattached-method.md │ │ │ ├── icordebugprocess6-processstatechanged-method.md │ │ │ ├── icordebugprocess7-interface.md │ │ │ ├── icordebugprocess7-setwriteablemetadataupdatemode-method.md │ │ │ ├── icordebugprocess8-enableexceptioncallbacksoutsideofmycode-method.md │ │ │ ├── icordebugprocess8-interface.md │ │ │ ├── icordebugprocessenum-interface.md │ │ │ ├── icordebugprocessenum-next-method.md │ │ │ ├── icordebugreferencevalue-dereference-method.md │ │ │ ├── icordebugreferencevalue-dereferencestrong-method.md │ │ │ ├── icordebugreferencevalue-getvalue-method.md │ │ │ ├── icordebugreferencevalue-interface.md │ │ │ ├── icordebugreferencevalue-isnull-method.md │ │ │ ├── icordebugreferencevalue-setvalue-method.md │ │ │ ├── icordebugregisterset-getregisters-method.md │ │ │ ├── icordebugregisterset-getregistersavailable-method.md │ │ │ ├── icordebugregisterset-getthreadcontext-method.md │ │ │ ├── icordebugregisterset-interface.md │ │ │ ├── icordebugregisterset-setregisters-method.md │ │ │ ├── icordebugregisterset-setthreadcontext-method.md │ │ │ ├── icordebugregisterset2-getregisters-method.md │ │ │ ├── icordebugregisterset2-getregistersavailable-method.md │ │ │ ├── icordebugregisterset2-interface.md │ │ │ ├── icordebugregisterset2-setregisters-method.md │ │ │ ├── icordebugremote-createprocessex-method.md │ │ │ ├── icordebugremote-debugactiveprocessex-method.md │ │ │ ├── icordebugremote-interface.md │ │ │ ├── icordebugremotetarget-gethostname-method.md │ │ │ ├── icordebugremotetarget-interface.md │ │ │ ├── icordebugruntimeunwindableframe-interface.md │ │ │ ├── icordebugstackwalk-getcontext-method.md │ │ │ ├── icordebugstackwalk-getframe-method.md │ │ │ ├── icordebugstackwalk-interface.md │ │ │ ├── icordebugstackwalk-next-method.md │ │ │ ├── icordebugstackwalk-setcontext-method.md │ │ │ ├── icordebugstaticfieldsymbol-getaddress-method.md │ │ │ ├── icordebugstaticfieldsymbol-getname-method.md │ │ │ ├── icordebugstaticfieldsymbol-getsize-method.md │ │ │ ├── icordebugstaticfieldsymbol-interface.md │ │ │ ├── icordebugstepper-deactivate-method.md │ │ │ ├── icordebugstepper-interface.md │ │ │ ├── icordebugstepper-isactive-method.md │ │ │ ├── icordebugstepper-setinterceptmask-method.md │ │ │ ├── icordebugstepper-setrangeil-method.md │ │ │ ├── icordebugstepper-setunmappedstopmask-method.md │ │ │ ├── icordebugstepper-step-method.md │ │ │ ├── icordebugstepper-stepout-method.md │ │ │ ├── icordebugstepper-steprange-method.md │ │ │ ├── icordebugstepper2-interface1.md │ │ │ ├── icordebugstepper2-setjmc-method.md │ │ │ ├── icordebugstepperenum-interface.md │ │ │ ├── icordebugstepperenum-next-method.md │ │ │ ├── icordebugstringvalue-getlength-method.md │ │ │ ├── icordebugstringvalue-getstring-method.md │ │ │ ├── icordebugstringvalue-interface.md │ │ │ ├── icordebugsymbolprovider-getassemblyimagebytes-method.md │ │ │ ├── icordebugsymbolprovider-getassemblyimagemetadata-method.md │ │ │ ├── icordebugsymbolprovider-getcoderange-method.md │ │ │ ├── icordebugsymbolprovider-getinstancefieldsymbols-method.md │ │ │ ├── icordebugsymbolprovider-getmergedassemblyrecords-method.md │ │ │ ├── icordebugsymbolprovider-getmethodlocalsymbols-method.md │ │ │ ├── icordebugsymbolprovider-getmethodparametersymbols-method.md │ │ │ ├── icordebugsymbolprovider-getmethodprops-method.md │ │ │ ├── icordebugsymbolprovider-getobjectsize-method.md │ │ │ ├── icordebugsymbolprovider-getstaticfieldsymbols-method.md │ │ │ ├── icordebugsymbolprovider-gettypeprops-method.md │ │ │ ├── icordebugsymbolprovider-interface.md │ │ │ ├── icordebugsymbolprovider2-getframeprops-method.md │ │ │ ├── icordebugsymbolprovider2-getgenericdictionaryinfo-method.md │ │ │ ├── icordebugsymbolprovider2-interface.md │ │ │ ├── icordebugthread-clearcurrentexception-method.md │ │ │ ├── icordebugthread-createeval-method.md │ │ │ ├── icordebugthread-createstepper-method.md │ │ │ ├── icordebugthread-enumeratechains-method.md │ │ │ ├── icordebugthread-getactivechain-method.md │ │ │ ├── icordebugthread-getactiveframe-method.md │ │ │ ├── icordebugthread-getappdomain-method.md │ │ │ ├── icordebugthread-getcurrentexception-method.md │ │ │ ├── icordebugthread-getdebugstate-method.md │ │ │ ├── icordebugthread-gethandle-method.md │ │ │ ├── icordebugthread-getid-method.md │ │ │ ├── icordebugthread-getobject-method.md │ │ │ ├── icordebugthread-getprocess-method.md │ │ │ ├── icordebugthread-getregisterset-method.md │ │ │ ├── icordebugthread-getuserstate-method.md │ │ │ ├── icordebugthread-interface.md │ │ │ ├── icordebugthread-setdebugstate-method.md │ │ │ ├── icordebugthread2-getactivefunctions-method.md │ │ │ ├── icordebugthread2-getconnectionid-method.md │ │ │ ├── icordebugthread2-gettaskid-method.md │ │ │ ├── icordebugthread2-getvolatileosthreadid-method.md │ │ │ ├── icordebugthread2-interceptcurrentexception-method.md │ │ │ ├── icordebugthread2-interface.md │ │ │ ├── icordebugthread3-createstackwalk-method.md │ │ │ ├── icordebugthread3-getactiveinternalframes-method.md │ │ │ ├── icordebugthread3-interface.md │ │ │ ├── icordebugthread4-getblockingobjects-method.md │ │ │ ├── icordebugthread4-getcurrentcustomdebuggernotification-method.md │ │ │ ├── icordebugthread4-hadunhandledexception-method.md │ │ │ ├── icordebugthread4-interface.md │ │ │ ├── icordebugthreadenum-interface1.md │ │ │ ├── icordebugthreadenum-next-method.md │ │ │ ├── icordebugtype-enumeratetypeparameters-method.md │ │ │ ├── icordebugtype-getbase-method.md │ │ │ ├── icordebugtype-getclass-method.md │ │ │ ├── icordebugtype-getfirsttypeparameter-method.md │ │ │ ├── icordebugtype-getrank-method.md │ │ │ ├── icordebugtype-getstaticfieldvalue-method.md │ │ │ ├── icordebugtype-gettype-method.md │ │ │ ├── icordebugtype-interface.md │ │ │ ├── icordebugtype2-gettypeid-method.md │ │ │ ├── icordebugtype2-interface.md │ │ │ ├── icordebugtypeenum-interface.md │ │ │ ├── icordebugtypeenum-next-method.md │ │ │ ├── icordebugunmanagedcallback-debugevent-method.md │ │ │ ├── icordebugunmanagedcallback-interface.md │ │ │ ├── icordebugvalue-createbreakpoint-method.md │ │ │ ├── icordebugvalue-getaddress-method.md │ │ │ ├── icordebugvalue-getsize-method.md │ │ │ ├── icordebugvalue-gettype-method.md │ │ │ ├── icordebugvalue-interface.md │ │ │ ├── icordebugvalue2-getexacttype-method.md │ │ │ ├── icordebugvalue2-interface.md │ │ │ ├── icordebugvalue3-getsize64-method.md │ │ │ ├── icordebugvalue3-interface.md │ │ │ ├── icordebugvaluebreakpoint-getvalue-method.md │ │ │ ├── icordebugvaluebreakpoint-interface.md │ │ │ ├── icordebugvalueenum-interface.md │ │ │ ├── icordebugvalueenum-next-method.md │ │ │ ├── icordebugvariablehome-getargumentindex-method.md │ │ │ ├── icordebugvariablehome-getcode-method.md │ │ │ ├── icordebugvariablehome-getliverange-method.md │ │ │ ├── icordebugvariablehome-getlocationtype-method.md │ │ │ ├── icordebugvariablehome-getoffset-method.md │ │ │ ├── icordebugvariablehome-getregister-method.md │ │ │ ├── icordebugvariablehome-getslotindex-method.md │ │ │ ├── icordebugvariablehome-interface.md │ │ │ ├── icordebugvariablehomeenum-interface.md │ │ │ ├── icordebugvariablehomeenum-next-method.md │ │ │ ├── icordebugvariablesymbol-getname-method.md │ │ │ ├── icordebugvariablesymbol-getsize-method.md │ │ │ ├── icordebugvariablesymbol-getslotindex-method.md │ │ │ ├── icordebugvariablesymbol-getvalue-method.md │ │ │ ├── icordebugvariablesymbol-interface.md │ │ │ ├── icordebugvariablesymbol-setvalue-method.md │ │ │ ├── icordebugvirtualunwinder-getcontext-method.md │ │ │ ├── icordebugvirtualunwinder-interface.md │ │ │ ├── icordebugvirtualunwinder-next-method.md │ │ │ ├── icoreclrdebugtarget-enumprocesses-method.md │ │ │ ├── icoreclrdebugtarget-enumruntimes-method.md │ │ │ ├── icoreclrdebugtarget-freememory-method.md │ │ │ ├── icoreclrdebugtarget-interface.md │ │ │ ├── icorpublish-enumprocesses-method.md │ │ │ ├── icorpublish-getprocess-method.md │ │ │ ├── icorpublish-interface.md │ │ │ ├── icorpublishappdomain-getid-method.md │ │ │ ├── icorpublishappdomain-getname-method.md │ │ │ ├── icorpublishappdomain-interface.md │ │ │ ├── icorpublishappdomainenum-interface.md │ │ │ ├── icorpublishappdomainenum-next-method.md │ │ │ ├── icorpublishenum-clone-method.md │ │ │ ├── icorpublishenum-getcount-method.md │ │ │ ├── icorpublishenum-interface.md │ │ │ ├── icorpublishenum-reset-method.md │ │ │ ├── icorpublishenum-skip-method.md │ │ │ ├── icorpublishprocess-enumappdomains-method.md │ │ │ ├── icorpublishprocess-getdisplayname-method.md │ │ │ ├── icorpublishprocess-getprocessid-method.md │ │ │ ├── icorpublishprocess-interface.md │ │ │ ├── icorpublishprocess-ismanaged-method.md │ │ │ ├── icorpublishprocessenum-interface.md │ │ │ ├── icorpublishprocessenum-next-method.md │ │ │ ├── ilcodekind-enumeration.md │ │ │ ├── index.md │ │ │ ├── initdbgtransportmanager-function.md │ │ │ ├── isosdacinterface-getmethoddescdata-method.md │ │ │ ├── isosdacinterface-getmethoddescptrfromip-method.md │ │ │ ├── isosdacinterface-getmoduledata-method.md │ │ │ ├── isosdacinterface-interface.md │ │ │ ├── ixclrdatamethoddefinition-endenuminstances-method.md │ │ │ ├── ixclrdatamethoddefinition-enuminstance-method.md │ │ │ ├── ixclrdatamethoddefinition-interface.md │ │ │ ├── ixclrdatamethoddefinition-startenuminstances-method.md │ │ │ ├── ixclrdatamethodinstance-getiladdressmap-method.md │ │ │ ├── ixclrdatamethodinstance-getrepresentativeentryaddress-method.md │ │ │ ├── ixclrdatamethodinstance-interface.md │ │ │ ├── ixclrdatamodule-getmethoddefinitionbytoken-method.md │ │ │ ├── ixclrdatamodule-getversionid-method.md │ │ │ ├── ixclrdatamodule-interface.md │ │ │ ├── ixclrdatamodule-request-method.md │ │ │ ├── ixclrdataprocess-endenummethodinstancesbyaddress-method.md │ │ │ ├── ixclrdataprocess-endenummodules-method.md │ │ │ ├── ixclrdataprocess-enummethodinstancebyaddress-method.md │ │ │ ├── ixclrdataprocess-enummodule-method.md │ │ │ ├── ixclrdataprocess-getappdomainbyuniqueid-method.md │ │ │ ├── ixclrdataprocess-interface.md │ │ │ ├── ixclrdataprocess-startenummethodinstancesbyaddress-method.md │ │ │ ├── ixclrdataprocess-startenummodules-method.md │ │ │ ├── logginglevelenum-enumeration.md │ │ │ ├── logswitchcallreason-enumeration.md │ │ │ ├── pfn-clrdatacreateinstance-function-pointer.md │ │ │ ├── shutdowndbgtransportmanager-function.md │ │ │ ├── silverlight-debugging.md │ │ │ ├── stacktrace-simplecontext-structure.md │ │ │ ├── toc.yml │ │ │ ├── variablelocationtype-enumeration.md │ │ │ └── writeablemetadataupdatemode-enumeration.md │ │ ├── diagnostics │ │ │ ├── call-id-structure.md │ │ │ ├── corsymaddrkind-enumeration.md │ │ │ ├── corsymsearchpolicyattributes-enumeration.md │ │ │ ├── corsymvarflag-enumeration.md │ │ │ ├── diagnostics-symbol-store-enumerations.md │ │ │ ├── diagnostics-symbol-store-interfaces.md │ │ │ ├── diagnostics-symbol-store-structures.md │ │ │ ├── ibindingdisplay-getcurrentdisplay-method.md │ │ │ ├── ibindingdisplay-initializeforprocess-method.md │ │ │ ├── ibindingdisplay-interface.md │ │ │ ├── idebugautoattach-autoattach-method.md │ │ │ ├── idebugautoattach-interface.md │ │ │ ├── index.md │ │ │ ├── inotifyconnection2-interface.md │ │ │ ├── inotifyconnection2-registernotifysource-method.md │ │ │ ├── inotifyconnection2-unregisternotifysource-method.md │ │ │ ├── inotifysink2-interface.md │ │ │ ├── inotifysink2-onsynccallenter-method.md │ │ │ ├── inotifysink2-onsynccallexit-method.md │ │ │ ├── inotifysink2-onsynccallout-method.md │ │ │ ├── inotifysink2-onsynccallreturn-method.md │ │ │ ├── inotifysource2-interface.md │ │ │ ├── inotifysource2-setnotifyfilter-method.md │ │ │ ├── isymencunmanagedmethod-getdocumentsformethod-method.md │ │ │ ├── isymencunmanagedmethod-getdocumentsformethodcount-method.md │ │ │ ├── isymencunmanagedmethod-getfilenamefromoffset-method.md │ │ │ ├── isymencunmanagedmethod-getlinefromoffset-method.md │ │ │ ├── isymencunmanagedmethod-getsourceextentindocument-method.md │ │ │ ├── isymencunmanagedmethod-interface.md │ │ │ ├── isymunmanagedasyncmethod-getasyncstepinfo-method.md │ │ │ ├── isymunmanagedasyncmethod-getasyncstepinfocount-method.md │ │ │ ├── isymunmanagedasyncmethod-getcatchhandleriloffset-method.md │ │ │ ├── isymunmanagedasyncmethod-getkickoffmethod-method.md │ │ │ ├── isymunmanagedasyncmethod-hascatchhandleriloffset-method.md │ │ │ ├── isymunmanagedasyncmethod-interface.md │ │ │ ├── isymunmanagedasyncmethod-isasyncmethod-method.md │ │ │ ├── isymunmanagedasyncmethodpropertieswriter-defineasyncstepinfo-method.md │ │ │ ├── isymunmanagedasyncmethodpropertieswriter-definecatchhandleriloffset-method.md │ │ │ ├── isymunmanagedasyncmethodpropertieswriter-definekickoffmethod-method.md │ │ │ ├── isymunmanagedasyncmethodpropertieswriter-interface.md │ │ │ ├── isymunmanagedbinder-getreaderforfile-method.md │ │ │ ├── isymunmanagedbinder-getreaderfromstream-method.md │ │ │ ├── isymunmanagedbinder-interface.md │ │ │ ├── isymunmanagedbinder2-getreaderforfile2-method.md │ │ │ ├── isymunmanagedbinder2-interface.md │ │ │ ├── isymunmanagedbinder3-getreaderfromcallback-method.md │ │ │ ├── isymunmanagedbinder3-interface.md │ │ │ ├── isymunmanagedconstant-getname-method.md │ │ │ ├── isymunmanagedconstant-getsignature-method.md │ │ │ ├── isymunmanagedconstant-getvalue-method.md │ │ │ ├── isymunmanagedconstant-interface.md │ │ │ ├── isymunmanageddispose-destroy-method.md │ │ │ ├── isymunmanageddispose-interface.md │ │ │ ├── isymunmanageddocument-findclosestline-method.md │ │ │ ├── isymunmanageddocument-getchecksum-method.md │ │ │ ├── isymunmanageddocument-getchecksumalgorithmid-method.md │ │ │ ├── isymunmanageddocument-getdocumenttype-method.md │ │ │ ├── isymunmanageddocument-getlanguage-method.md │ │ │ ├── isymunmanageddocument-getlanguagevendor-method.md │ │ │ ├── isymunmanageddocument-getsourcelength-method.md │ │ │ ├── isymunmanageddocument-getsourcerange-method.md │ │ │ ├── isymunmanageddocument-geturl-method.md │ │ │ ├── isymunmanageddocument-hasembeddedsource-method.md │ │ │ ├── isymunmanageddocument-interface.md │ │ │ ├── isymunmanageddocumentwriter-interface.md │ │ │ ├── isymunmanageddocumentwriter-setchecksum-method.md │ │ │ ├── isymunmanageddocumentwriter-setsource-method.md │ │ │ ├── isymunmanagedencupdate-getlocalvariablecount-method.md │ │ │ ├── isymunmanagedencupdate-getlocalvariables-method.md │ │ │ ├── isymunmanagedencupdate-initializeforenc-method.md │ │ │ ├── isymunmanagedencupdate-interface.md │ │ │ ├── isymunmanagedencupdate-updatemethodlines-method.md │ │ │ ├── isymunmanagedencupdate-updatesymbolstore2-method.md │ │ │ ├── isymunmanagedmethod-getnamespace-method.md │ │ │ ├── isymunmanagedmethod-getoffset-method.md │ │ │ ├── isymunmanagedmethod-getparameters-method.md │ │ │ ├── isymunmanagedmethod-getranges-method.md │ │ │ ├── isymunmanagedmethod-getrootscope-method.md │ │ │ ├── isymunmanagedmethod-getscopefromoffset-method.md │ │ │ ├── isymunmanagedmethod-getsequencepointcount-method.md │ │ │ ├── isymunmanagedmethod-getsequencepoints-method.md │ │ │ ├── isymunmanagedmethod-getsourcestartend-method.md │ │ │ ├── isymunmanagedmethod-gettoken-method.md │ │ │ ├── isymunmanagedmethod-interface.md │ │ │ ├── isymunmanagednamespace-getname-method.md │ │ │ ├── isymunmanagednamespace-getnamespaces-method.md │ │ │ ├── isymunmanagednamespace-getvariables-method.md │ │ │ ├── isymunmanagednamespace-interface.md │ │ │ ├── isymunmanagedreader-getdocument-method.md │ │ │ ├── isymunmanagedreader-getdocuments-method.md │ │ │ ├── isymunmanagedreader-getdocumentversion-method.md │ │ │ ├── isymunmanagedreader-getglobalvariables-method.md │ │ │ ├── isymunmanagedreader-getmethod-method.md │ │ │ ├── isymunmanagedreader-getmethodbyversion-method.md │ │ │ ├── isymunmanagedreader-getmethodfromdocumentposition-method.md │ │ │ ├── isymunmanagedreader-getmethodsfromdocumentposition-method.md │ │ │ ├── isymunmanagedreader-getmethodversion-method.md │ │ │ ├── isymunmanagedreader-getnamespaces-method.md │ │ │ ├── isymunmanagedreader-getsymattribute-method.md │ │ │ ├── isymunmanagedreader-getsymbolstorefilename-method.md │ │ │ ├── isymunmanagedreader-getuserentrypoint-method.md │ │ │ ├── isymunmanagedreader-getvariables-method.md │ │ │ ├── isymunmanagedreader-initialize-method.md │ │ │ ├── isymunmanagedreader-interface.md │ │ │ ├── isymunmanagedreader-replacesymbolstore-method.md │ │ │ ├── isymunmanagedreader-updatesymbolstore-method.md │ │ │ ├── isymunmanagedreader2-getmethodbyversionpreremap-method.md │ │ │ ├── isymunmanagedreader2-getmethodsindocument-method.md │ │ │ ├── isymunmanagedreader2-getsymattributepreremap-method.md │ │ │ ├── isymunmanagedreader2-interface.md │ │ │ ├── isymunmanagedreadersymbolsearchinfo-getsymbolsearchinfo-method.md │ │ │ ├── isymunmanagedreadersymbolsearchinfo-getsymbolsearchinfocount-method.md │ │ │ ├── isymunmanagedreadersymbolsearchinfo-interface.md │ │ │ ├── isymunmanagedscope-getchildren-method.md │ │ │ ├── isymunmanagedscope-getendoffset-method.md │ │ │ ├── isymunmanagedscope-getlocalcount-method.md │ │ │ ├── isymunmanagedscope-getlocals-method.md │ │ │ ├── isymunmanagedscope-getmethod-method.md │ │ │ ├── isymunmanagedscope-getnamespaces-method.md │ │ │ ├── isymunmanagedscope-getparent-method.md │ │ │ ├── isymunmanagedscope-getstartoffset-method.md │ │ │ ├── isymunmanagedscope-interface.md │ │ │ ├── isymunmanagedscope2-getconstantcount-method.md │ │ │ ├── isymunmanagedscope2-getconstants-method.md │ │ │ ├── isymunmanagedscope2-interface.md │ │ │ ├── isymunmanagedsourceservermodule-getsourceserverdata-method.md │ │ │ ├── isymunmanagedsourceservermodule-interface.md │ │ │ ├── isymunmanagedsymbolsearchinfo-gethresult-method.md │ │ │ ├── isymunmanagedsymbolsearchinfo-getsearchpath-method.md │ │ │ ├── isymunmanagedsymbolsearchinfo-getsearchpathlength-method.md │ │ │ ├── isymunmanagedsymbolsearchinfo-interface.md │ │ │ ├── isymunmanagedvariable-getaddressfield1-method.md │ │ │ ├── isymunmanagedvariable-getaddressfield2-method.md │ │ │ ├── isymunmanagedvariable-getaddressfield3-method.md │ │ │ ├── isymunmanagedvariable-getaddresskind-method.md │ │ │ ├── isymunmanagedvariable-getattributes-method.md │ │ │ ├── isymunmanagedvariable-getendoffset-method.md │ │ │ ├── isymunmanagedvariable-getname-method.md │ │ │ ├── isymunmanagedvariable-getsignature-method.md │ │ │ ├── isymunmanagedvariable-getstartoffset-method.md │ │ │ ├── isymunmanagedvariable-interface.md │ │ │ ├── isymunmanagedwriter-abort-method.md │ │ │ ├── isymunmanagedwriter-close-method.md │ │ │ ├── isymunmanagedwriter-closemethod-method.md │ │ │ ├── isymunmanagedwriter-closenamespace-method.md │ │ │ ├── isymunmanagedwriter-closescope-method.md │ │ │ ├── isymunmanagedwriter-defineconstant-method.md │ │ │ ├── isymunmanagedwriter-definedocument-method.md │ │ │ ├── isymunmanagedwriter-definefield-method.md │ │ │ ├── isymunmanagedwriter-defineglobalvariable-method.md │ │ │ ├── isymunmanagedwriter-definelocalvariable-method.md │ │ │ ├── isymunmanagedwriter-defineparameter-method.md │ │ │ ├── isymunmanagedwriter-definesequencepoints-method.md │ │ │ ├── isymunmanagedwriter-getdebuginfo-method.md │ │ │ ├── isymunmanagedwriter-initialize-method.md │ │ │ ├── isymunmanagedwriter-initialize2-method.md │ │ │ ├── isymunmanagedwriter-interface.md │ │ │ ├── isymunmanagedwriter-openmethod-method.md │ │ │ ├── isymunmanagedwriter-opennamespace-method.md │ │ │ ├── isymunmanagedwriter-openscope-method.md │ │ │ ├── isymunmanagedwriter-remaptoken-method.md │ │ │ ├── isymunmanagedwriter-setmethodsourcerange-method.md │ │ │ ├── isymunmanagedwriter-setscoperange-method.md │ │ │ ├── isymunmanagedwriter-setsymattribute-method.md │ │ │ ├── isymunmanagedwriter-setuserentrypoint-method.md │ │ │ ├── isymunmanagedwriter-usingnamespace-method.md │ │ │ ├── isymunmanagedwriter2-defineconstant2-method.md │ │ │ ├── isymunmanagedwriter2-defineglobalvariable2-method.md │ │ │ ├── isymunmanagedwriter2-definelocalvariable2-method.md │ │ │ ├── isymunmanagedwriter2-interface.md │ │ │ ├── isymunmanagedwriter3-commit-method.md │ │ │ ├── isymunmanagedwriter3-interface.md │ │ │ ├── isymunmanagedwriter3-openmethod2-method.md │ │ │ ├── isymunmanagedwriter4-getdebuginfowithpadding-method.md │ │ │ ├── isymunmanagedwriter4-interface.md │ │ │ ├── isymunmanagedwriter5-closemaptokenstosourcespans-method.md │ │ │ ├── isymunmanagedwriter5-interface.md │ │ │ ├── isymunmanagedwriter5-maptokentosourcespan-method.md │ │ │ ├── isymunmanagedwriter5-openmaptokenstosourcespans-method.md │ │ │ ├── notify-filter-enumeration.md │ │ │ ├── symlinedelta-structure.md │ │ │ ├── toc.yml │ │ │ └── user-thread-structure.md │ │ ├── fusion │ │ │ ├── asm-cache-flags-enumeration.md │ │ │ ├── asm-cmp-flags-enumeration.md │ │ │ ├── asm-display-flags-enumeration.md │ │ │ ├── asm-name-enumeration.md │ │ │ ├── assembly-info-structure.md │ │ │ ├── assemblycomparisonresult-enumeration.md │ │ │ ├── cleardownloadcache-function.md │ │ │ ├── compareassemblyidentity-function.md │ │ │ ├── create-asm-name-obj-flags-enumeration.md │ │ │ ├── createapplicationcontext-function.md │ │ │ ├── createassemblycache-function.md │ │ │ ├── createassemblyenum-function.md │ │ │ ├── createassemblynameobject-function.md │ │ │ ├── createhistoryreader-function.md │ │ │ ├── createinstallreferenceenum-function.md │ │ │ ├── fusion-enumerations.md │ │ │ ├── fusion-global-static-functions.md │ │ │ ├── fusion-install-reference-structure.md │ │ │ ├── fusion-interfaces.md │ │ │ ├── fusion-structures.md │ │ │ ├── getappidauthority-function.md │ │ │ ├── getassemblyidentityfromfile-function.md │ │ │ ├── getcachepath-function.md │ │ │ ├── gethistoryfiledirectory-function.md │ │ │ ├── getidentityauthority-function.md │ │ │ ├── iappidauthority-interface.md │ │ │ ├── iassemblycache-createassemblycacheitem-method.md │ │ │ ├── iassemblycache-createassemblyscavenger-method.md │ │ │ ├── iassemblycache-installassembly-method.md │ │ │ ├── iassemblycache-interface.md │ │ │ ├── iassemblycache-queryassemblyinfo-method.md │ │ │ ├── iassemblycache-uninstallassembly-method.md │ │ │ ├── iassemblycacheitem-abortitem-method.md │ │ │ ├── iassemblycacheitem-commit-method.md │ │ │ ├── iassemblycacheitem-createstream-method.md │ │ │ ├── iassemblycacheitem-interface.md │ │ │ ├── iassemblyenum-clone-method.md │ │ │ ├── iassemblyenum-getnextassembly-method.md │ │ │ ├── iassemblyenum-interface.md │ │ │ ├── iassemblyenum-reset-method.md │ │ │ ├── iassemblyname-clone-method.md │ │ │ ├── iassemblyname-finalize-method.md │ │ │ ├── iassemblyname-getdisplayname-method.md │ │ │ ├── iassemblyname-getname-method.md │ │ │ ├── iassemblyname-getproperty-method.md │ │ │ ├── iassemblyname-getversion-method.md │ │ │ ├── iassemblyname-interface.md │ │ │ ├── iassemblyname-isequal-method.md │ │ │ ├── iassemblyname-setproperty-method.md │ │ │ ├── idefinitionappid-interface.md │ │ │ ├── idefinitionidentity-interface.md │ │ │ ├── identity-attribute-blob-structure.md │ │ │ ├── identity-attribute-structure.md │ │ │ ├── ienumdefinitionidentity-interface.md │ │ │ ├── ienumidentity-attribute-interface.md │ │ │ ├── ienumreferenceidentity-interface.md │ │ │ ├── iidentityauthority-interface.md │ │ │ ├── iinstallreferenceenum-getnextinstallreferenceitem-method.md │ │ │ ├── iinstallreferenceenum-interface.md │ │ │ ├── iinstallreferenceitem-getreference-method.md │ │ │ ├── iinstallreferenceitem-interface.md │ │ │ ├── index.md │ │ │ ├── ireferenceappid-interface.md │ │ │ ├── ireferenceidentity-interface.md │ │ │ ├── isframeworkassembly-function.md │ │ │ ├── nukedownloadedcache-function.md │ │ │ ├── prebindassemblyex-function.md │ │ │ └── toc.yml │ │ ├── guid-managedname-attribute.md │ │ ├── hosting │ │ │ ├── assemblybindinfo-structure.md │ │ │ ├── bucketparameters-structure.md │ │ │ ├── callfunctionshim-function.md │ │ │ ├── clr-hosting-interfaces-added-in-the-net-framework-4-and-4-5.md │ │ │ ├── clr-hosting-interfaces.md │ │ │ ├── clrcreateinstance-function.md │ │ │ ├── clrcreatemanagedinstance-function.md │ │ │ ├── clrruntimehost-coclass.md │ │ │ ├── clsid-resolution-flags-enumeration.md │ │ │ ├── coeeshutdowncom-function.md │ │ │ ├── coinitializecor-function.md │ │ │ ├── coinitializeee-function.md │ │ │ ├── comcallunmarshal-coclass.md │ │ │ ├── cor-gc-stat-types-enumeration.md │ │ │ ├── cor-gc-stats-structure.md │ │ │ ├── cor-gc-thread-stats-structure.md │ │ │ ├── cor-gc-thread-stats-types-enumeration.md │ │ │ ├── corbindtocurrentruntime-function.md │ │ │ ├── corbindtoruntime-function.md │ │ │ ├── corbindtoruntimebycfg-function.md │ │ │ ├── corbindtoruntimeex-function.md │ │ │ ├── corbindtoruntimehost-function.md │ │ │ ├── cordllmain-function.md │ │ │ ├── corexemain-function.md │ │ │ ├── corexemain2-function.md │ │ │ ├── corexitprocess-function.md │ │ │ ├── corimageunloading-function.md │ │ │ ├── corlaunchapplication-function.md │ │ │ ├── cormarkthreadinthreadpool-function.md │ │ │ ├── corruntimehost-coclass.md │ │ │ ├── corvalidateimage-function.md │ │ │ ├── couninitializecor-function.md │ │ │ ├── couninitializeee-function.md │ │ │ ├── createdebugginginterfacefromversion-function.md │ │ │ ├── createiceefilegen-function.md │ │ │ ├── customdumpitem-structure.md │ │ │ ├── deprecated-clr-hosting-functions.md │ │ │ ├── deprecated-clr-hosting-interfaces-and-coclasses.md │ │ │ ├── destroyiceefilegen-function.md │ │ │ ├── eapicategories-enumeration.md │ │ │ ├── ebindpolicylevels-enumeration.md │ │ │ ├── eclrassemblyidentityflags-enumeration.md │ │ │ ├── eclrevent-enumeration.md │ │ │ ├── eclrfailure-enumeration.md │ │ │ ├── eclroperation-enumeration.md │ │ │ ├── eclrunhandledexception-enumeration.md │ │ │ ├── econtexttype-enumeration.md │ │ │ ├── ecustomdumpflavor-enumeration.md │ │ │ ├── ecustomdumpitemkind-enumeration.md │ │ │ ├── ehostapplicationpolicy-enumeration.md │ │ │ ├── ehostbindingpolicymodifyflags-enumeration.md │ │ │ ├── einitializenewdomainflags-enumeration.md │ │ │ ├── ememoryavailable-enumeration.md │ │ │ ├── ememorycriticallevel-enumeration.md │ │ │ ├── epolicyaction-enumeration.md │ │ │ ├── esymbolreadingpolicy-enumeration.md │ │ │ ├── etasktype-enumeration.md │ │ │ ├── fexecuteinappdomaincallback-function-pointer.md │ │ │ ├── flockclrversioncallback-function-pointer.md │ │ │ ├── getclridentitymanager-function.md │ │ │ ├── getcorrequiredversion-function.md │ │ │ ├── getcorsystemdirectory-function.md │ │ │ ├── getcorversion-function.md │ │ │ ├── getfileversion-function.md │ │ │ ├── getrealprocaddress-function.md │ │ │ ├── getrequestedruntimeinfo-function.md │ │ │ ├── getrequestedruntimeversion-function.md │ │ │ ├── getrequestedruntimeversionforclsid-function.md │ │ │ ├── getversionfromprocess-function.md │ │ │ ├── host-type-enumeration.md │ │ │ ├── hosting-coclasses.md │ │ │ ├── hosting-enumerations.md │ │ │ ├── hosting-global-static-functions.md │ │ │ ├── hosting-interfaces.md │ │ │ ├── hosting-structures.md │ │ │ ├── iactiononclrevent-interface.md │ │ │ ├── iactiononclrevent-onevent-method.md │ │ │ ├── iapartmentcallback-docallback-method.md │ │ │ ├── iapartmentcallback-interface.md │ │ │ ├── iappdomainbinding-interface.md │ │ │ ├── iappdomainbinding-onappdomain-method.md │ │ │ ├── iappdomainsetup-interface.md │ │ │ ├── icatalogservices-autodone-method.md │ │ │ ├── icatalogservices-interface.md │ │ │ ├── icatalogservices-notautodone-method.md │ │ │ ├── iceefilegen-class.md │ │ │ ├── iclrappdomainresourcemonitor-getcurrentallocated-method.md │ │ │ ├── iclrappdomainresourcemonitor-getcurrentcputime-method.md │ │ │ ├── iclrappdomainresourcemonitor-getcurrentsurvived-method.md │ │ │ ├── iclrappdomainresourcemonitor-interface.md │ │ │ ├── iclrassemblyidentitymanager-getbindingidentityfromfile-method.md │ │ │ ├── iclrassemblyidentitymanager-getbindingidentityfromstream-method.md │ │ │ ├── iclrassemblyidentitymanager-getclrassemblyreferencelist-method.md │ │ │ ├── iclrassemblyidentitymanager-getprobingassembliesfromreference-method.md │ │ │ ├── iclrassemblyidentitymanager-getreferencedassembliesfromfile-method.md │ │ │ ├── iclrassemblyidentitymanager-getreferencedassembliesfromstream-method.md │ │ │ ├── iclrassemblyidentitymanager-interface.md │ │ │ ├── iclrassemblyidentitymanager-isstronglynamed-method.md │ │ │ ├── iclrassemblyreferencelist-interface.md │ │ │ ├── iclrassemblyreferencelist-isassemblyreferenceinlist-method.md │ │ │ ├── iclrassemblyreferencelist-isstringassemblyreferenceinlist-method.md │ │ │ ├── iclrcontrol-getclrmanager-method.md │ │ │ ├── iclrcontrol-interface.md │ │ │ ├── iclrcontrol-setappdomainmanagertype-method.md │ │ │ ├── iclrdebugmanager-beginconnection-method.md │ │ │ ├── iclrdebugmanager-endconnection-method.md │ │ │ ├── iclrdebugmanager-getdacl-method.md │ │ │ ├── iclrdebugmanager-interface.md │ │ │ ├── iclrdebugmanager-isdebuggerattached-method.md │ │ │ ├── iclrdebugmanager-setconnectiontasks-method.md │ │ │ ├── iclrdebugmanager-setdacl-method.md │ │ │ ├── iclrdebugmanager-setsymbolreadingpolicy-method.md │ │ │ ├── iclrdomainmanager-interface.md │ │ │ ├── iclrdomainmanager-setappdomainmanagertype-method.md │ │ │ ├── iclrdomainmanager-setpropertiesfordefaultappdomain-method.md │ │ │ ├── iclrerrorreportingmanager-begincustomdump-method.md │ │ │ ├── iclrerrorreportingmanager-endcustomdump-method.md │ │ │ ├── iclrerrorreportingmanager-getbucketparametersforcurrentexception-method.md │ │ │ ├── iclrerrorreportingmanager-interface.md │ │ │ ├── iclrgcmanager-collect-method.md │ │ │ ├── iclrgcmanager-getstats-method.md │ │ │ ├── iclrgcmanager-interface.md │ │ │ ├── iclrgcmanager-setgcstartuplimits-method.md │ │ │ ├── iclrgcmanager2-interface.md │ │ │ ├── iclrgcmanager2-setgcstartuplimitsex-method.md │ │ │ ├── iclrhostbindingpolicymanager-evaluatepolicy-method.md │ │ │ ├── iclrhostbindingpolicymanager-interface.md │ │ │ ├── iclrhostbindingpolicymanager-modifyapplicationpolicy-method.md │ │ │ ├── iclrhostprotectionmanager-interface.md │ │ │ ├── iclrhostprotectionmanager-seteagerserializegrantsets-method.md │ │ │ ├── iclrhostprotectionmanager-setprotectedcategories-method.md │ │ │ ├── iclriocompletionmanager-interface.md │ │ │ ├── iclriocompletionmanager-oncomplete-method.md │ │ │ ├── iclrmemorynotificationcallback-interface.md │ │ │ ├── iclrmemorynotificationcallback-onmemorynotification-method.md │ │ │ ├── iclrmetahost-enumerateinstalledruntimes-method.md │ │ │ ├── iclrmetahost-enumerateloadedruntimes-method.md │ │ │ ├── iclrmetahost-exitprocess-method.md │ │ │ ├── iclrmetahost-getruntime-method.md │ │ │ ├── iclrmetahost-getversionfromfile-method.md │ │ │ ├── iclrmetahost-interface.md │ │ │ ├── iclrmetahost-querylegacyv2runtimebinding-method.md │ │ │ ├── iclrmetahost-requestruntimeloadednotification-method.md │ │ │ ├── iclrmetahostpolicy-getrequestedruntime-method.md │ │ │ ├── iclrmetahostpolicy-interface.md │ │ │ ├── iclroneventmanager-interface.md │ │ │ ├── iclroneventmanager-registeractiononevent-method.md │ │ │ ├── iclroneventmanager-unregisteractiononevent-method.md │ │ │ ├── iclrpolicymanager-interface.md │ │ │ ├── iclrpolicymanager-setactiononfailure-method.md │ │ │ ├── iclrpolicymanager-setactionontimeout-method.md │ │ │ ├── iclrpolicymanager-setdefaultaction-method.md │ │ │ ├── iclrpolicymanager-settimeout-method.md │ │ │ ├── iclrpolicymanager-settimeoutandaction-method.md │ │ │ ├── iclrpolicymanager-setunhandledexceptionpolicy-method.md │ │ │ ├── iclrprobingassemblyenum-get-method.md │ │ │ ├── iclrprobingassemblyenum-interface.md │ │ │ ├── iclrreferenceassemblyenum-get-method.md │ │ │ ├── iclrreferenceassemblyenum-interface.md │ │ │ ├── iclrruntimehost-executeapplication-method.md │ │ │ ├── iclrruntimehost-executeinappdomain-method.md │ │ │ ├── iclrruntimehost-executeindefaultappdomain-method.md │ │ │ ├── iclrruntimehost-getclrcontrol-method.md │ │ │ ├── iclrruntimehost-getcurrentappdomainid-method.md │ │ │ ├── iclrruntimehost-interface.md │ │ │ ├── iclrruntimehost-sethostcontrol-method.md │ │ │ ├── iclrruntimehost-start-method.md │ │ │ ├── iclrruntimehost-stop-method.md │ │ │ ├── iclrruntimehost-unloadappdomain-method.md │ │ │ ├── iclrruntimeinfo-bindaslegacyv2runtime-method.md │ │ │ ├── iclrruntimeinfo-getdefaultstartupflags-method.md │ │ │ ├── iclrruntimeinfo-getinterface-method.md │ │ │ ├── iclrruntimeinfo-getprocaddress-method.md │ │ │ ├── iclrruntimeinfo-getruntimedirectory-method.md │ │ │ ├── iclrruntimeinfo-getversionstring-method.md │ │ │ ├── iclrruntimeinfo-interface.md │ │ │ ├── iclrruntimeinfo-isloadable-method.md │ │ │ ├── iclrruntimeinfo-isloaded-method.md │ │ │ ├── iclrruntimeinfo-isstarted-method.md │ │ │ ├── iclrruntimeinfo-loaderrorstring-method.md │ │ │ ├── iclrruntimeinfo-loadlibrary-method.md │ │ │ ├── iclrruntimeinfo-setdefaultstartupflags-method.md │ │ │ ├── iclrstrongname-gethashfromassemblyfile-method.md │ │ │ ├── iclrstrongname-gethashfromassemblyfilew-method.md │ │ │ ├── iclrstrongname-gethashfromblob-method.md │ │ │ ├── iclrstrongname-gethashfromfile-method.md │ │ │ ├── iclrstrongname-gethashfromfilew-method.md │ │ │ ├── iclrstrongname-gethashfromhandle-method.md │ │ │ ├── iclrstrongname-interface.md │ │ │ ├── iclrstrongname-strongnamecompareassemblies-method.md │ │ │ ├── iclrstrongname-strongnamefreebuffer-method.md │ │ │ ├── iclrstrongname-strongnamegetblob-method.md │ │ │ ├── iclrstrongname-strongnamegetblobfromimage-method.md │ │ │ ├── iclrstrongname-strongnamegetpublickey-method.md │ │ │ ├── iclrstrongname-strongnamehashsize-method.md │ │ │ ├── iclrstrongname-strongnamekeydelete-method.md │ │ │ ├── iclrstrongname-strongnamekeygen-method.md │ │ │ ├── iclrstrongname-strongnamekeygenex-method.md │ │ │ ├── iclrstrongname-strongnamekeyinstall-method.md │ │ │ ├── iclrstrongname-strongnamesignaturegeneration-method.md │ │ │ ├── iclrstrongname-strongnamesignaturegenerationex-method.md │ │ │ ├── iclrstrongname-strongnamesignaturesize-method.md │ │ │ ├── iclrstrongname-strongnamesignatureverification-method.md │ │ │ ├── iclrstrongname-strongnamesignatureverificationex-method.md │ │ │ ├── iclrstrongname-strongnamesignatureverificationfromimage-method.md │ │ │ ├── iclrstrongname-strongnametokenfromassembly-method.md │ │ │ ├── iclrstrongname-strongnametokenfromassemblyex-method.md │ │ │ ├── iclrstrongname-strongnametokenfrompublickey-method.md │ │ │ ├── iclrstrongname2-interface.md │ │ │ ├── iclrsyncmanager-createrwlockowneriterator-method.md │ │ │ ├── iclrsyncmanager-deleterwlockowneriterator-method.md │ │ │ ├── iclrsyncmanager-getmonitorowner-method.md │ │ │ ├── iclrsyncmanager-getrwlockownernext-method.md │ │ │ ├── iclrsyncmanager-interface.md │ │ │ ├── iclrtask-abort-method.md │ │ │ ├── iclrtask-exittask-method.md │ │ │ ├── iclrtask-getmemstats-method.md │ │ │ ├── iclrtask-interface.md │ │ │ ├── iclrtask-locksheld-method.md │ │ │ ├── iclrtask-needspriorityscheduling-method.md │ │ │ ├── iclrtask-reset-method.md │ │ │ ├── iclrtask-rudeabort-method.md │ │ │ ├── iclrtask-settaskidentifier-method.md │ │ │ ├── iclrtask-switchin-method.md │ │ │ ├── iclrtask-switchout-method.md │ │ │ ├── iclrtask-yieldtask-method.md │ │ │ ├── iclrtask2-beginpreventasyncabort-method.md │ │ │ ├── iclrtask2-endpreventasyncabort-method.md │ │ │ ├── iclrtask2-interface.md │ │ │ ├── iclrtaskmanager-createtask-method.md │ │ │ ├── iclrtaskmanager-getcurrenttask-method.md │ │ │ ├── iclrtaskmanager-getcurrenttasktype-method.md │ │ │ ├── iclrtaskmanager-interface.md │ │ │ ├── iclrtaskmanager-setlocale-method.md │ │ │ ├── iclrtaskmanager-setuilocale-method.md │ │ │ ├── iclrvalidator-formateventinfo-method.md │ │ │ ├── iclrvalidator-interface.md │ │ │ ├── iclrvalidator-validate-method.md │ │ │ ├── icorconfiguration-adddebuggerspecialthread-method.md │ │ │ ├── icorconfiguration-interface.md │ │ │ ├── icorconfiguration-setdebuggerthreadcontrol-method.md │ │ │ ├── icorconfiguration-setgchostcontrol-method.md │ │ │ ├── icorconfiguration-setgcthreadcontrol-method.md │ │ │ ├── icorruntimehost-closeenum-method.md │ │ │ ├── icorruntimehost-createdomain-method.md │ │ │ ├── icorruntimehost-createdomainex-method.md │ │ │ ├── icorruntimehost-createdomainsetup-method.md │ │ │ ├── icorruntimehost-createevidence-method.md │ │ │ ├── icorruntimehost-createlogicalthreadstate-method.md │ │ │ ├── icorruntimehost-currentdomain-method.md │ │ │ ├── icorruntimehost-deletelogicalthreadstate-method.md │ │ │ ├── icorruntimehost-enumdomains-method.md │ │ │ ├── icorruntimehost-getconfiguration-method.md │ │ │ ├── icorruntimehost-getdefaultdomain-method.md │ │ │ ├── icorruntimehost-interface.md │ │ │ ├── icorruntimehost-locksheldbylogicalthread-method.md │ │ │ ├── icorruntimehost-mapfile-method.md │ │ │ ├── icorruntimehost-nextdomain-method.md │ │ │ ├── icorruntimehost-start-method.md │ │ │ ├── icorruntimehost-stop-method.md │ │ │ ├── icorruntimehost-switchinlogicalthreadstate-method.md │ │ │ ├── icorruntimehost-switchoutlogicalthreadstate-method.md │ │ │ ├── icorruntimehost-unloaddomain-method.md │ │ │ ├── icorthreadpool-corbindiocompletioncallback-method.md │ │ │ ├── icorthreadpool-corcallorqueueuserworkitem-method.md │ │ │ ├── icorthreadpool-corchangetimer-method.md │ │ │ ├── icorthreadpool-corcreatetimer-method.md │ │ │ ├── icorthreadpool-cordeletetimer-method.md │ │ │ ├── icorthreadpool-corgetavailablethreads-method.md │ │ │ ├── icorthreadpool-corgetmaxthreads-method.md │ │ │ ├── icorthreadpool-corqueueuserworkitem-method.md │ │ │ ├── icorthreadpool-corregisterwaitforsingleobject-method.md │ │ │ ├── icorthreadpool-corsetmaxthreads-method.md │ │ │ ├── icorthreadpool-corunregisterwait-method.md │ │ │ ├── icorthreadpool-interface.md │ │ │ ├── idebuggerinfo-interface.md │ │ │ ├── idebuggerinfo-isdebuggerattached-method.md │ │ │ ├── idebuggerthreadcontrol-interface.md │ │ │ ├── idebuggerthreadcontrol-releaseallruntimethreads-method.md │ │ │ ├── idebuggerthreadcontrol-startblockingfordebugger-method.md │ │ │ ├── idebuggerthreadcontrol-threadisblockingfordebugger-method.md │ │ │ ├── igchost-collect-method.md │ │ │ ├── igchost-getstats-method.md │ │ │ ├── igchost-getthreadstats-method.md │ │ │ ├── igchost-interface.md │ │ │ ├── igchost-setgcstartuplimits-method.md │ │ │ ├── igchost-setvirtualmemlimit-method.md │ │ │ ├── igchost2-interface.md │ │ │ ├── igchost2-setgcstartuplimitsex-method.md │ │ │ ├── igchostcontrol-interface.md │ │ │ ├── igchostcontrol-requestvirtualmemlimit-method.md │ │ │ ├── igcthreadcontrol-interface.md │ │ │ ├── igcthreadcontrol-suspensionending-method.md │ │ │ ├── igcthreadcontrol-suspensionstarting-method.md │ │ │ ├── igcthreadcontrol-threadisblockingforsuspension-method.md │ │ │ ├── ihostassemblymanager-getassemblystore-method.md │ │ │ ├── ihostassemblymanager-getnonhoststoreassemblies-method.md │ │ │ ├── ihostassemblymanager-interface.md │ │ │ ├── ihostassemblystore-interface.md │ │ │ ├── ihostassemblystore-provideassembly-method.md │ │ │ ├── ihostassemblystore-providemodule-method.md │ │ │ ├── ihostautoevent-interface.md │ │ │ ├── ihostautoevent-set-method.md │ │ │ ├── ihostautoevent-wait-method.md │ │ │ ├── ihostcontrol-gethostmanager-method.md │ │ │ ├── ihostcontrol-interface.md │ │ │ ├── ihostcontrol-setappdomainmanager-method.md │ │ │ ├── ihostcrst-enter-method.md │ │ │ ├── ihostcrst-interface.md │ │ │ ├── ihostcrst-leave-method.md │ │ │ ├── ihostcrst-setspincount-method.md │ │ │ ├── ihostcrst-tryenter-method.md │ │ │ ├── ihostgcmanager-interface.md │ │ │ ├── ihostgcmanager-suspensionending-method.md │ │ │ ├── ihostgcmanager-suspensionstarting-method.md │ │ │ ├── ihostgcmanager-threadisblockingforsuspension-method.md │ │ │ ├── ihostiocompletionmanager-bind-method.md │ │ │ ├── ihostiocompletionmanager-closeiocompletionport-method.md │ │ │ ├── ihostiocompletionmanager-createiocompletionport-method.md │ │ │ ├── ihostiocompletionmanager-getavailablethreads-method.md │ │ │ ├── ihostiocompletionmanager-gethostoverlappedsize-method.md │ │ │ ├── ihostiocompletionmanager-getmaxthreads-method.md │ │ │ ├── ihostiocompletionmanager-getminthreads-method.md │ │ │ ├── ihostiocompletionmanager-initializehostoverlapped-method.md │ │ │ ├── ihostiocompletionmanager-interface.md │ │ │ ├── ihostiocompletionmanager-setclriocompletionmanager-method.md │ │ │ ├── ihostiocompletionmanager-setmaxthreads-method.md │ │ │ ├── ihostiocompletionmanager-setminthreads-method.md │ │ │ ├── ihostmalloc-alloc-method.md │ │ │ ├── ihostmalloc-debugalloc-method.md │ │ │ ├── ihostmalloc-free-method.md │ │ │ ├── ihostmalloc-interface.md │ │ │ ├── ihostmanualevent-interface.md │ │ │ ├── ihostmanualevent-reset-method.md │ │ │ ├── ihostmanualevent-set-method.md │ │ │ ├── ihostmanualevent-wait-method.md │ │ │ ├── ihostmemorymanager-acquiredvirtualaddressspace-method.md │ │ │ ├── ihostmemorymanager-createmalloc-method.md │ │ │ ├── ihostmemorymanager-getmemoryload-method.md │ │ │ ├── ihostmemorymanager-interface.md │ │ │ ├── ihostmemorymanager-needsvirtualaddressspace-method.md │ │ │ ├── ihostmemorymanager-registermemorynotificationcallback-method.md │ │ │ ├── ihostmemorymanager-releasedvirtualaddressspace-method.md │ │ │ ├── ihostmemorymanager-virtualalloc-method.md │ │ │ ├── ihostmemorymanager-virtualfree-method.md │ │ │ ├── ihostmemorymanager-virtualprotect-method.md │ │ │ ├── ihostmemorymanager-virtualquery-method.md │ │ │ ├── ihostpolicymanager-interface.md │ │ │ ├── ihostpolicymanager-ondefaultaction-method.md │ │ │ ├── ihostpolicymanager-onfailure-method.md │ │ │ ├── ihostpolicymanager-ontimeout-method.md │ │ │ ├── ihostsecuritycontext-capture-method.md │ │ │ ├── ihostsecuritycontext-interface.md │ │ │ ├── ihostsecuritymanager-getsecuritycontext-method.md │ │ │ ├── ihostsecuritymanager-impersonateloggedonuser-method.md │ │ │ ├── ihostsecuritymanager-interface.md │ │ │ ├── ihostsecuritymanager-openthreadtoken-method.md │ │ │ ├── ihostsecuritymanager-reverttoself-method.md │ │ │ ├── ihostsecuritymanager-setsecuritycontext-method.md │ │ │ ├── ihostsecuritymanager-setthreadtoken-method.md │ │ │ ├── ihostsemaphore-interface.md │ │ │ ├── ihostsemaphore-releasesemaphore-method.md │ │ │ ├── ihostsemaphore-wait-method.md │ │ │ ├── ihostsyncmanager-createautoevent-method.md │ │ │ ├── ihostsyncmanager-createcrst-method.md │ │ │ ├── ihostsyncmanager-createcrstwithspincount-method.md │ │ │ ├── ihostsyncmanager-createmanualevent-method.md │ │ │ ├── ihostsyncmanager-createmonitorevent-method.md │ │ │ ├── ihostsyncmanager-createrwlockreaderevent-method.md │ │ │ ├── ihostsyncmanager-createrwlockwriterevent-method.md │ │ │ ├── ihostsyncmanager-createsemaphore-method.md │ │ │ ├── ihostsyncmanager-interface.md │ │ │ ├── ihostsyncmanager-setclrsyncmanager-method.md │ │ │ ├── ihosttask-alert-method.md │ │ │ ├── ihosttask-getpriority-method.md │ │ │ ├── ihosttask-interface.md │ │ │ ├── ihosttask-join-method.md │ │ │ ├── ihosttask-setclrtask-method.md │ │ │ ├── ihosttask-setpriority-method.md │ │ │ ├── ihosttask-start-method.md │ │ │ ├── ihosttaskmanager-begindelayabort-method.md │ │ │ ├── ihosttaskmanager-beginthreadaffinity-method.md │ │ │ ├── ihosttaskmanager-callneedshosthook-method.md │ │ │ ├── ihosttaskmanager-createtask-method.md │ │ │ ├── ihosttaskmanager-enddelayabort-method.md │ │ │ ├── ihosttaskmanager-endthreadaffinity-method.md │ │ │ ├── ihosttaskmanager-enterruntime-method.md │ │ │ ├── ihosttaskmanager-getcurrenttask-method.md │ │ │ ├── ihosttaskmanager-getstackguarantee-method.md │ │ │ ├── ihosttaskmanager-interface.md │ │ │ ├── ihosttaskmanager-leaveruntime-method.md │ │ │ ├── ihosttaskmanager-reverseenterruntime-method.md │ │ │ ├── ihosttaskmanager-reverseleaveruntime-method.md │ │ │ ├── ihosttaskmanager-setclrtaskmanager-method.md │ │ │ ├── ihosttaskmanager-setlocale-method.md │ │ │ ├── ihosttaskmanager-setstackguarantee-method.md │ │ │ ├── ihosttaskmanager-setuilocale-method.md │ │ │ ├── ihosttaskmanager-sleep-method.md │ │ │ ├── ihosttaskmanager-switchtotask-method.md │ │ │ ├── ihostthreadpoolmanager-getavailablethreads-method.md │ │ │ ├── ihostthreadpoolmanager-getmaxthreads-method.md │ │ │ ├── ihostthreadpoolmanager-getminthreads-method.md │ │ │ ├── ihostthreadpoolmanager-interface.md │ │ │ ├── ihostthreadpoolmanager-queueuserworkitem-method.md │ │ │ ├── ihostthreadpoolmanager-setmaxthreads-method.md │ │ │ ├── ihostthreadpoolmanager-setminthreads-method.md │ │ │ ├── imanagedobject-getobjectidentity-method.md │ │ │ ├── imanagedobject-getserializedbuffer-method.md │ │ │ ├── imanagedobject-interface.md │ │ │ ├── index.md │ │ │ ├── iobjecthandle-interface.md │ │ │ ├── iobjecthandle-unwrap-method.md │ │ │ ├── itypename-getassemblyname-method.md │ │ │ ├── itypename-getmodifierlength-method.md │ │ │ ├── itypename-getmodifiers-method.md │ │ │ ├── itypename-getnamecount-method.md │ │ │ ├── itypename-getnames-method.md │ │ │ ├── itypename-gettypeargumentcount-method.md │ │ │ ├── itypename-gettypearguments-method.md │ │ │ ├── itypename-interface.md │ │ │ ├── itypenamebuilder-addarray-method.md │ │ │ ├── itypenamebuilder-addassemblyspec-method.md │ │ │ ├── itypenamebuilder-addbyref-method.md │ │ │ ├── itypenamebuilder-addname-method.md │ │ │ ├── itypenamebuilder-addpointer-method.md │ │ │ ├── itypenamebuilder-addszarray-method.md │ │ │ ├── itypenamebuilder-clear-method.md │ │ │ ├── itypenamebuilder-closegenericargument-method.md │ │ │ ├── itypenamebuilder-closegenericarguments-method.md │ │ │ ├── itypenamebuilder-interface.md │ │ │ ├── itypenamebuilder-opengenericargument-method.md │ │ │ ├── itypenamebuilder-opengenericarguments-method.md │ │ │ ├── itypenamebuilder-tostring-method.md │ │ │ ├── itypenamefactory-gettypenamebuilder-method.md │ │ │ ├── itypenamefactory-interface.md │ │ │ ├── itypenamefactory-parsetypename-method.md │ │ │ ├── ivalidator-formateventinfo-method.md │ │ │ ├── ivalidator-interface.md │ │ │ ├── ivalidator-validate-method.md │ │ │ ├── loadlibraryshim-function.md │ │ │ ├── loadstringrc-function.md │ │ │ ├── loadstringrcex-function.md │ │ │ ├── lockclrversion-function.md │ │ │ ├── lpoverlapped-completion-routine-function-pointer.md │ │ │ ├── lpthread-start-routine-function-pointer.md │ │ │ ├── malloc-type-enumeration.md │ │ │ ├── mdainfo-structure.md │ │ │ ├── metahost-config-flags-enumeration.md │ │ │ ├── metahost-policy-flags-enumeration.md │ │ │ ├── modulebindinfo-structure.md │ │ │ ├── net-framework-4-hosting-global-static-functions.md │ │ │ ├── rundll32shimw-function.md │ │ │ ├── runtime-info-flags-enumeration.md │ │ │ ├── stackoverflowinfo-structure.md │ │ │ ├── stackoverflowtype-enumeration.md │ │ │ ├── startup-flags-enumeration.md │ │ │ ├── strongnamegetpublickeyex-method.md │ │ │ ├── strongnamesignatureverificationex2-method.md │ │ │ ├── toc.yml │ │ │ ├── typenamefactory-coclass.md │ │ │ ├── validatorflags-enumeration.md │ │ │ ├── wait-option-enumeration.md │ │ │ └── waitortimercallback-function-pointer.md │ │ ├── index.md │ │ ├── metadata │ │ │ ├── assemblyflags-enumeration.md │ │ │ ├── assemblymetadata-structure.md │ │ │ ├── assemblyrefflags-enumeration.md │ │ │ ├── ceesectionattr-enumeration.md │ │ │ ├── ceesectionrelocextra-union.md │ │ │ ├── ceesectionreloctype-enumeration.md │ │ │ ├── coiniticor-enumeration.md │ │ │ ├── coinitiee-enumeration.md │ │ │ ├── cor-field-offset-structure.md │ │ │ ├── cor-native-link-structure.md │ │ │ ├── corargtype-enumeration.md │ │ │ ├── corassemblyflags-enumeration.md │ │ │ ├── corattributetargets-enumeration.md │ │ │ ├── corcallingconvention-enumeration.md │ │ │ ├── corcheckduplicatesfor-enumeration.md │ │ │ ├── cordeclsecurity-enumeration.md │ │ │ ├── corelementtype-enumeration.md │ │ │ ├── corerrorifemitoutoforder-enumeration.md │ │ │ ├── coreventattr-enumeration.md │ │ │ ├── corfieldattr-enumeration.md │ │ │ ├── corfileflags-enumeration.md │ │ │ ├── corfilemapping-enumeration.md │ │ │ ├── corgenericparamattr-enumeration.md │ │ │ ├── corimportoptions-enumeration.md │ │ │ ├── corlinkeroptions-enumeration.md │ │ │ ├── corlocalrefpreservation-enumeration.md │ │ │ ├── cormanifestresourceflags-enumeration.md │ │ │ ├── cormethodattr-enumeration.md │ │ │ ├── cormethodimpl-enumeration.md │ │ │ ├── cormethodsemanticsattr-enumeration.md │ │ │ ├── cornativelinkflags-enumeration.md │ │ │ ├── cornativelinktype-enumeration.md │ │ │ ├── cornativetype-enumeration.md │ │ │ ├── cornotificationfortokenmovement-enumeration.md │ │ │ ├── coropenflags-enumeration.md │ │ │ ├── corparamattr-enumeration.md │ │ │ ├── corpekind-enumeration.md │ │ │ ├── corpinvokemap-enumeration.md │ │ │ ├── corpropertyattr-enumeration.md │ │ │ ├── correftodefcheck-enumeration.md │ │ │ ├── corregflags-enumeration.md │ │ │ ├── corsavesize-enumeration.md │ │ │ ├── corserializationtype-enumeration.md │ │ │ ├── corsetenc-enumeration.md │ │ │ ├── corthreadsafetyoptions-enumeration.md │ │ │ ├── cortokentype-enumeration.md │ │ │ ├── cortypeattr-enumeration.md │ │ │ ├── corunmanagedcallingconvention-enumeration.md │ │ │ ├── corvalidatormoduletype-enumeration.md │ │ │ ├── couninitiee-enumeration.md │ │ │ ├── cvstruct-structure.md │ │ │ ├── iceegen-addsectionreloc-method.md │ │ │ ├── iceegen-allocatemethodbuffer-method.md │ │ │ ├── iceegen-computepointer-method.md │ │ │ ├── iceegen-emitstring-method.md │ │ │ ├── iceegen-generateceefile-method.md │ │ │ ├── iceegen-generateceememoryimage-method.md │ │ │ ├── iceegen-getilsection-method.md │ │ │ ├── iceegen-getimaptokeniface-method.md │ │ │ ├── iceegen-getmethodbuffer-method.md │ │ │ ├── iceegen-getsectionblock-method.md │ │ │ ├── iceegen-getsectioncreate-method.md │ │ │ ├── iceegen-getsectiondatalen-method.md │ │ │ ├── iceegen-getstring-method.md │ │ │ ├── iceegen-getstringsection-method.md │ │ │ ├── iceegen-interface.md │ │ │ ├── iceegen-truncatesection-method.md │ │ │ ├── ihostfilter-interface.md │ │ │ ├── ihostfilter-marktoken-method.md │ │ │ ├── imaptoken-interface.md │ │ │ ├── imaptoken-map-method.md │ │ │ ├── imetadataassemblyemit-defineassembly-method.md │ │ │ ├── imetadataassemblyemit-defineassemblyref-method.md │ │ │ ├── imetadataassemblyemit-defineexportedtype-method.md │ │ │ ├── imetadataassemblyemit-definefile-method.md │ │ │ ├── imetadataassemblyemit-definemanifestresource-method.md │ │ │ ├── imetadataassemblyemit-interface.md │ │ │ ├── imetadataassemblyemit-setassemblyprops-method.md │ │ │ ├── imetadataassemblyemit-setassemblyrefprops-method.md │ │ │ ├── imetadataassemblyemit-setexportedtypeprops-method.md │ │ │ ├── imetadataassemblyemit-setfileprops-method.md │ │ │ ├── imetadataassemblyemit-setmanifestresourceprops-method.md │ │ │ ├── imetadataassemblyimport-closeenum-method.md │ │ │ ├── imetadataassemblyimport-enumassemblyrefs-method.md │ │ │ ├── imetadataassemblyimport-enumexportedtypes-method.md │ │ │ ├── imetadataassemblyimport-enumfiles-method.md │ │ │ ├── imetadataassemblyimport-enummanifestresources-method.md │ │ │ ├── imetadataassemblyimport-findassembliesbyname-method.md │ │ │ ├── imetadataassemblyimport-findexportedtypebyname-method.md │ │ │ ├── imetadataassemblyimport-findmanifestresourcebyname-method.md │ │ │ ├── imetadataassemblyimport-getassemblyfromscope-method.md │ │ │ ├── imetadataassemblyimport-getassemblyprops-method.md │ │ │ ├── imetadataassemblyimport-getassemblyrefprops-method.md │ │ │ ├── imetadataassemblyimport-getexportedtypeprops-method.md │ │ │ ├── imetadataassemblyimport-getfileprops-method.md │ │ │ ├── imetadataassemblyimport-getmanifestresourceprops-method.md │ │ │ ├── imetadataassemblyimport-interface.md │ │ │ ├── imetadataconverter-getmetadatafromtypeinfo-method.md │ │ │ ├── imetadataconverter-getmetadatafromtypelib-method.md │ │ │ ├── imetadataconverter-gettypelibfrommetadata-method.md │ │ │ ├── imetadataconverter-interface.md │ │ │ ├── imetadatadispenser-definescope-method.md │ │ │ ├── imetadatadispenser-interface.md │ │ │ ├── imetadatadispenser-openscope-method.md │ │ │ ├── imetadatadispenser-openscopeonmemory-method.md │ │ │ ├── imetadatadispenserex-findassembly-method.md │ │ │ ├── imetadatadispenserex-findassemblymodule-method.md │ │ │ ├── imetadatadispenserex-getcorsystemdirectory-method.md │ │ │ ├── imetadatadispenserex-getoption-method.md │ │ │ ├── imetadatadispenserex-interface.md │ │ │ ├── imetadatadispenserex-openscopeonitypeinfo-method.md │ │ │ ├── imetadatadispenserex-setoption-method.md │ │ │ ├── imetadataemit-applyeditandcontinue-method.md │ │ │ ├── imetadataemit-definecustomattribute-method.md │ │ │ ├── imetadataemit-defineevent-method.md │ │ │ ├── imetadataemit-definefield-method.md │ │ │ ├── imetadataemit-defineimportmember-method.md │ │ │ ├── imetadataemit-defineimporttype-method.md │ │ │ ├── imetadataemit-definememberref-method.md │ │ │ ├── imetadataemit-definemethod-method.md │ │ │ ├── imetadataemit-definemethodimpl-method.md │ │ │ ├── imetadataemit-definemoduleref-method.md │ │ │ ├── imetadataemit-definenestedtype-method.md │ │ │ ├── imetadataemit-defineparam-method.md │ │ │ ├── imetadataemit-definepermissionset-method.md │ │ │ ├── imetadataemit-definepinvokemap-method.md │ │ │ ├── imetadataemit-defineproperty-method.md │ │ │ ├── imetadataemit-definesecurityattributeset-method.md │ │ │ ├── imetadataemit-definetypedef-method.md │ │ │ ├── imetadataemit-definetyperefbyname-method.md │ │ │ ├── imetadataemit-defineuserstring-method.md │ │ │ ├── imetadataemit-deleteclasslayout-method.md │ │ │ ├── imetadataemit-deletefieldmarshal-method.md │ │ │ ├── imetadataemit-deletepinvokemap-method.md │ │ │ ├── imetadataemit-deletetoken-method.md │ │ │ ├── imetadataemit-getsavesize-method.md │ │ │ ├── imetadataemit-gettokenfromsig-method.md │ │ │ ├── imetadataemit-gettokenfromtypespec-method.md │ │ │ ├── imetadataemit-interface.md │ │ │ ├── imetadataemit-merge-method.md │ │ │ ├── imetadataemit-mergeend-method.md │ │ │ ├── imetadataemit-save-method.md │ │ │ ├── imetadataemit-savetomemory-method.md │ │ │ ├── imetadataemit-savetostream-method.md │ │ │ ├── imetadataemit-setclasslayout-method.md │ │ │ ├── imetadataemit-setcustomattributevalue-method.md │ │ │ ├── imetadataemit-seteventprops-method.md │ │ │ ├── imetadataemit-setfieldmarshal-method.md │ │ │ ├── imetadataemit-setfieldprops-method.md │ │ │ ├── imetadataemit-setfieldrva-method.md │ │ │ ├── imetadataemit-sethandler-method.md │ │ │ ├── imetadataemit-setmethodimplflags-method.md │ │ │ ├── imetadataemit-setmethodprops-method.md │ │ │ ├── imetadataemit-setmoduleprops-method.md │ │ │ ├── imetadataemit-setparamprops-method.md │ │ │ ├── imetadataemit-setparent-method.md │ │ │ ├── imetadataemit-setpermissionsetprops-method.md │ │ │ ├── imetadataemit-setpinvokemap-method.md │ │ │ ├── imetadataemit-setpropertyprops-method.md │ │ │ ├── imetadataemit-setrva-method.md │ │ │ ├── imetadataemit-settypedefprops-method.md │ │ │ ├── imetadataemit-translatesigwithscope-method.md │ │ │ ├── imetadataemit2-definegenericparam-method.md │ │ │ ├── imetadataemit2-definemethodspec-method.md │ │ │ ├── imetadataemit2-getdeltasavesize-method.md │ │ │ ├── imetadataemit2-interface.md │ │ │ ├── imetadataemit2-resetenclog-method.md │ │ │ ├── imetadataemit2-savedelta-method.md │ │ │ ├── imetadataemit2-savedeltatomemory-method.md │ │ │ ├── imetadataemit2-savedeltatostream-method.md │ │ │ ├── imetadataemit2-setgenericparamprops-method.md │ │ │ ├── imetadataerror-interface.md │ │ │ ├── imetadataerror-onerror-method.md │ │ │ ├── imetadatafilter-interface.md │ │ │ ├── imetadatafilter-istokenmarked-method.md │ │ │ ├── imetadatafilter-marktoken-method.md │ │ │ ├── imetadatafilter-unmarkall-method.md │ │ │ ├── imetadataimport-closeenum-method.md │ │ │ ├── imetadataimport-countenum-method.md │ │ │ ├── imetadataimport-enumcustomattributes-method.md │ │ │ ├── imetadataimport-enumevents-method.md │ │ │ ├── imetadataimport-enumfields-method.md │ │ │ ├── imetadataimport-enumfieldswithname-method.md │ │ │ ├── imetadataimport-enuminterfaceimpls-method.md │ │ │ ├── imetadataimport-enummemberrefs-method.md │ │ │ ├── imetadataimport-enummembers-method.md │ │ │ ├── imetadataimport-enummemberswithname-method.md │ │ │ ├── imetadataimport-enummethodimpls-method.md │ │ │ ├── imetadataimport-enummethods-method.md │ │ │ ├── imetadataimport-enummethodsemantics-method.md │ │ │ ├── imetadataimport-enummethodswithname-method.md │ │ │ ├── imetadataimport-enummodulerefs-method.md │ │ │ ├── imetadataimport-enumparams-method.md │ │ │ ├── imetadataimport-enumpermissionsets-method.md │ │ │ ├── imetadataimport-enumproperties-method.md │ │ │ ├── imetadataimport-enumsignatures-method.md │ │ │ ├── imetadataimport-enumtypedefs-method.md │ │ │ ├── imetadataimport-enumtyperefs-method.md │ │ │ ├── imetadataimport-enumtypespecs-method.md │ │ │ ├── imetadataimport-enumunresolvedmethods-method.md │ │ │ ├── imetadataimport-enumuserstrings-method.md │ │ │ ├── imetadataimport-findfield-method.md │ │ │ ├── imetadataimport-findmember-method.md │ │ │ ├── imetadataimport-findmemberref-method.md │ │ │ ├── imetadataimport-findmethod-method.md │ │ │ ├── imetadataimport-findtypedefbyname-method.md │ │ │ ├── imetadataimport-findtyperef-method.md │ │ │ ├── imetadataimport-getclasslayout-method.md │ │ │ ├── imetadataimport-getcustomattributebyname-method.md │ │ │ ├── imetadataimport-getcustomattributeprops-method.md │ │ │ ├── imetadataimport-geteventprops-method.md │ │ │ ├── imetadataimport-getfieldmarshal-method.md │ │ │ ├── imetadataimport-getfieldprops-method.md │ │ │ ├── imetadataimport-getinterfaceimplprops-method.md │ │ │ ├── imetadataimport-getmemberprops-method.md │ │ │ ├── imetadataimport-getmemberrefprops-method.md │ │ │ ├── imetadataimport-getmethodprops-method.md │ │ │ ├── imetadataimport-getmethodsemantics-method.md │ │ │ ├── imetadataimport-getmodulefromscope-method.md │ │ │ ├── imetadataimport-getmodulerefprops-method.md │ │ │ ├── imetadataimport-getnamefromtoken-method.md │ │ │ ├── imetadataimport-getnativecallconvfromsig-method.md │ │ │ ├── imetadataimport-getnestedclassprops-method.md │ │ │ ├── imetadataimport-getparamformethodindex-method.md │ │ │ ├── imetadataimport-getparamprops-method.md │ │ │ ├── imetadataimport-getpermissionsetprops-method.md │ │ │ ├── imetadataimport-getpinvokemap-method.md │ │ │ ├── imetadataimport-getpropertyprops-method.md │ │ │ ├── imetadataimport-getrva-method.md │ │ │ ├── imetadataimport-getscopeprops-method.md │ │ │ ├── imetadataimport-getsigfromtoken-method.md │ │ │ ├── imetadataimport-gettypedefprops-method.md │ │ │ ├── imetadataimport-gettyperefprops-method.md │ │ │ ├── imetadataimport-gettypespecfromtoken-method.md │ │ │ ├── imetadataimport-getuserstring-method.md │ │ │ ├── imetadataimport-interface.md │ │ │ ├── imetadataimport-isglobal-method.md │ │ │ ├── imetadataimport-isvalidtoken-method.md │ │ │ ├── imetadataimport-resetenum-method.md │ │ │ ├── imetadataimport-resolvetyperef-method.md │ │ │ ├── imetadataimport2-enumgenericparamconstraints-method.md │ │ │ ├── imetadataimport2-enumgenericparams-method.md │ │ │ ├── imetadataimport2-enummethodspecs-method.md │ │ │ ├── imetadataimport2-getgenericparamconstraintprops-method.md │ │ │ ├── imetadataimport2-getgenericparamprops-method.md │ │ │ ├── imetadataimport2-getmethodspecprops-method.md │ │ │ ├── imetadataimport2-getpekind-method.md │ │ │ ├── imetadataimport2-getversionstring-method.md │ │ │ ├── imetadataimport2-interface.md │ │ │ ├── imetadatainfo-getfilemapping-method.md │ │ │ ├── imetadatainfo-interface.md │ │ │ ├── imetadatatables-getblob-method.md │ │ │ ├── imetadatatables-getblobheapsize-method.md │ │ │ ├── imetadatatables-getcodedtokeninfo-method.md │ │ │ ├── imetadatatables-getcolumn-method.md │ │ │ ├── imetadatatables-getcolumninfo-method.md │ │ │ ├── imetadatatables-getguid-method.md │ │ │ ├── imetadatatables-getguidheapsize-method.md │ │ │ ├── imetadatatables-getnextblob-method.md │ │ │ ├── imetadatatables-getnextguid-method.md │ │ │ ├── imetadatatables-getnextstring-method.md │ │ │ ├── imetadatatables-getnextuserstring-method.md │ │ │ ├── imetadatatables-getnumtables-method.md │ │ │ ├── imetadatatables-getrow-method.md │ │ │ ├── imetadatatables-getstring-method.md │ │ │ ├── imetadatatables-getstringheapsize-method.md │ │ │ ├── imetadatatables-gettableindex-method.md │ │ │ ├── imetadatatables-gettableinfo-method.md │ │ │ ├── imetadatatables-getuserstring-method.md │ │ │ ├── imetadatatables-getuserstringheapsize-method.md │ │ │ ├── imetadatatables-interface.md │ │ │ ├── imetadatatables2-getmetadatastorage-method.md │ │ │ ├── imetadatatables2-getmetadatastreaminfo-method.md │ │ │ ├── imetadatatables2-interface.md │ │ │ ├── imetadatavalidate-interface.md │ │ │ ├── imetadatavalidate-validatemetadata-method.md │ │ │ ├── imetadatavalidate-validatorinit-method.md │ │ │ ├── index.md │ │ │ ├── metadata-enumerations.md │ │ │ ├── metadata-global-static-functions.md │ │ │ ├── metadata-interfaces.md │ │ │ ├── metadata-structures.md │ │ │ ├── metadata-unions.md │ │ │ ├── osinfo-structure.md │ │ │ └── toc.yml │ │ ├── profiling │ │ │ ├── clr-profilers-and-windows-store-apps.md │ │ │ ├── cor-prf-assembly-reference-info-structure.md │ │ │ ├── cor-prf-clause-type-enumeration.md │ │ │ ├── cor-prf-code-info-structure.md │ │ │ ├── cor-prf-codegen-flags-enumeration.md │ │ │ ├── cor-prf-ex-clause-info-structure.md │ │ │ ├── cor-prf-finalizer-flags-enumeration.md │ │ │ ├── cor-prf-function-argument-info-structure.md │ │ │ ├── cor-prf-function-argument-range-structure.md │ │ │ ├── cor-prf-function-structure.md │ │ │ ├── cor-prf-gc-generation-enumeration.md │ │ │ ├── cor-prf-gc-generation-range-structure.md │ │ │ ├── cor-prf-gc-reason-enumeration.md │ │ │ ├── cor-prf-gc-root-flags-enumeration.md │ │ │ ├── cor-prf-gc-root-kind-enumeration.md │ │ │ ├── cor-prf-high-monitor-enumeration.md │ │ │ ├── cor-prf-jit-cache-enumeration.md │ │ │ ├── cor-prf-misc-enumeration.md │ │ │ ├── cor-prf-module-flags-enumeration.md │ │ │ ├── cor-prf-monitor-enumeration.md │ │ │ ├── cor-prf-rejit-flags-enumeration.md │ │ │ ├── cor-prf-runtime-type-enumeration.md │ │ │ ├── cor-prf-snapshot-info-enumeration.md │ │ │ ├── cor-prf-static-type-enumeration.md │ │ │ ├── cor-prf-suspend-reason-enumeration.md │ │ │ ├── cor-prf-transition-reason-enumeration.md │ │ │ ├── corprof-e-unsupported-call-sequence-hresult.md │ │ │ ├── functionenter-function.md │ │ │ ├── functionenter2-function.md │ │ │ ├── functionenter3-function.md │ │ │ ├── functionenter3withinfo-function.md │ │ │ ├── functionidmapper-function.md │ │ │ ├── functionidmapper2-function.md │ │ │ ├── functionleave-function.md │ │ │ ├── functionleave2-function.md │ │ │ ├── functionleave3-function.md │ │ │ ├── functionleave3withinfo-function.md │ │ │ ├── functiontailcall-function.md │ │ │ ├── functiontailcall2-function.md │ │ │ ├── functiontailcall3-function.md │ │ │ ├── functiontailcall3withinfo-function.md │ │ │ ├── iclrprofiling-attachprofiler-method.md │ │ │ ├── iclrprofiling-interface.md │ │ │ ├── icorprofilerassemblyreferenceprovider-addassemblyreference-method.md │ │ │ ├── icorprofilerassemblyreferenceprovider-interface.md │ │ │ ├── icorprofilercallback-appdomaincreationfinished-method.md │ │ │ ├── icorprofilercallback-appdomaincreationstarted-method.md │ │ │ ├── icorprofilercallback-appdomainshutdownfinished-method.md │ │ │ ├── icorprofilercallback-appdomainshutdownstarted-method.md │ │ │ ├── icorprofilercallback-assemblyloadfinished-method.md │ │ │ ├── icorprofilercallback-assemblyloadstarted-method.md │ │ │ ├── icorprofilercallback-assemblyunloadfinished-method.md │ │ │ ├── icorprofilercallback-assemblyunloadstarted-method.md │ │ │ ├── icorprofilercallback-classloadfinished-method.md │ │ │ ├── icorprofilercallback-classloadstarted-method.md │ │ │ ├── icorprofilercallback-classunloadfinished-method.md │ │ │ ├── icorprofilercallback-classunloadstarted-method.md │ │ │ ├── icorprofilercallback-comclassicvtablecreated-method.md │ │ │ ├── icorprofilercallback-comclassicvtabledestroyed-method.md │ │ │ ├── icorprofilercallback-exceptioncatcherenter-method.md │ │ │ ├── icorprofilercallback-exceptioncatcherleave-method.md │ │ │ ├── icorprofilercallback-exceptionclrcatcherexecute-method.md │ │ │ ├── icorprofilercallback-exceptionclrcatcherfound-method.md │ │ │ ├── icorprofilercallback-exceptionoshandlerenter-method.md │ │ │ ├── icorprofilercallback-exceptionoshandlerleave-method.md │ │ │ ├── icorprofilercallback-exceptionsearchcatcherfound-method.md │ │ │ ├── icorprofilercallback-exceptionsearchfilterenter-method.md │ │ │ ├── icorprofilercallback-exceptionsearchfilterleave-method.md │ │ │ ├── icorprofilercallback-exceptionsearchfunctionenter-method.md │ │ │ ├── icorprofilercallback-exceptionsearchfunctionleave-method.md │ │ │ ├── icorprofilercallback-exceptionthrown-method.md │ │ │ ├── icorprofilercallback-exceptionunwindfinallyenter-method.md │ │ │ ├── icorprofilercallback-exceptionunwindfinallyleave-method.md │ │ │ ├── icorprofilercallback-exceptionunwindfunctionenter-method.md │ │ │ ├── icorprofilercallback-exceptionunwindfunctionleave-method.md │ │ │ ├── icorprofilercallback-functionunloadstarted-method.md │ │ │ ├── icorprofilercallback-initialize-method.md │ │ │ ├── icorprofilercallback-interface.md │ │ │ ├── icorprofilercallback-jitcachedfunctionsearchfinished-method.md │ │ │ ├── icorprofilercallback-jitcachedfunctionsearchstarted-method.md │ │ │ ├── icorprofilercallback-jitcompilationfinished-method.md │ │ │ ├── icorprofilercallback-jitcompilationstarted-method.md │ │ │ ├── icorprofilercallback-jitfunctionpitched-method.md │ │ │ ├── icorprofilercallback-jitinlining-method.md │ │ │ ├── icorprofilercallback-managedtounmanagedtransition-method.md │ │ │ ├── icorprofilercallback-moduleattachedtoassembly-method.md │ │ │ ├── icorprofilercallback-moduleloadfinished-method.md │ │ │ ├── icorprofilercallback-moduleloadstarted-method.md │ │ │ ├── icorprofilercallback-moduleunloadfinished-method.md │ │ │ ├── icorprofilercallback-moduleunloadstarted-method.md │ │ │ ├── icorprofilercallback-movedreferences-method.md │ │ │ ├── icorprofilercallback-objectallocated-method.md │ │ │ ├── icorprofilercallback-objectreferences-method.md │ │ │ ├── icorprofilercallback-objectsallocatedbyclass-method.md │ │ │ ├── icorprofilercallback-remotingclientinvocationfinished-method.md │ │ │ ├── icorprofilercallback-remotingclientinvocationstarted-method.md │ │ │ ├── icorprofilercallback-remotingclientreceivingreply-method.md │ │ │ ├── icorprofilercallback-remotingclientsendingmessage-method.md │ │ │ ├── icorprofilercallback-remotingserverinvocationreturned-method.md │ │ │ ├── icorprofilercallback-remotingserverinvocationstarted-method.md │ │ │ ├── icorprofilercallback-remotingserverreceivingmessage-method.md │ │ │ ├── icorprofilercallback-remotingserversendingreply-method.md │ │ │ ├── icorprofilercallback-rootreferences-method.md │ │ │ ├── icorprofilercallback-runtimeresumefinished-method.md │ │ │ ├── icorprofilercallback-runtimeresumestarted-method.md │ │ │ ├── icorprofilercallback-runtimesuspendaborted-method.md │ │ │ ├── icorprofilercallback-runtimesuspendfinished-method.md │ │ │ ├── icorprofilercallback-runtimesuspendstarted-method.md │ │ │ ├── icorprofilercallback-runtimethreadresumed-method.md │ │ │ ├── icorprofilercallback-runtimethreadsuspended-method.md │ │ │ ├── icorprofilercallback-shutdown-method.md │ │ │ ├── icorprofilercallback-threadassignedtoosthread-method.md │ │ │ ├── icorprofilercallback-threadcreated-method.md │ │ │ ├── icorprofilercallback-threaddestroyed-method.md │ │ │ ├── icorprofilercallback-unmanagedtomanagedtransition-method.md │ │ │ ├── icorprofilercallback2-finalizeableobjectqueued-method.md │ │ │ ├── icorprofilercallback2-garbagecollectionfinished-method.md │ │ │ ├── icorprofilercallback2-garbagecollectionstarted-method.md │ │ │ ├── icorprofilercallback2-handlecreated-method.md │ │ │ ├── icorprofilercallback2-handledestroyed-method.md │ │ │ ├── icorprofilercallback2-interface.md │ │ │ ├── icorprofilercallback2-rootreferences2-method.md │ │ │ ├── icorprofilercallback2-survivingreferences-method.md │ │ │ ├── icorprofilercallback2-threadnamechanged-method.md │ │ │ ├── icorprofilercallback3-initializeforattach-method.md │ │ │ ├── icorprofilercallback3-interface.md │ │ │ ├── icorprofilercallback3-profilerattachcomplete-method.md │ │ │ ├── icorprofilercallback3-profilerdetachsucceeded-method.md │ │ │ ├── icorprofilercallback4-getrejitparameters-method.md │ │ │ ├── icorprofilercallback4-interface.md │ │ │ ├── icorprofilercallback4-movedreferences2-method.md │ │ │ ├── icorprofilercallback4-rejitcompilationfinished-method.md │ │ │ ├── icorprofilercallback4-rejitcompilationstarted-method.md │ │ │ ├── icorprofilercallback4-rejiterror-method.md │ │ │ ├── icorprofilercallback4-survivingreferences2-method.md │ │ │ ├── icorprofilercallback5-conditionalweaktableelementreferences-method.md │ │ │ ├── icorprofilercallback5-interface.md │ │ │ ├── icorprofilercallback6-getassemblyreferences-method.md │ │ │ ├── icorprofilercallback6-interface.md │ │ │ ├── icorprofilercallback7-interface.md │ │ │ ├── icorprofilercallback7-moduleinmemorysymbolsupdated-method.md │ │ │ ├── icorprofilercallback8-dynamicmethodjitcompilationfinished-method.md │ │ │ ├── icorprofilercallback8-dynamicmethodjitcompilationstarted-method.md │ │ │ ├── icorprofilercallback8-interface.md │ │ │ ├── icorprofilercallback9-dynamicmethodunloaded-method.md │ │ │ ├── icorprofilercallback9-interface.md │ │ │ ├── icorprofilerfunctioncontrol-interface.md │ │ │ ├── icorprofilerfunctioncontrol-setcodegenflags-method.md │ │ │ ├── icorprofilerfunctioncontrol-setilfunctionbody-method.md │ │ │ ├── icorprofilerfunctioncontrol-setilinstrumentedcodemap-method.md │ │ │ ├── icorprofilerfunctionenum-clone-method.md │ │ │ ├── icorprofilerfunctionenum-getcount-method.md │ │ │ ├── icorprofilerfunctionenum-interface.md │ │ │ ├── icorprofilerfunctionenum-next-method.md │ │ │ ├── icorprofilerfunctionenum-reset-method.md │ │ │ ├── icorprofilerfunctionenum-skip-method.md │ │ │ ├── icorprofilerinfo-begininprocdebugging-method.md │ │ │ ├── icorprofilerinfo-endinprocdebugging-method.md │ │ │ ├── icorprofilerinfo-forcegc-method.md │ │ │ ├── icorprofilerinfo-getappdomaininfo-method.md │ │ │ ├── icorprofilerinfo-getassemblyinfo-method.md │ │ │ ├── icorprofilerinfo-getclassfromobject-method.md │ │ │ ├── icorprofilerinfo-getclassfromtoken-method.md │ │ │ ├── icorprofilerinfo-getclassidinfo-method.md │ │ │ ├── icorprofilerinfo-getcodeinfo-method.md │ │ │ ├── icorprofilerinfo-getcurrentthreadid-method.md │ │ │ ├── icorprofilerinfo-geteventmask-method.md │ │ │ ├── icorprofilerinfo-getfunctionfromip-method.md │ │ │ ├── icorprofilerinfo-getfunctionfromtoken-method.md │ │ │ ├── icorprofilerinfo-getfunctioninfo-method.md │ │ │ ├── icorprofilerinfo-gethandlefromthread-method.md │ │ │ ├── icorprofilerinfo-getilfunctionbody-method.md │ │ │ ├── icorprofilerinfo-getilfunctionbodyallocator-method.md │ │ │ ├── icorprofilerinfo-getiltonativemapping-method.md │ │ │ ├── icorprofilerinfo-getinprocinspectioninterface-method.md │ │ │ ├── icorprofilerinfo-getinprocinspectionithisthread-method.md │ │ │ ├── icorprofilerinfo-getmoduleinfo-method.md │ │ │ ├── icorprofilerinfo-getmodulemetadata-method.md │ │ │ ├── icorprofilerinfo-getobjectsize-method.md │ │ │ ├── icorprofilerinfo-getthreadcontext-method.md │ │ │ ├── icorprofilerinfo-getthreadinfo-method.md │ │ │ ├── icorprofilerinfo-gettokenandmetadatafromfunction-method.md │ │ │ ├── icorprofilerinfo-interface.md │ │ │ ├── icorprofilerinfo-isarrayclass-method.md │ │ │ ├── icorprofilerinfo-setenterleavefunctionhooks-method.md │ │ │ ├── icorprofilerinfo-seteventmask-method.md │ │ │ ├── icorprofilerinfo-setfunctionidmapper-method.md │ │ │ ├── icorprofilerinfo-setfunctionrejit-method.md │ │ │ ├── icorprofilerinfo-setilfunctionbody-method.md │ │ │ ├── icorprofilerinfo-setilinstrumentedcodemap-method.md │ │ │ ├── icorprofilerinfo10-enumerateobjectreferences-method.md │ │ │ ├── icorprofilerinfo10-getlohobjectsizethreshold-method.md │ │ │ ├── icorprofilerinfo10-interface.md │ │ │ ├── icorprofilerinfo10-isfrozenobject-method.md │ │ │ ├── icorprofilerinfo10-requestrejitwithinliners-method.md │ │ │ ├── icorprofilerinfo10-resumeruntime-method.md │ │ │ ├── icorprofilerinfo10-suspendruntime-method.md │ │ │ ├── icorprofilerinfo2-dostacksnapshot-method.md │ │ │ ├── icorprofilerinfo2-enummodulefrozenobjects-method.md │ │ │ ├── icorprofilerinfo2-getappdomainstaticaddress-method.md │ │ │ ├── icorprofilerinfo2-getarrayobjectinfo-method.md │ │ │ ├── icorprofilerinfo2-getboxclasslayout-method.md │ │ │ ├── icorprofilerinfo2-getclassfromtokenandtypeargs-method.md │ │ │ ├── icorprofilerinfo2-getclassidinfo2-method.md │ │ │ ├── icorprofilerinfo2-getclasslayout-method.md │ │ │ ├── icorprofilerinfo2-getcodeinfo2-method.md │ │ │ ├── icorprofilerinfo2-getcontextstaticaddress-method.md │ │ │ ├── icorprofilerinfo2-getfunctionfromtokenandtypeargs-method.md │ │ │ ├── icorprofilerinfo2-getfunctioninfo2-method.md │ │ │ ├── icorprofilerinfo2-getgenerationbounds-method.md │ │ │ ├── icorprofilerinfo2-getnotifiedexceptionclauseinfo-method.md │ │ │ ├── icorprofilerinfo2-getobjectgeneration-method.md │ │ │ ├── icorprofilerinfo2-getrvastaticaddress-method.md │ │ │ ├── icorprofilerinfo2-getstaticfieldinfo-method.md │ │ │ ├── icorprofilerinfo2-getstringlayout-method.md │ │ │ ├── icorprofilerinfo2-getthreadappdomain-method.md │ │ │ ├── icorprofilerinfo2-getthreadstaticaddress-method.md │ │ │ ├── icorprofilerinfo2-interface.md │ │ │ ├── icorprofilerinfo2-setenterleavefunctionhooks2-method.md │ │ │ ├── icorprofilerinfo3-enumjitedfunctions-method.md │ │ │ ├── icorprofilerinfo3-enummodules-method.md │ │ │ ├── icorprofilerinfo3-getappdomainscontainingmodule-method.md │ │ │ ├── icorprofilerinfo3-getfunctionenter3info-method.md │ │ │ ├── icorprofilerinfo3-getfunctionleave3info-method.md │ │ │ ├── icorprofilerinfo3-getfunctiontailcall3info-method.md │ │ │ ├── icorprofilerinfo3-getmoduleinfo2-method.md │ │ │ ├── icorprofilerinfo3-getruntimeinformation-method.md │ │ │ ├── icorprofilerinfo3-getstringlayout2-method.md │ │ │ ├── icorprofilerinfo3-getthreadstaticaddress2-method.md │ │ │ ├── icorprofilerinfo3-interface.md │ │ │ ├── icorprofilerinfo3-requestprofilerdetach-method.md │ │ │ ├── icorprofilerinfo3-setenterleavefunctionhooks3-method.md │ │ │ ├── icorprofilerinfo3-setenterleavefunctionhooks3withinfo-method.md │ │ │ ├── icorprofilerinfo3-setfunctionidmapper2-method.md │ │ │ ├── icorprofilerinfo4-enumjitedfunctions2-method.md │ │ │ ├── icorprofilerinfo4-enumthreads-method.md │ │ │ ├── icorprofilerinfo4-getcodeinfo3-method.md │ │ │ ├── icorprofilerinfo4-getfunctionfromip2-method.md │ │ │ ├── icorprofilerinfo4-getiltonativemapping2-method.md │ │ │ ├── icorprofilerinfo4-getobjectsize2-method.md │ │ │ ├── icorprofilerinfo4-getrejitids-method.md │ │ │ ├── icorprofilerinfo4-initializecurrentthread-method.md │ │ │ ├── icorprofilerinfo4-interface.md │ │ │ ├── icorprofilerinfo4-requestrejit-method.md │ │ │ ├── icorprofilerinfo4-requestrevert-method.md │ │ │ ├── icorprofilerinfo5-geteventmask2-method.md │ │ │ ├── icorprofilerinfo5-interface.md │ │ │ ├── icorprofilerinfo5-seteventmask2-method.md │ │ │ ├── icorprofilerinfo6-enumngenmodulemethodsinliningthismethod-method.md │ │ │ ├── icorprofilerinfo6-interface.md │ │ │ ├── icorprofilerinfo7-applymetadata-method.md │ │ │ ├── icorprofilerinfo7-getinmemorysymbolslength-method.md │ │ │ ├── icorprofilerinfo7-interface.md │ │ │ ├── icorprofilerinfo7-readinmemorysymbols.md │ │ │ ├── icorprofilerinfo8-getdynamicfunctioninfo-method.md │ │ │ ├── icorprofilerinfo8-getfunctionfromip3-method.md │ │ │ ├── icorprofilerinfo8-interface.md │ │ │ ├── icorprofilerinfo8-isfunctiondynamic-method.md │ │ │ ├── icorprofilerinfo9-getcodeinfo4-method.md │ │ │ ├── icorprofilerinfo9-getiltonativemapping3-method.md │ │ │ ├── icorprofilerinfo9-getnativecodestartaddresses-method.md │ │ │ ├── icorprofilerinfo9-interface.md │ │ │ ├── icorprofilermoduleenum-clone-method.md │ │ │ ├── icorprofilermoduleenum-getcount-method.md │ │ │ ├── icorprofilermoduleenum-interface.md │ │ │ ├── icorprofilermoduleenum-next-method.md │ │ │ ├── icorprofilermoduleenum-reset-method.md │ │ │ ├── icorprofilermoduleenum-skip-method.md │ │ │ ├── icorprofilerobjectenum-clone-method.md │ │ │ ├── icorprofilerobjectenum-getcount-method.md │ │ │ ├── icorprofilerobjectenum-interface.md │ │ │ ├── icorprofilerobjectenum-next-method.md │ │ │ ├── icorprofilerobjectenum-reset-method.md │ │ │ ├── icorprofilerobjectenum-skip-method.md │ │ │ ├── icorprofilerthreadenum-clone-method.md │ │ │ ├── icorprofilerthreadenum-getcount-method.md │ │ │ ├── icorprofilerthreadenum-interface.md │ │ │ ├── icorprofilerthreadenum-next-method.md │ │ │ ├── icorprofilerthreadenum-reset-method.md │ │ │ ├── icorprofilerthreadenum-skip-method.md │ │ │ ├── imethodmalloc-alloc-method.md │ │ │ ├── imethodmalloc-interface.md │ │ │ ├── index.md │ │ │ ├── media │ │ │ │ └── profiling-overview │ │ │ │ │ └── profiling-architecture.png │ │ │ ├── profiling-enumerations.md │ │ │ ├── profiling-global-static-functions.md │ │ │ ├── profiling-interfaces.md │ │ │ ├── profiling-overview.md │ │ │ ├── profiling-structures.md │ │ │ ├── setting-up-a-profiling-environment.md │ │ │ ├── stacksnapshotcallback-function.md │ │ │ └── toc.yml │ │ ├── strong-naming │ │ │ ├── gethashfromassemblyfile-function.md │ │ │ ├── gethashfromassemblyfilew-function.md │ │ │ ├── gethashfromblob-function.md │ │ │ ├── gethashfromfile-function.md │ │ │ ├── gethashfromfilew-function.md │ │ │ ├── gethashfromhandle-function.md │ │ │ ├── index.md │ │ │ ├── publickeyblob-structure.md │ │ │ ├── strongnamecompareassemblies-function.md │ │ │ ├── strongnameerrorinfo-function.md │ │ │ ├── strongnamefreebuffer-function.md │ │ │ ├── strongnamegetblob-function.md │ │ │ ├── strongnamegetblobfromimage-function.md │ │ │ ├── strongnamegetpublickey-function.md │ │ │ ├── strongnamehashsize-function.md │ │ │ ├── strongnamekeydelete-function.md │ │ │ ├── strongnamekeygen-function.md │ │ │ ├── strongnamekeygenex-function.md │ │ │ ├── strongnamekeyinstall-function.md │ │ │ ├── strongnamesignaturegeneration-function.md │ │ │ ├── strongnamesignaturegenerationex-function.md │ │ │ ├── strongnamesignaturesize-function.md │ │ │ ├── strongnamesignatureverification-function.md │ │ │ ├── strongnamesignatureverificationex-function.md │ │ │ ├── strongnamesignatureverificationfromimage-function.md │ │ │ ├── strongnametokenfromassembly-function.md │ │ │ ├── strongnametokenfromassemblyex-function.md │ │ │ ├── strongnametokenfrompublickey-function.md │ │ │ └── toc.yml │ │ ├── tlbexp │ │ │ ├── gettypelibinfo-function.md │ │ │ ├── index.md │ │ │ ├── itypelibresolver-interface.md │ │ │ ├── loadtypelibwithresolver-function.md │ │ │ ├── resolvetypelib-method.md │ │ │ └── toc.yml │ │ ├── toc.yml │ │ └── wmi │ │ │ ├── beginenumeration.md │ │ │ ├── beginmethodenumeration.md │ │ │ ├── blessiwbemservices.md │ │ │ ├── blessiwbemservicesobject.md │ │ │ ├── clone.md │ │ │ ├── cloneenumwbemclassobject.md │ │ │ ├── compareto.md │ │ │ ├── connectserverwmi.md │ │ │ ├── createclassenumwmi.md │ │ │ ├── createinstanceenumwmi.md │ │ │ ├── delete.md │ │ │ ├── deletemethod.md │ │ │ ├── endenumeration.md │ │ │ ├── endmethodenumeration.md │ │ │ ├── execnotificationquerywmi.md │ │ │ ├── execquerywmi.md │ │ │ ├── formatfromrawvalue.md │ │ │ ├── get.md │ │ │ ├── getcurrentapartmenttype.md │ │ │ ├── getdemultiplexedstub.md │ │ │ ├── geterrorinfo.md │ │ │ ├── getmethod.md │ │ │ ├── getmethodorigin.md │ │ │ ├── getmethodqualifierset.md │ │ │ ├── getnames.md │ │ │ ├── getobjecttext.md │ │ │ ├── getpropertyhandle.md │ │ │ ├── getpropertyorigin.md │ │ │ ├── getpropertyqualifierset.md │ │ │ ├── getqualifierset.md │ │ │ ├── index.md │ │ │ ├── inheritsfrom.md │ │ │ ├── initialize.md │ │ │ ├── next.md │ │ │ ├── nextmethod.md │ │ │ ├── put.md │ │ │ ├── putclasswmi.md │ │ │ ├── putinstancewmi.md │ │ │ ├── putmethod.md │ │ │ ├── qualifierset-beginenumeration.md │ │ │ ├── qualifierset-delete.md │ │ │ ├── qualifierset-endenumeration.md │ │ │ ├── qualifierset-get.md │ │ │ ├── qualifierset-getnames.md │ │ │ ├── qualifierset-next.md │ │ │ ├── qualifierset-put.md │ │ │ ├── resetsecurity.md │ │ │ ├── setsecurity.md │ │ │ ├── spawnderivedclass.md │ │ │ ├── spawninstance.md │ │ │ ├── toc.yml │ │ │ ├── verifyclientkey.md │ │ │ └── writepropertyvalue.md │ ├── wcf │ │ ├── accessing-services-using-a-wcf-client.md │ │ ├── add-service-reference-in-a-portable-subset-project.md │ │ ├── architecture.md │ │ ├── basic-programming-lifecycle.md │ │ ├── basic-wcf-programming.md │ │ ├── best-practices-data-contract-versioning.md │ │ ├── best-practices-intermediaries.md │ │ ├── bindings-overview.md │ │ ├── bindings.md │ │ ├── building-clients.md │ │ ├── com-service-model-configuration-tool-comsvcconfig-exe.md │ │ ├── conceptual-overview.md │ │ ├── configuration-editor-tool-svcconfigeditor-exe.md │ │ ├── configuring-bindings-for-wcf-services.md │ │ ├── configuring-client-behaviors.md │ │ ├── configuring-services-using-configuration-files.md │ │ ├── configuring-services.md │ │ ├── configuring-wcf-services-in-code.md │ │ ├── contract-first-tool.md │ │ ├── controlling-auto-launching-of-wcf-service-host.md │ │ ├── controlling-resource-consumption-and-improving-performance.md │ │ ├── creating-ws-i-basic-profile-1-1-interoperable-services.md │ │ ├── defining-and-specifying-faults.md │ │ ├── deploying-a-wcf-library-project.md │ │ ├── deploying-wcf-applications-with-clickonce.md │ │ ├── designing-and-implementing-services.md │ │ ├── designing-service-contracts.md │ │ ├── diagnostics │ │ │ ├── configuring-message-logging.md │ │ │ ├── configuring-your-application.md │ │ │ ├── deploying-services.md │ │ │ ├── etw │ │ │ │ ├── 131-bufferpoolallocation.md │ │ │ │ ├── 132-bufferpoolchangequota.md │ │ │ │ ├── 133-actionitemscheduled.md │ │ │ │ ├── 134-actionitemcallbackinvoked.md │ │ │ │ ├── 1400-channelinitializationtimeout.md │ │ │ │ ├── 1401-closetimeout.md │ │ │ │ ├── 1402-idletimeout.md │ │ │ │ ├── 1403-leasetimeout.md │ │ │ │ ├── 1405-opentimeout.md │ │ │ │ ├── 1406-receivetimeout.md │ │ │ │ ├── 1407-sendtimeout.md │ │ │ │ ├── 1409-inactivitytimeout.md │ │ │ │ ├── 1416-maxreceivedmessagesizeexceeded.md │ │ │ │ ├── 1417-maxsentmessagesizeexceeded.md │ │ │ │ ├── 1418-maxoutboundconnectionsperendpointexceeded.md │ │ │ │ ├── 1419-maxpendingconnectionsexceeded.md │ │ │ │ ├── 1420-readerquotaexceeded.md │ │ │ │ ├── 1422-negotiatetokenauthenticatorstatecacheexceeded.md │ │ │ │ ├── 1423-negotiatetokenauthenticatorstatecacheratio.md │ │ │ │ ├── 1424-securitysessionratio.md │ │ │ │ ├── 1430-pendingconnectionsratio.md │ │ │ │ ├── 1431-concurrentcallsratio.md │ │ │ │ ├── 1432-concurrentsessionsratio.md │ │ │ │ ├── 1433-outboundconnectionsperendpointratio.md │ │ │ │ ├── 1436-pendingmessagesperchannelratio.md │ │ │ │ ├── 1438-concurrentinstancesratio.md │ │ │ │ ├── 1439-pendingacceptsatzero.md │ │ │ │ ├── 1441-maxsessionsizereached.md │ │ │ │ ├── 1442-receiveretrycountreached.md │ │ │ │ ├── 1443-maxretrycyclesexceededmsmq.md │ │ │ │ ├── 1445-readpoolmiss.md │ │ │ │ ├── 1446-writepoolmiss.md │ │ │ │ ├── 1451-maxretrycyclesexceeded.md │ │ │ │ ├── 201-clientmessageinspectorafterreceiveinvoked.md │ │ │ │ ├── 202-clientmessageinspectorbeforesendinvoked.md │ │ │ │ ├── 203-clientparameterinspectoraftercallinvoked.md │ │ │ │ ├── 204-clientparameterinspectorbeforecallinvoked.md │ │ │ │ ├── 205-operationinvoked.md │ │ │ │ ├── 206-errorhandlerinvoked.md │ │ │ │ ├── 207-faultproviderinvoked.md │ │ │ │ ├── 208-messageinspectorafterreceiveinvoked.md │ │ │ │ ├── 209-messageinspectorbeforesendinvoked.md │ │ │ │ ├── 210-messagethrottleexceeded.md │ │ │ │ ├── 211-parameterinspectoraftercallinvoked.md │ │ │ │ ├── 212-parameterinspectorbeforecallinvoked.md │ │ │ │ ├── 213-servicehoststarted.md │ │ │ │ ├── 214-operationcompleted.md │ │ │ │ ├── 215-messagereceivedbytransport.md │ │ │ │ ├── 216-messagesentbytransport.md │ │ │ │ ├── 217-clientoperationprepared.md │ │ │ │ ├── 218-clientoperationcompleted.md │ │ │ │ ├── 219-serviceexception.md │ │ │ │ ├── 220-messagesenttotransport.md │ │ │ │ ├── 221-messagereceivedfromtransport.md │ │ │ │ ├── 222-operationfailed.md │ │ │ │ ├── 223-operationfaulted.md │ │ │ │ ├── 224-messagethrottleatseventypercent.md │ │ │ │ ├── 226-idleservicesclosed.md │ │ │ │ ├── 301-userdefinederroroccurred.md │ │ │ │ ├── 302-userdefinedwarningoccurred.md │ │ │ │ ├── 303-userdefinedinformationeventoccured.md │ │ │ │ ├── 3300-receivecontextcompletefailed.md │ │ │ │ ├── 3301-receivecontextabandonfailed.md │ │ │ │ ├── 3302-receivecontextfaulted.md │ │ │ │ ├── 3303-receivecontextabandonwithexception.md │ │ │ │ ├── 3305-clientbasecachedchannelfactorycount.md │ │ │ │ ├── 3306-clientbasechannelfactoryagedoutofcache.md │ │ │ │ ├── 3307-clientbasechannelfactorycachehit.md │ │ │ │ ├── 3308-clientbaseusinglocalchannelfactory.md │ │ │ │ ├── 3309-querycompositionexecuted.md │ │ │ │ ├── 3310-dispatchfailed.md │ │ │ │ ├── 3311-dispatchsuccessful.md │ │ │ │ ├── 3312-messagereadbyencoder.md │ │ │ │ ├── 3313-messagewrittenbyencoder.md │ │ │ │ ├── 3314-sessionidletimeout.md │ │ │ │ ├── 3319-socketacceptenqueued.md │ │ │ │ ├── 3320-socketaccepted.md │ │ │ │ ├── 3321-connectionpoolmiss.md │ │ │ │ ├── 3322-dispatchformatterdeserializerequeststart.md │ │ │ │ ├── 3323-dispatchformatterdeserializerequeststop.md │ │ │ │ ├── 3324-dispatchformatterserializereplystart.md │ │ │ │ ├── 3325-dispatchformatterserializereplystop.md │ │ │ │ ├── 3326-clientformatterserializerequeststart.md │ │ │ │ ├── 3327-clientformatterserializerequeststop.md │ │ │ │ ├── 3328-clientformatterdeserializereplystart.md │ │ │ │ ├── 3329-clientformatterdeserializereplystop.md │ │ │ │ ├── 3330-securitynegotiationstart.md │ │ │ │ ├── 3331-securitynegotiationstop.md │ │ │ │ ├── 3332-securitytokenprovideropened.md │ │ │ │ ├── 3333-outgoingmessagesecured.md │ │ │ │ ├── 3334-incomingmessageverified.md │ │ │ │ ├── 3335-getserviceinstancestart.md │ │ │ │ ├── 3336-getserviceinstancestop.md │ │ │ │ ├── 3337-channelreceivestart.md │ │ │ │ ├── 3338-channelreceivestop.md │ │ │ │ ├── 3339-channelfactorycreated.md │ │ │ │ ├── 3340-pipeconnectionacceptstart.md │ │ │ │ ├── 3341-pipeconnectionacceptstop.md │ │ │ │ ├── 3342-establishconnectionstart.md │ │ │ │ ├── 3343-establishconnectionstop.md │ │ │ │ ├── 3345-sessionpreambleunderstood.md │ │ │ │ ├── 3346-connectionreadersendfault.md │ │ │ │ ├── 3347-socketacceptclosed.md │ │ │ │ ├── 3348-servicehostfaulted.md │ │ │ │ ├── 3349-listeneropenstart.md │ │ │ │ ├── 3350-listeneropenstop.md │ │ │ │ ├── 3351-servermaxpooledconnectionsquotareached.md │ │ │ │ ├── 3352-tcpconnectiontimedout.md │ │ │ │ ├── 3353-tcpconnectionreseterror.md │ │ │ │ ├── 3354-servicesecuritynegotiationcompleted.md │ │ │ │ ├── 3355-securitynegotiationprocessingfailure.md │ │ │ │ ├── 3356-securityidentityverificationsuccess.md │ │ │ │ ├── 3357-securityidentityverificationfailure.md │ │ │ │ ├── 3358-portsharingduplicatedsocket.md │ │ │ │ ├── 3359-securityimpersonationsuccess.md │ │ │ │ ├── 3360-securityimpersonationfailure.md │ │ │ │ ├── 3361-httpchannelrequestaborted.md │ │ │ │ ├── 3362-httpchannelresponseaborted.md │ │ │ │ ├── 3363-httpauthfailed.md │ │ │ │ ├── 3364-sharedlistenerproxyregisterstart.md │ │ │ │ ├── 3365-sharedlistenerproxyregisterstop.md │ │ │ │ ├── 3366-sharedlistenerproxyregisterfailed.md │ │ │ │ ├── 3367-connectionpoolpreamblefailed.md │ │ │ │ ├── 3368-ssloninitiateupgrade.md │ │ │ │ ├── 3369-sslonacceptupgrade.md │ │ │ │ ├── 3370-binarymessageencodingstart.md │ │ │ │ ├── 3371-mtommessageencodingstart.md │ │ │ │ ├── 3372-textmessageencodingstart.md │ │ │ │ ├── 3373-binarymessagedecodingstart.md │ │ │ │ ├── 3374-mtommessagedecodingstart.md │ │ │ │ ├── 3375-textmessagedecodingstart.md │ │ │ │ ├── 3376-httpresponsereceivestart.md │ │ │ │ ├── 3377-socketreadstop.md │ │ │ │ ├── 3378-socketasyncreadstop.md │ │ │ │ ├── 3379-socketwritestart.md │ │ │ │ ├── 3380-socketasyncwritestart.md │ │ │ │ ├── 3381-sequenceacknowledgementsent.md │ │ │ │ ├── 3382-clientreliablesessionreconnect.md │ │ │ │ ├── 3383-reliablesessionchannelfaulted.md │ │ │ │ ├── 3384-windowsstreamsecurityoninitiateupgrade.md │ │ │ │ ├── 3385-windowsstreamsecurityonacceptupgrade.md │ │ │ │ ├── 3386-socketconnectionabort.md │ │ │ │ ├── 3388-httpgetcontextstart.md │ │ │ │ ├── 3389-clientsendpreamblestart.md │ │ │ │ ├── 3390-clientsendpreamblestop.md │ │ │ │ ├── 3391-httpmessagereceivefailed.md │ │ │ │ ├── 3392-transactionscopecreate.md │ │ │ │ ├── 3393-streamedmessagereadbyencoder.md │ │ │ │ ├── 3394-streamedmessagewrittenbyencoder.md │ │ │ │ ├── 3395-messagewrittenasynchronouslybyencoder.md │ │ │ │ ├── 3396-bufferedasyncwritestart.md │ │ │ │ ├── 3397-bufferedasyncwritestop.md │ │ │ │ ├── 3398-pipesharedmemorycreated.md │ │ │ │ ├── 3399-namedpipecreated.md │ │ │ │ ├── 3401-signatureverificationstart.md │ │ │ │ ├── 3402-signatureverificationsuccess.md │ │ │ │ ├── 3403-wrappedkeydecryptionstart.md │ │ │ │ ├── 3404-wrappedkeydecryptionsuccess.md │ │ │ │ ├── 3405-encrypteddataprocessingstart.md │ │ │ │ ├── 3406-encrypteddataprocessingsuccess.md │ │ │ │ ├── 3407-httppipelineprocessinboundrequeststart.md │ │ │ │ ├── 3408-httppipelinebeginprocessinboundrequeststart.md │ │ │ │ ├── 3409-httppipelineprocessinboundrequeststop.md │ │ │ │ ├── 3410-httppipelinefaulted.md │ │ │ │ ├── 3411-httppipelinetimeoutexception.md │ │ │ │ ├── 3412-httppipelineprocessresponsestart.md │ │ │ │ ├── 3413-httppipelinebeginprocessresponsestart.md │ │ │ │ ├── 3414-httppipelineprocessresponsestop.md │ │ │ │ ├── 3415-websocketconnectionrequestsendstart.md │ │ │ │ ├── 3416-websocketconnectionrequestsendstop.md │ │ │ │ ├── 3417-websocketconnectionacceptstart.md │ │ │ │ ├── 3418-websocketconnectionaccepted.md │ │ │ │ ├── 3419-websocketconnectiondeclined.md │ │ │ │ ├── 3420-websocketconnectionfailed.md │ │ │ │ ├── 3421-websocketconnectionaborted.md │ │ │ │ ├── 3422-websocketasyncwritestart.md │ │ │ │ ├── 3423-websocketasyncwritestop.md │ │ │ │ ├── 3424-websocketasyncreadstart.md │ │ │ │ ├── 3425-websocketasyncreadstop.md │ │ │ │ ├── 3426-websocketclosesent.md │ │ │ │ ├── 3427-websocketcloseoutputsent.md │ │ │ │ ├── 3428-websocketconnectionclosed.md │ │ │ │ ├── 3429-websocketclosestatusreceived.md │ │ │ │ ├── 3430-websocketuseversionfromclientwebsocketfactory.md │ │ │ │ ├── 3431-websocketcreateclientwebsocketwithfactory.md │ │ │ │ ├── 3553-xamlservicesloadstart.md │ │ │ │ ├── 3554-xamlservicesloadstop.md │ │ │ │ ├── 3555-createworkflowservicehoststart.md │ │ │ │ ├── 3556-createworkflowservicehoststop.md │ │ │ │ ├── 3558-serviceactivationstart.md │ │ │ │ ├── 3559-serviceactivationstop.md │ │ │ │ ├── 3560-serviceactivationavailablememory.md │ │ │ │ ├── 3800-routingserviceclosingclient.md │ │ │ │ ├── 3801-routingservicechannelfaulted.md │ │ │ │ ├── 3802-routingservicecompletingoneway.md │ │ │ │ ├── 3803-routingserviceprocessingfailure.md │ │ │ │ ├── 3804-routingservicecreatingclientforendpoint.md │ │ │ │ ├── 3805-routingservicedisplayconfig.md │ │ │ │ ├── 3807-routingservicecompletingtwoway.md │ │ │ │ ├── 3809-routingservicemessageroutedtoendpoints.md │ │ │ │ ├── 3810-routingserviceconfigurationapplied.md │ │ │ │ ├── 3815-routingserviceprocessingmessage.md │ │ │ │ ├── 3816-routingservicetransmittingmessage.md │ │ │ │ ├── 3817-routingservicecommittingtransaction.md │ │ │ │ ├── 3818-routingserviceduplexcallbackexception.md │ │ │ │ ├── 3819-routingservicemovedtobackup.md │ │ │ │ ├── 3820-routingservicecreatingtransaction.md │ │ │ │ ├── 3821-routingserviceclosefailed.md │ │ │ │ ├── 3822-routingservicesendingresponse.md │ │ │ │ ├── 3823-routingservicesendingfaultresponse.md │ │ │ │ ├── 3824-routingservicecompletingreceivecontext.md │ │ │ │ ├── 3825-routingserviceabandoningreceivecontext.md │ │ │ │ ├── 3826-routingserviceusingexistingtransaction.md │ │ │ │ ├── 3827-routingservicetransmitfailed.md │ │ │ │ ├── 3828-routingservicefiltertablematchstart.md │ │ │ │ ├── 3829-routingservicefiltertablematchstop.md │ │ │ │ ├── 3830-routingserviceabortingchannel.md │ │ │ │ ├── 3831-routingservicehandledexception.md │ │ │ │ ├── 3832-routingservicetransmitsucceeded.md │ │ │ │ ├── 4001-transportlistenersessionsreceived.md │ │ │ │ ├── 4002-failfastexception.md │ │ │ │ ├── 4003-servicestartpipeerror.md │ │ │ │ ├── 4008-dispatchsessionstart.md │ │ │ │ ├── 401-stopsignpostevent.md │ │ │ │ ├── 4010-pendingsessionqueuefull.md │ │ │ │ ├── 4011-messagequeueregisterstart.md │ │ │ │ ├── 4012-messagequeueregisterabort.md │ │ │ │ ├── 4013-messagequeueunregistersucceeded.md │ │ │ │ ├── 4014-messagequeueregisterfailed.md │ │ │ │ ├── 4015-messagequeueregistercompleted.md │ │ │ │ ├── 4016-messagequeueduplicatedsocketerror.md │ │ │ │ ├── 4019-messagequeueduplicatedsocketcomplete.md │ │ │ │ ├── 402-startsignpostevent.md │ │ │ │ ├── 4020-tcptransportlistenerlisteningstart.md │ │ │ │ ├── 4021-tcptransportlistenerlisteningstop.md │ │ │ │ ├── 4022-webhostunregisterprotocolfailed.md │ │ │ │ ├── 4023-wasclosealllistenerchannelinstancescompleted.md │ │ │ │ ├── 4024-wasclosealllistenerchannelinstancesfailed.md │ │ │ │ ├── 4025-openlistenerchannelinstancefailed.md │ │ │ │ ├── 4026-wasconnected.md │ │ │ │ ├── 4027-wasdisconnected.md │ │ │ │ ├── 4028-pipetransportlistenerlisteningstart.md │ │ │ │ ├── 4029-pipetransportlistenerlisteningstop.md │ │ │ │ ├── 403-suspendsignpostevent.md │ │ │ │ ├── 4030-dispatchsessionsuccess.md │ │ │ │ ├── 4031-dispatchsessionfailed.md │ │ │ │ ├── 4032-wasconnectiontimedout.md │ │ │ │ ├── 4033-routingtablelookupstart.md │ │ │ │ ├── 4034-routingtablelookupstop.md │ │ │ │ ├── 4035-pendingsessionqueueratio.md │ │ │ │ ├── 404-resumesignpostevent.md │ │ │ │ ├── 451-messageloginfo.md │ │ │ │ ├── 452-messagelogwarning.md │ │ │ │ ├── 4600-messagelogeventsizeexceeded.md │ │ │ │ ├── 4801-discoveryclientinclientchannelfailedtoclose.md │ │ │ │ ├── 4802-discoveryclientprotocolexceptionsuppressed.md │ │ │ │ ├── 4803-discoveryclientreceivedmulticastsuppression.md │ │ │ │ ├── 4804-discoverymessagereceivedafteroperationcompleted.md │ │ │ │ ├── 4805-discoverymessagewithinvalidcontent.md │ │ │ │ ├── 4806-discoverymessagewithinvalidrelatestooroperationcompleted.md │ │ │ │ ├── 4807-discoverymessagewithinvalidreplyto.md │ │ │ │ ├── 4808-discoverymessagewithnocontent.md │ │ │ │ ├── 4809-discoverymessagewithnullmessageid.md │ │ │ │ ├── 4810-discoverymessagewithnullmessagesequence.md │ │ │ │ ├── 4811-discoverymessagewithnullrelatesto.md │ │ │ │ ├── 4812-discoverymessagewithnullreplyto.md │ │ │ │ ├── 4813-duplicatediscoverymessage.md │ │ │ │ ├── 4814-endpointdiscoverabilitydisabled.md │ │ │ │ ├── 4815-endpointdiscoverabilityenabled.md │ │ │ │ ├── 4816-findinitiatedindiscoveryclientchannel.md │ │ │ │ ├── 4817-innerchannelcreationfailed.md │ │ │ │ ├── 4818-innerchannelopenfailed.md │ │ │ │ ├── 4819-innerchannelopensucceeded.md │ │ │ │ ├── 4820-synchronizationcontextreset.md │ │ │ │ ├── 4821-synchronizationcontextsettonull.md │ │ │ │ ├── 499-transferemitted.md │ │ │ │ ├── 5001-dcserializewithsurrogatestart.md │ │ │ │ ├── 5002-dcserializewithsurrogatestop.md │ │ │ │ ├── 5003-dcdeserializewithsurrogatestart.md │ │ │ │ ├── 5004-dcdeserializewithsurrogatestop.md │ │ │ │ ├── 5005-importknowntypesstart.md │ │ │ │ ├── 5006-importknowntypesstop.md │ │ │ │ ├── 5007-dcresolverresolve.md │ │ │ │ ├── 5008-dcgenwriterstart.md │ │ │ │ ├── 5009-dcgenwriterstop.md │ │ │ │ ├── 501-compilationstart.md │ │ │ │ ├── 5010-dcgenreaderstart.md │ │ │ │ ├── 5011-dcgenreaderstop.md │ │ │ │ ├── 5012-dcjsongenreaderstart.md │ │ │ │ ├── 5013-dcjsongenreaderstop.md │ │ │ │ ├── 5014-dcjsongenwriterstart.md │ │ │ │ ├── 5015-dcjsongenwriterstop.md │ │ │ │ ├── 5016-genxmlserializablestart.md │ │ │ │ ├── 5017-genxmlserializablestop.md │ │ │ │ ├── 502-compilationstop.md │ │ │ │ ├── 503-servicehostfactorycreationstart.md │ │ │ │ ├── 504-servicehostfactorycreationstop.md │ │ │ │ ├── 505-createservicehoststart.md │ │ │ │ ├── 506-createservicehoststop.md │ │ │ │ ├── 507-hostedtransportconfigurationmanagerconfiginitstart.md │ │ │ │ ├── 508-hostedtransportconfigurationmanagerconfiginitstop.md │ │ │ │ ├── 509-servicehostopenstart.md │ │ │ │ ├── 510-servicehostopenstop.md │ │ │ │ ├── 513-webhostrequeststart.md │ │ │ │ ├── 514-webhostrequeststop.md │ │ │ │ ├── 5203-jsonmessagedecodingstart.md │ │ │ │ ├── 5204-jsonmessageencodingstart.md │ │ │ │ ├── 5402-tokenvalidationstarted.md │ │ │ │ ├── 5403-tokenvalidationsuccess.md │ │ │ │ ├── 5404-tokenvalidationfailure.md │ │ │ │ ├── 5405-getissuernamesuccess.md │ │ │ │ ├── 5406-getissuernamefailure.md │ │ │ │ ├── 5600-federationmessageprocessingstarted.md │ │ │ │ ├── 5601-federationmessageprocessingsuccess.md │ │ │ │ ├── 5602-federationmessagecreationstarted.md │ │ │ │ ├── 5603-federationmessagecreationsuccess.md │ │ │ │ ├── 5604-sessioncookiereadingstarted.md │ │ │ │ ├── 5605-sessioncookiereadingsuccess.md │ │ │ │ ├── 5606-principalsettingfromsessiontokenstarted.md │ │ │ │ ├── 5607-principalsettingfromsessiontokensuccess.md │ │ │ │ ├── 57393-appdomainunload.md │ │ │ │ ├── 57394-handledexception.md │ │ │ │ ├── 57395-shipassertexceptionmessage.md │ │ │ │ ├── 57396-throwingexception.md │ │ │ │ ├── 57397-unhandledexception.md │ │ │ │ ├── 57399-tracecodeeventlogcritical.md │ │ │ │ ├── 57400-tracecodeeventlogerror.md │ │ │ │ ├── 57401-tracecodeeventloginfo.md │ │ │ │ ├── 57402-tracecodeeventlogverbose.md │ │ │ │ ├── 57403-tracecodeeventlogwarning.md │ │ │ │ ├── 57404-handledexceptionwarning.md │ │ │ │ ├── 601-cbaentryread.md │ │ │ │ ├── 602-cbamatchfound.md │ │ │ │ ├── 603-aspnetroutingservice.md │ │ │ │ ├── 604-aspnetroute.md │ │ │ │ ├── 605-incrementbusycount.md │ │ │ │ ├── 606-decrementbusycount.md │ │ │ │ ├── 62326-httphandlerpickedforurl.md │ │ │ │ ├── 701-servicechannelopenstart.md │ │ │ │ ├── 702-servicechannelopenstop.md │ │ │ │ ├── 703-servicechannelcallstart.md │ │ │ │ ├── 704-servicechannelbegincallstart.md │ │ │ │ ├── 706-httpsendmessagestart.md │ │ │ │ ├── 707-httpsendstop.md │ │ │ │ ├── 708-httpmessagereceivestart.md │ │ │ │ ├── 709-dispatchmessagestart.md │ │ │ │ ├── 710-httpcontextbeforeprocessauthentication.md │ │ │ │ ├── 711-dispatchmessagebeforeauthorization.md │ │ │ │ ├── 712-dispatchmessagestop.md │ │ │ │ ├── 715-clientchannelopenstart.md │ │ │ │ ├── 716-clientchannelopenstop.md │ │ │ │ ├── 717-httpsendstreamedmessagestart.md │ │ │ │ ├── analytic-trace-event-reference.md │ │ │ │ ├── analytic-tracing-overview.md │ │ │ │ ├── configuring-message-flow-tracing.md │ │ │ │ ├── determining-service-operation-duration.md │ │ │ │ ├── dynamically-enabling-analytic-tracing.md │ │ │ │ ├── index.md │ │ │ │ └── toc.yml │ │ │ ├── event-logging │ │ │ │ ├── bindingerror.md │ │ │ │ ├── complusdllhostinitializerstartingerror.md │ │ │ │ ├── complusinstancecreationerror.md │ │ │ │ ├── complusinvokingmethodfailed.md │ │ │ │ ├── complusinvokingmethodfailedmismatchedtransactions.md │ │ │ │ ├── complusservicehoststartingserviceerror.md │ │ │ │ ├── complustlbimporterror.md │ │ │ │ ├── coordinatorrecoverylogentrycorrupt.md │ │ │ │ ├── coordinatorrecoverylogentrycreationfailure.md │ │ │ │ ├── events-general-reference.md │ │ │ │ ├── failedtocreatemessageloggingtracesource.md │ │ │ │ ├── failedtoinitializetracesource.md │ │ │ │ ├── failedtoloadperformancecounter.md │ │ │ │ ├── failedtologmessage.md │ │ │ │ ├── failedtoremoveperformancecounter.md │ │ │ │ ├── failedtosetuptracing.md │ │ │ │ ├── failedtotraceevent.md │ │ │ │ ├── failedtotraceeventwithexception.md │ │ │ │ ├── failfast.md │ │ │ │ ├── failfastexception.md │ │ │ │ ├── fatalunexpectedstatemachineevent.md │ │ │ │ ├── impersonationfailure.md │ │ │ │ ├── impersonationsuccess.md │ │ │ │ ├── index.md │ │ │ │ ├── invariantassertionfailed.md │ │ │ │ ├── lafailedtolistenforapp.md │ │ │ │ ├── messageauthenticationfailure.md │ │ │ │ ├── messageauthenticationsuccess.md │ │ │ │ ├── messageloggingoff.md │ │ │ │ ├── messageloggingon.md │ │ │ │ ├── messagequeueduplicatedpipeleak.md │ │ │ │ ├── messagequeueduplicatedsocketleak.md │ │ │ │ ├── missingnecessaryenhancedkeyusage.md │ │ │ │ ├── missingnecessarykeyusage.md │ │ │ │ ├── nonfatalunexpectedstatemachineevent.md │ │ │ │ ├── participantrecoverylogentrycorrupt.md │ │ │ │ ├── participantrecoverylogentrycreationfailure.md │ │ │ │ ├── performancecounterinitializationfailure.md │ │ │ │ ├── piiloggingnotallowed.md │ │ │ │ ├── piiloggingon.md │ │ │ │ ├── protocolinitializationfailure.md │ │ │ │ ├── protocolrecoverybeginningfailure.md │ │ │ │ ├── protocolrecoverycomplete.md │ │ │ │ ├── protocolrecoverycompletefailure.md │ │ │ │ ├── protocolstartfailure.md │ │ │ │ ├── protocolstopfailure.md │ │ │ │ ├── protocolstopped.md │ │ │ │ ├── securitynegotiationfailure.md │ │ │ │ ├── securitynegotiationsuccess.md │ │ │ │ ├── serviceauthorizationfailure.md │ │ │ │ ├── serviceauthorizationsuccess.md │ │ │ │ ├── servicestartfailed.md │ │ │ │ ├── sslnoaccessibleprivatekey.md │ │ │ │ ├── sslnoprivatekey.md │ │ │ │ ├── starterrorpublish.md │ │ │ │ ├── thumbprintnotfound.md │ │ │ │ ├── thumbprintnotvalidated.md │ │ │ │ ├── toc.yml │ │ │ │ ├── tracecoderemovedbadfilter.md │ │ │ │ ├── transactionbridgerecoveryfailure.md │ │ │ │ ├── transportauthenticationfailure.md │ │ │ │ ├── transportauthenticationsuccess.md │ │ │ │ ├── unhandledstatemachineexceptionrecorddescription.md │ │ │ │ ├── unknownlisteneradaptererror.md │ │ │ │ ├── wasconnectiontimedout.md │ │ │ │ ├── wasdisconnected.md │ │ │ │ ├── webhostfailedtolisten.md │ │ │ │ ├── webhostfailedtoprocessrequest.md │ │ │ │ ├── webhosthttperror.md │ │ │ │ ├── webhostunhandledexception.md │ │ │ │ ├── wmiadmintypemismatch.md │ │ │ │ ├── wmicreateinstancefailed.md │ │ │ │ ├── wmideleteinstancefailed.md │ │ │ │ ├── wmiexecmethodfailed.md │ │ │ │ ├── wmiexecqueryfailed.md │ │ │ │ ├── wmigetobjectfailed.md │ │ │ │ ├── wmipropertymissing.md │ │ │ │ ├── wmiputinstancefailed.md │ │ │ │ ├── wmiregistrationfailed.md │ │ │ │ └── wmiunregistrationfailed.md │ │ │ ├── exceptions-reference │ │ │ │ ├── com-integration.md │ │ │ │ ├── configuration.md │ │ │ │ ├── core-communications-channel-framework.md │ │ │ │ ├── core-communications-connection-framework.md │ │ │ │ ├── core-communications-http-https-transport-channels.md │ │ │ │ ├── core-communications-internal-duplex-transport-channels.md │ │ │ │ ├── core-communications-named-pipe-transport-channels.md │ │ │ │ ├── core-communications-tcp-transport-channels.md │ │ │ │ ├── core-communications-transport-framework.md │ │ │ │ ├── core-communications-utilities.md │ │ │ │ ├── core-communications-webhost-support.md │ │ │ │ ├── hosting-exceptions.md │ │ │ │ ├── identitymodel-exceptions.md │ │ │ │ ├── index.md │ │ │ │ ├── msmq-integration-transport.md │ │ │ │ ├── msmq-transport.md │ │ │ │ ├── peer-channel.md │ │ │ │ ├── reliable-messaging.md │ │ │ │ ├── security-exceptions.md │ │ │ │ ├── service-framework-data.md │ │ │ │ ├── service-framework-metadata.md │ │ │ │ ├── service-framework.md │ │ │ │ ├── toc.yml │ │ │ │ ├── tools.md │ │ │ │ ├── transaction-exceptions.md │ │ │ │ └── transaction-formatter.md │ │ │ ├── index.md │ │ │ ├── message-flow-overview.md │ │ │ ├── message-logging.md │ │ │ ├── performance-counters │ │ │ │ ├── calls-duration.md │ │ │ │ ├── calls-failed-per-second.md │ │ │ │ ├── calls-failed.md │ │ │ │ ├── calls-faulted-per-second.md │ │ │ │ ├── calls-faulted.md │ │ │ │ ├── calls-outstanding.md │ │ │ │ ├── calls-per-second.md │ │ │ │ ├── calls.md │ │ │ │ ├── endpoint-calls-duration.md │ │ │ │ ├── endpoint-calls-failed-per-second.md │ │ │ │ ├── endpoint-calls-failed.md │ │ │ │ ├── endpoint-calls-faulted-per-second.md │ │ │ │ ├── endpoint-calls-faulted.md │ │ │ │ ├── endpoint-calls-outstanding.md │ │ │ │ ├── endpoint-calls-per-second.md │ │ │ │ ├── endpoint-calls.md │ │ │ │ ├── endpoint-performance-counters.md │ │ │ │ ├── endpoint-reliable-messaging-messages-dropped-per-second.md │ │ │ │ ├── endpoint-reliable-messaging-messages-dropped.md │ │ │ │ ├── endpoint-reliable-messaging-sessions-faulted-per-second.md │ │ │ │ ├── endpoint-reliable-messaging-sessions-faulted.md │ │ │ │ ├── endpoint-security-calls-not-authorized-per-second.md │ │ │ │ ├── endpoint-security-calls-not-authorized.md │ │ │ │ ├── endpoint-security-validation-and-authentication-failures-per-second.md │ │ │ │ ├── endpoint-security-validation-and-authentication-failures.md │ │ │ │ ├── endpoint-transactions-flowed-per-second.md │ │ │ │ ├── endpoint-transactions-flowed.md │ │ │ │ ├── index.md │ │ │ │ ├── instances-per-second.md │ │ │ │ ├── instances.md │ │ │ │ ├── operation-performance-counters.md │ │ │ │ ├── percent-of-max-concurrent-calls.md │ │ │ │ ├── percent-of-max-concurrent-instances.md │ │ │ │ ├── percent-of-max-concurrent-sessions.md │ │ │ │ ├── queue-dropped-messages-per-second.md │ │ │ │ ├── queue-dropped-messages.md │ │ │ │ ├── queued-poison-messages-per-second.md │ │ │ │ ├── queued-poison-messages.md │ │ │ │ ├── queued-rejected-messages-per-second.md │ │ │ │ ├── queued-rejected-messages.md │ │ │ │ ├── reliable-messaging-messages-dropped-per-second.md │ │ │ │ ├── reliable-messaging-messages-dropped.md │ │ │ │ ├── reliable-messaging-sessions-faulted-per-second.md │ │ │ │ ├── reliable-messaging-sessions-faulted.md │ │ │ │ ├── security-calls-not-authorized-per-second.md │ │ │ │ ├── security-calls-not-authorized.md │ │ │ │ ├── security-validation-and-authentication-failures-per-second.md │ │ │ │ ├── security-validation-and-authentication-failures.md │ │ │ │ ├── service-calls-duration.md │ │ │ │ ├── service-calls-failed-per-second.md │ │ │ │ ├── service-calls-failed.md │ │ │ │ ├── service-calls-faulted-per-second.md │ │ │ │ ├── service-calls-faulted.md │ │ │ │ ├── service-calls-outstanding.md │ │ │ │ ├── service-calls-per-second.md │ │ │ │ ├── service-calls.md │ │ │ │ ├── service-performance-counters.md │ │ │ │ ├── service-security-calls-not-authorized-per-second.md │ │ │ │ ├── service-security-calls-not-authorized.md │ │ │ │ ├── service-security-validation-and-authentication-failures-per-second.md │ │ │ │ ├── service-security-validation-and-authentication-failures.md │ │ │ │ ├── service-transactions-flowed-per-second.md │ │ │ │ ├── service-transactions-flowed.md │ │ │ │ ├── toc.yml │ │ │ │ ├── transacted-operations-aborted-per-second.md │ │ │ │ ├── transacted-operations-aborted.md │ │ │ │ ├── transacted-operations-committed-per-second.md │ │ │ │ ├── transacted-operations-committed.md │ │ │ │ ├── transacted-operations-in-doubt-per-second.md │ │ │ │ ├── transacted-operations-in-doubt.md │ │ │ │ ├── transactions-flowed-per-second.md │ │ │ │ └── transactions-flowed.md │ │ │ ├── security-concerns-for-message-logging.md │ │ │ ├── servicemodel-registration-tool.md │ │ │ ├── toc.yml │ │ │ ├── tracing │ │ │ │ ├── activity-id-propagation.md │ │ │ │ ├── activity-list.md │ │ │ │ ├── activity-tracing-in-message-security.md │ │ │ │ ├── activity.md │ │ │ │ ├── asynchronous-scenarios-using-http-tcp-or-named-pipe.md │ │ │ │ ├── com.md │ │ │ │ ├── configuring-tracing.md │ │ │ │ ├── connectionpoolmaxoutboundconnectionsperendpointquotareached.md │ │ │ │ ├── debugging-on-the-client.md │ │ │ │ ├── emitting-user-code-traces.md │ │ │ │ ├── end-to-end-tracing-scenarios.md │ │ │ │ ├── end-to-end-tracing.md │ │ │ │ ├── index.md │ │ │ │ ├── media │ │ │ │ │ ├── 242c9358-475a-4baf-83f3-4227aa942fcd.gif │ │ │ │ │ ├── asynchronous-scenarios-using-http-tcp-or-named-pipe │ │ │ │ │ │ ├── asynchronous-client-callback-endcall-in-callback.gif │ │ │ │ │ │ ├── asynchronous-client-callback-endcall-outside-callback.gif │ │ │ │ │ │ ├── asynchronous-client-no-callback.gif │ │ │ │ │ │ ├── asynchronous-scenario-propagation-disabled-either-side.gif │ │ │ │ │ │ ├── asynchronous-scenario-propagation-disabled-using-tcp.gif │ │ │ │ │ │ ├── asynchronous-scenario-propagation-enabled-using-tcp.gif │ │ │ │ │ │ └── asynchronous-server-callback.gif │ │ │ │ │ ├── com-tracing.gif │ │ │ │ │ ├── emitting-user-code-traces │ │ │ │ │ │ ├── trace-viewer-endpoint-errors.gif │ │ │ │ │ │ └── trace-viewer-error-correlation.gif │ │ │ │ │ ├── synchronous-scenarios-using-http-tcp-or-named-pipe │ │ │ │ │ │ └── synchronous-scenario-http-tcp-named-pipes.gif │ │ │ │ │ ├── using-service-trace-viewer-for-viewing-correlated-traces-and-troubleshooting │ │ │ │ │ │ ├── message-logging-enabled.gif │ │ │ │ │ │ ├── process-action-traces.gif │ │ │ │ │ │ ├── service-trace-viewer.gif │ │ │ │ │ │ ├── wcf-activities-graph-ambient-process.gif │ │ │ │ │ │ ├── wcf-client-activities-creation-time.gif │ │ │ │ │ │ ├── wcf-client-service-activities.gif │ │ │ │ │ │ └── wcf-service-activities.gif │ │ │ │ │ └── wcfc-e2etrace9s.gif │ │ │ │ ├── microsoft-transactions-transactionbridge-commitmessageretry.md │ │ │ │ ├── microsoft-transactions-transactionbridge-coordinatorrecovered.md │ │ │ │ ├── microsoft-transactions-transactionbridge-coordinatorstatemachinefinished.md │ │ │ │ ├── microsoft-transactions-transactionbridge-createtransactionfailure.md │ │ │ │ ├── microsoft-transactions-transactionbridge-enlistmentidentitycheckfailed.md │ │ │ │ ├── microsoft-transactions-transactionbridge-enlisttransaction.md │ │ │ │ ├── microsoft-transactions-transactionbridge-participantrecovered.md │ │ │ │ ├── microsoft-transactions-transactionbridge-participantstatemachinefinished.md │ │ │ │ ├── microsoft-transactions-transactionbridge-preparedmessageretry.md │ │ │ │ ├── microsoft-transactions-transactionbridge-preparemessageretry.md │ │ │ │ ├── microsoft-transactions-transactionbridge-protocolinitialized.md │ │ │ │ ├── microsoft-transactions-transactionbridge-protocolstarted.md │ │ │ │ ├── microsoft-transactions-transactionbridge-recoveredcoordinatorinvalidmetadata.md │ │ │ │ ├── microsoft-transactions-transactionbridge-recoveredparticipantinvalidmetadata.md │ │ │ │ ├── microsoft-transactions-transactionbridge-registercoordinator.md │ │ │ │ ├── microsoft-transactions-transactionbridge-registerparticipant.md │ │ │ │ ├── microsoft-transactions-transactionbridge-registerparticipantfailure.md │ │ │ │ ├── microsoft-transactions-transactionbridge-registrationcoordinatorfailed.md │ │ │ │ ├── microsoft-transactions-transactionbridge-registrationcoordinatorfaulted.md │ │ │ │ ├── microsoft-transactions-transactionbridge-registrationcoordinatorresponseinvalidmetadata.md │ │ │ │ ├── microsoft-transactions-transactionbridge-replaymessageretry.md │ │ │ │ ├── microsoft-transactions-transactionbridge-volatileoutcometimeout.md │ │ │ │ ├── microsoft-transactions-transactionbridge-volatileparticipantindoubt.md │ │ │ │ ├── msmq.md │ │ │ │ ├── mts-registrationcoordinatorresponseinvalidmetadata.md │ │ │ │ ├── mtt-durableparticipantreplaywhilepreparing.md │ │ │ │ ├── propagation.md │ │ │ │ ├── recommended-settings-for-tracing-and-message-logging.md │ │ │ │ ├── security-concerns-and-useful-tips-for-tracing.md │ │ │ │ ├── significant-traces.md │ │ │ │ ├── ssc--comintegrationmexmonikermetadataexchangecomplete.md │ │ │ │ ├── ssc--comintegrationservicehostcreatedserviceendpoint.md │ │ │ │ ├── ssc-comintegration.md │ │ │ │ ├── ssc-comintegrationinvokingmethodcontexttransaction.md │ │ │ │ ├── ssc-comintegrationservicehostcreatedservicecontract.md │ │ │ │ ├── synchronous-scenarios-using-http-tcp-or-named-pipe.md │ │ │ │ ├── system-identitymodel-authorizationcontextcreated.md │ │ │ │ ├── system-identitymodel-authorizationpolicyevaluated.md │ │ │ │ ├── system-identitymodel-identitymodelasynccallbackthrewexception.md │ │ │ │ ├── system-identitymodel-selectors-generalinformation.md │ │ │ │ ├── system-identitymodel-selectors-storebegintransaction.md │ │ │ │ ├── system-identitymodel-selectors-storeclosing.md │ │ │ │ ├── system-identitymodel-selectors-storecommittransaction.md │ │ │ │ ├── system-identitymodel-selectors-storedeleting.md │ │ │ │ ├── system-identitymodel-selectors-storefailedtoopenstore.md │ │ │ │ ├── system-identitymodel-selectors-storeloading.md │ │ │ │ ├── system-identitymodel-selectors-storerollbacktransaction.md │ │ │ │ ├── system-identitymodel-selectors-storesignaturenotvalid.md │ │ │ │ ├── system-runtime-serialization-elementignored.md │ │ │ │ ├── system-runtime-serialization-factorytypenotfound.md │ │ │ │ ├── system-runtime-serialization-objectwithlargedepth.md │ │ │ │ ├── system-runtime-serialization-readobjectbegin.md │ │ │ │ ├── system-runtime-serialization-writeobjectbegin.md │ │ │ │ ├── system-runtime-serialization-writeobjectcontentbegin.md │ │ │ │ ├── system-runtime-serialization-writeobjectcontentend.md │ │ │ │ ├── system-runtime-serialization-writeobjectend.md │ │ │ │ ├── system-runtime-serialization-xsdexportannotationfailed.md │ │ │ │ ├── system-runtime-serialization-xsdexportbegin.md │ │ │ │ ├── system-runtime-serialization-xsdexportdupitems.md │ │ │ │ ├── system-runtime-serialization-xsdexportend.md │ │ │ │ ├── system-runtime-serialization-xsdexporterror.md │ │ │ │ ├── system-runtime-serialization-xsdimportannotationfailed.md │ │ │ │ ├── system-runtime-serialization-xsdimportbegin.md │ │ │ │ ├── system-runtime-serialization-xsdimportend.md │ │ │ │ ├── system-runtime-serialization-xsdimporterror.md │ │ │ │ ├── system-servicemodel-activation-messagequeueclosed.md │ │ │ │ ├── system-servicemodel-activation-messagequeueduplicatedpipe.md │ │ │ │ ├── system-servicemodel-activation-messagequeueduplicatedpipeerror.md │ │ │ │ ├── system-servicemodel-activation-messagequeueduplicatedsocket.md │ │ │ │ ├── system-servicemodel-activation-messagequeueduplicatedsocketerror.md │ │ │ │ ├── system-servicemodel-activation-messagequeueregistercalled.md │ │ │ │ ├── system-servicemodel-activation-messagequeueregisterfailed.md │ │ │ │ ├── system-servicemodel-activation-messagequeueregistersucceeded.md │ │ │ │ ├── system-servicemodel-activation-messagequeueunregistersucceeded.md │ │ │ │ ├── system-servicemodel-activation-servicecontinue.md │ │ │ │ ├── system-servicemodel-activation-servicepause.md │ │ │ │ ├── system-servicemodel-activation-serviceshutdown.md │ │ │ │ ├── system-servicemodel-activation-serviceshutdownerror.md │ │ │ │ ├── system-servicemodel-activation-servicestart.md │ │ │ │ ├── system-servicemodel-activation-servicestartpipeerror.md │ │ │ │ ├── system-servicemodel-activation-servicestop.md │ │ │ │ ├── system-servicemodel-activation-webhostcompilation.md │ │ │ │ ├── system-servicemodel-activation-webhostdebugrequest.md │ │ │ │ ├── system-servicemodel-activation-webhostprotocolmisconfigured.md │ │ │ │ ├── system-servicemodel-activation-webhostserviceactivated.md │ │ │ │ ├── system-servicemodel-activation-webhostserviceclosefailed.md │ │ │ │ ├── system-servicemodel-administration-wmiput.md │ │ │ │ ├── system-servicemodel-asynccallbackthrewexception.md │ │ │ │ ├── system-servicemodel-beginexecutemethod.md │ │ │ │ ├── system-servicemodel-cannotbeimportedincurrentformat.md │ │ │ │ ├── system-servicemodel-channels-channelcreated.md │ │ │ │ ├── system-servicemodel-channels-channeldisposed.md │ │ │ │ ├── system-servicemodel-channels-connectionabandoned.md │ │ │ │ ├── system-servicemodel-channels-connectionpoolcloseexception.md │ │ │ │ ├── system-servicemodel-channels-connectionpoolidletimeoutreached.md │ │ │ │ ├── system-servicemodel-channels-connectionpoolleasetimeoutreached.md │ │ │ │ ├── system-servicemodel-channels-connectionpoolmaxoutboundconnectionsperendpointquotareached.md │ │ │ │ ├── system-servicemodel-channels-connecttoipendpoint.md │ │ │ │ ├── system-servicemodel-channels-endpointlistenerclose.md │ │ │ │ ├── system-servicemodel-channels-endpointlisteneropen.md │ │ │ │ ├── system-servicemodel-channels-failedacceptfrompool.md │ │ │ │ ├── system-servicemodel-channels-failedpipeconnect.md │ │ │ │ ├── system-servicemodel-channels-httpauthfailed.md │ │ │ │ ├── system-servicemodel-channels-httpchannelconcurrentreceivequotareached.md │ │ │ │ ├── system-servicemodel-channels-httpchannelmessagereceivefailed.md │ │ │ │ ├── system-servicemodel-channels-httpchannelrequestaborted.md │ │ │ │ ├── system-servicemodel-channels-httpchannelresponseaborted.md │ │ │ │ ├── system-servicemodel-channels-httpchannelunexpectedresponse.md │ │ │ │ ├── system-servicemodel-channels-httpresponsereceived.md │ │ │ │ ├── system-servicemodel-channels-httpsclientcertificateinvalid.md │ │ │ │ ├── system-servicemodel-channels-httpsclientcertificatenotpresent.md │ │ │ │ ├── system-servicemodel-channels-incompatibleexistingtransportmanager.md │ │ │ │ ├── system-servicemodel-channels-initiatingnamedpipeconnection.md │ │ │ │ ├── system-servicemodel-channels-initiatingtcpconnection.md │ │ │ │ ├── system-servicemodel-channels-listenercreated.md │ │ │ │ ├── system-servicemodel-channels-listenerdisposed.md │ │ │ │ ├── system-servicemodel-channels-maxacceptedchannelsreached.md │ │ │ │ ├── system-servicemodel-channels-maxpendingconnectionsreached.md │ │ │ │ ├── system-servicemodel-channels-messagereceived.md │ │ │ │ ├── system-servicemodel-channels-messagesent.md │ │ │ │ ├── system-servicemodel-channels-msmqcannotpeekonqueue.md │ │ │ │ ├── system-servicemodel-channels-msmqcannotreadqueues.md │ │ │ │ ├── system-servicemodel-channels-msmqdatagramreceived.md │ │ │ │ ├── system-servicemodel-channels-msmqdatagramsent.md │ │ │ │ ├── system-servicemodel-channels-msmqdetected.md │ │ │ │ ├── system-servicemodel-channels-msmqenteredbatch.md │ │ │ │ ├── system-servicemodel-channels-msmqfoundbaseaddress.md │ │ │ │ ├── system-servicemodel-channels-msmqleftbatch.md │ │ │ │ ├── system-servicemodel-channels-msmqmatchedapplicationfound.md │ │ │ │ ├── system-servicemodel-channels-msmqmessagedropped.md │ │ │ │ ├── system-servicemodel-channels-msmqmessagelockedunderthetransaction.md │ │ │ │ ├── system-servicemodel-channels-msmqmessagerejected.md │ │ │ │ ├── system-servicemodel-channels-msmqpoisonmessagemovedpoison.md │ │ │ │ ├── system-servicemodel-channels-msmqpoisonmessagemovedretry.md │ │ │ │ ├── system-servicemodel-channels-msmqpoisonmessagerejected.md │ │ │ │ ├── system-servicemodel-channels-msmqpoolfull.md │ │ │ │ ├── system-servicemodel-channels-msmqpotentiallypoisonmessagedetected.md │ │ │ │ ├── system-servicemodel-channels-msmqqueueclosed.md │ │ │ │ ├── system-servicemodel-channels-msmqqueueopened.md │ │ │ │ ├── system-servicemodel-channels-msmqqueuetransactionalstatusunknown.md │ │ │ │ ├── system-servicemodel-channels-msmqscanstarted.md │ │ │ │ ├── system-servicemodel-channels-msmqsessiongramreceived.md │ │ │ │ ├── system-servicemodel-channels-msmqsessiongramsent.md │ │ │ │ ├── system-servicemodel-channels-msmqstartingapplication.md │ │ │ │ ├── system-servicemodel-channels-msmqstartingservice.md │ │ │ │ ├── system-servicemodel-channels-msmqunexpectedacknowledgment.md │ │ │ │ ├── system-servicemodel-channels-namedpipechannelmessagereceived.md │ │ │ │ ├── system-servicemodel-channels-namedpipechannelmessagereceivefailed.md │ │ │ │ ├── system-servicemodel-channels-noexistingtransportmanager.md │ │ │ │ ├── system-servicemodel-channels-openedlistener.md │ │ │ │ ├── system-servicemodel-channels-peerchannelmessagereceived.md │ │ │ │ ├── system-servicemodel-channels-peerchannelmessagesent.md │ │ │ │ ├── system-servicemodel-channels-peerfloodedmessagenotmatched.md │ │ │ │ ├── system-servicemodel-channels-peerfloodedmessagenotpropagated.md │ │ │ │ ├── system-servicemodel-channels-peerfloodedmessagereceived.md │ │ │ │ ├── system-servicemodel-channels-peerflooderreceivemessagequotaexceeded.md │ │ │ │ ├── system-servicemodel-channels-peermaintaineractivity.md │ │ │ │ ├── system-servicemodel-channels-peerneighbormanageroffline.md │ │ │ │ ├── system-servicemodel-channels-peerneighbormanageronline.md │ │ │ │ ├── system-servicemodel-channels-peerneighbormessagereceived.md │ │ │ │ ├── system-servicemodel-channels-peerneighbornotaccepted.md │ │ │ │ ├── system-servicemodel-channels-peerneighbornotfound.md │ │ │ │ ├── system-servicemodel-channels-peerneighborstatechanged.md │ │ │ │ ├── system-servicemodel-channels-peerneighborstatechangefailed.md │ │ │ │ ├── system-servicemodel-channels-peernodeaddresschanged.md │ │ │ │ ├── system-servicemodel-channels-peernodeauthenticationfailure.md │ │ │ │ ├── system-servicemodel-channels-peernodeauthenticationtimeout.md │ │ │ │ ├── system-servicemodel-channels-peernodeclosed.md │ │ │ │ ├── system-servicemodel-channels-peernodeclosing.md │ │ │ │ ├── system-servicemodel-channels-peernodeopened.md │ │ │ │ ├── system-servicemodel-channels-peernodeopenfailed.md │ │ │ │ ├── system-servicemodel-channels-peernodeopening.md │ │ │ │ ├── system-servicemodel-channels-peerreceivemessageauthenticationfailure.md │ │ │ │ ├── system-servicemodel-channels-peerserviceopened.md │ │ │ │ ├── system-servicemodel-channels-pipeconnectionabort.md │ │ │ │ ├── system-servicemodel-channels-pnrpregisteredaddresses.md │ │ │ │ ├── system-servicemodel-channels-pnrpresolvedaddresses.md │ │ │ │ ├── system-servicemodel-channels-pnrpresolveexception.md │ │ │ │ ├── system-servicemodel-channels-pnrpunregisteredaddresses.md │ │ │ │ ├── system-servicemodel-channels-prematuredatagrameof.md │ │ │ │ ├── system-servicemodel-channels-requestchannelreplyreceived.md │ │ │ │ ├── system-servicemodel-channels-requestcontextabort.md │ │ │ │ ├── system-servicemodel-channels-servermaxpooledconnectionsquotareached.md │ │ │ │ ├── system-servicemodel-channels-socketconnectionabort.md │ │ │ │ ├── system-servicemodel-channels-socketconnectionabortclose.md │ │ │ │ ├── system-servicemodel-channels-socketconnectionclose.md │ │ │ │ ├── system-servicemodel-channels-socketconnectioncreate.md │ │ │ │ ├── system-servicemodel-channels-sslclientcertmissing.md │ │ │ │ ├── system-servicemodel-channels-streamsecurityupgradeaccepted.md │ │ │ │ ├── system-servicemodel-channels-systemtimeresolution.md │ │ │ │ ├── system-servicemodel-channels-tcpchannelmessagereceived.md │ │ │ │ ├── system-servicemodel-channels-tcpconnecterror.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationchannelcreated.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationdispatchmethod.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationdllhostinitializeraddinghost.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationdllhostinitializerstarted.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationdllhostinitializerstarting.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationdllhostinitializerstopped.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationdllhostinitializerstopping.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationenteringactivity.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationexecutingcall.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationinstancecreationrequest.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationinstancecreationsuccess.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationinstancereleased.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationinvokedmethod.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationinvokingmethod.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationinvokingmethodnewtransaction.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationleftactivity.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationmexchannelbuilderloaded.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationmexmonikermetadataexchangecomplete.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationservicehostcreatedserviceendpoint.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationservicehoststartedservice.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationservicehoststartingservice.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationservicehoststoppedservice.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationservicehoststoppingservice.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationservicemonikerparsed.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationtlbimportconverterevent.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationtlbimportfinished.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationtlbimportfromassembly.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationtlbimportfromtypelib.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationtlbimportstarting.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationtxproxytxabortedbycontext.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationtxproxytxabortedbytm.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationtxproxytxcommitted.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationtypedchannelbuilderloaded.md │ │ │ │ ├── system-servicemodel-comintegration-comintegrationwsdlchannelbuilderloaded.md │ │ │ │ ├── system-servicemodel-communicationobjectaborted.md │ │ │ │ ├── system-servicemodel-communicationobjectabortfailed.md │ │ │ │ ├── system-servicemodel-communicationobjectclosed.md │ │ │ │ ├── system-servicemodel-communicationobjectclosefailed.md │ │ │ │ ├── system-servicemodel-communicationobjectclosing.md │ │ │ │ ├── system-servicemodel-communicationobjectcreated.md │ │ │ │ ├── system-servicemodel-communicationobjectdisposing.md │ │ │ │ ├── system-servicemodel-communicationobjectfaulted.md │ │ │ │ ├── system-servicemodel-communicationobjectfaultreason.md │ │ │ │ ├── system-servicemodel-communicationobjectopened.md │ │ │ │ ├── system-servicemodel-communicationobjectopenfailed.md │ │ │ │ ├── system-servicemodel-communicationobjectopening.md │ │ │ │ ├── system-servicemodel-configurationisreadonly.md │ │ │ │ ├── system-servicemodel-configuredextensiontypenotfound.md │ │ │ │ ├── system-servicemodel-diagnostics-activityboundary.md │ │ │ │ ├── system-servicemodel-diagnostics-appdomainunload.md │ │ │ │ ├── system-servicemodel-diagnostics-diagnosticsfailedmessagetrace.md │ │ │ │ ├── system-servicemodel-diagnostics-eventlog.md │ │ │ │ ├── system-servicemodel-diagnostics-failedtoaddanactivityidheader.md │ │ │ │ ├── system-servicemodel-diagnostics-failedtoreadanactivityidheader.md │ │ │ │ ├── system-servicemodel-diagnostics-filternotmatchednodequotaexceeded.md │ │ │ │ ├── system-servicemodel-diagnostics-messagenotloggedquotaexceeded.md │ │ │ │ ├── system-servicemodel-diagnostics-throwingexception.md │ │ │ │ ├── system-servicemodel-diagnostics-tracehandledexception.md │ │ │ │ ├── system-servicemodel-diagnostics-tracetruncatedquotaexceeded.md │ │ │ │ ├── system-servicemodel-diagnostics-unhandledexception.md │ │ │ │ ├── system-servicemodel-didnotunderstandmessageheader.md │ │ │ │ ├── system-servicemodel-droppedamessage.md │ │ │ │ ├── system-servicemodel-elementtypedoesntmatchconfiguredtype.md │ │ │ │ ├── system-servicemodel-endexecutemethod.md │ │ │ │ ├── system-servicemodel-errorinvokingusercode.md │ │ │ │ ├── system-servicemodel-evaluationcontextnotfound.md │ │ │ │ ├── system-servicemodel-extensioncollectiondoesnotexist.md │ │ │ │ ├── system-servicemodel-extensioncollectionisempty.md │ │ │ │ ├── system-servicemodel-extensioncollectionnamenotfound.md │ │ │ │ ├── system-servicemodel-extensionelementalreadyexistsincollection.md │ │ │ │ ├── system-servicemodel-failedtoopenincomingchannel.md │ │ │ │ ├── system-servicemodel-getbehaviorelement.md │ │ │ │ ├── system-servicemodel-getchannelendpointelement.md │ │ │ │ ├── system-servicemodel-getcommonbehaviors.md │ │ │ │ ├── system-servicemodel-getconfigurationsection.md │ │ │ │ ├── system-servicemodel-getconfiguredbinding.md │ │ │ │ ├── system-servicemodel-getdefaultconfiguredbinding.md │ │ │ │ ├── system-servicemodel-getserviceelement.md │ │ │ │ ├── system-servicemodel-manualflowthrottlelimitreached.md │ │ │ │ ├── system-servicemodel-messageclosed.md │ │ │ │ ├── system-servicemodel-messageclosedagain.md │ │ │ │ ├── system-servicemodel-messagecopied.md │ │ │ │ ├── system-servicemodel-messageprocessingpaused.md │ │ │ │ ├── system-servicemodel-messageread.md │ │ │ │ ├── system-servicemodel-messagewritten.md │ │ │ │ ├── system-servicemodel-metadataexchangeclientreceivereply.md │ │ │ │ ├── system-servicemodel-metadataexchangeclientsendrequest.md │ │ │ │ ├── system-servicemodel-overridingduplicateconfigurationkey.md │ │ │ │ ├── system-servicemodel-performancecounterfailedtoload.md │ │ │ │ ├── system-servicemodel-performancecountersfailed.md │ │ │ │ ├── system-servicemodel-performancecountersfailedduringupdate.md │ │ │ │ ├── system-servicemodel-performancecountersfailedforservice.md │ │ │ │ ├── system-servicemodel-performancecountersfailedonrelease.md │ │ │ │ ├── system-servicemodel-portsharing-portsharingclosed.md │ │ │ │ ├── system-servicemodel-portsharing-portsharingduphandlegranted.md │ │ │ │ ├── system-servicemodel-portsharing-portsharingduplicatedpipe.md │ │ │ │ ├── system-servicemodel-portsharing-portsharingduplicatedsocket.md │ │ │ │ ├── system-servicemodel-portsharing-portsharinglistening.md │ │ │ │ ├── system-servicemodel-portsharing-readnetpipeconfig.md │ │ │ │ ├── system-servicemodel-portsharing-readnettcpconfig.md │ │ │ │ ├── system-servicemodel-portsharing-routingtablecannotlisten.md │ │ │ │ ├── system-servicemodel-portsharing-routingtablelookup.md │ │ │ │ ├── system-servicemodel-portsharing-routingtablenamespaceconflict.md │ │ │ │ ├── system-servicemodel-portsharing-routingtablepathtoolong.md │ │ │ │ ├── system-servicemodel-portsharing-routingtableregistersuccess.md │ │ │ │ ├── system-servicemodel-portsharing-routingtableunsupportedprotocol.md │ │ │ │ ├── system-servicemodel-portsharing-sharedmanagerserviceendpointnotexist.md │ │ │ │ ├── system-servicemodel-portsharing-transportlistenerlistening.md │ │ │ │ ├── system-servicemodel-portsharing-transportlistenerlistenrequest.md │ │ │ │ ├── system-servicemodel-portsharing-transportlistenersessionsreceived.md │ │ │ │ ├── system-servicemodel-portsharing-transportlistenerstop.md │ │ │ │ ├── system-servicemodel-portsharing-wasclosealllistenerchannelinstances.md │ │ │ │ ├── system-servicemodel-portsharing-wasconnected.md │ │ │ │ ├── system-servicemodel-portsharing-waswebhostapifailed.md │ │ │ │ ├── system-servicemodel-removebehavior.md │ │ │ │ ├── system-servicemodel-security-exportsecuritychannelbindingentry.md │ │ │ │ ├── system-servicemodel-security-exportsecuritychannelbindingexit.md │ │ │ │ ├── system-servicemodel-security-importsecuritychannelbindingentry.md │ │ │ │ ├── system-servicemodel-security-importsecuritychannelbindingexit.md │ │ │ │ ├── system-servicemodel-security-issuancetokenproviderbeginsecuritynegotiation.md │ │ │ │ ├── system-servicemodel-security-issuancetokenproviderendsecuritynegotiation.md │ │ │ │ ├── system-servicemodel-security-issuancetokenproviderredirectapplied.md │ │ │ │ ├── system-servicemodel-security-issuancetokenproviderremovedcachedtoken.md │ │ │ │ ├── system-servicemodel-security-issuancetokenproviderservicetokencachefull.md │ │ │ │ ├── system-servicemodel-security-issuancetokenproviderusingcachedtoken.md │ │ │ │ ├── system-servicemodel-security-negotiationauthenticatorattached.md │ │ │ │ ├── system-servicemodel-security-negotiationtokenproviderattached.md │ │ │ │ ├── system-servicemodel-security-securityactiveserversessionremoved.md │ │ │ │ ├── system-servicemodel-security-securityauditwrittenfailure.md │ │ │ │ ├── system-servicemodel-security-securityauditwrittensuccess.md │ │ │ │ ├── system-servicemodel-security-securitybindingincomingmessageverified.md │ │ │ │ ├── system-servicemodel-security-securitybindingoutgoingmessagesecured.md │ │ │ │ ├── system-servicemodel-security-securitybindingsecureoutgoingmessagefailure.md │ │ │ │ ├── system-servicemodel-security-securitybindingverifyincomingmessagefailure.md │ │ │ │ ├── system-servicemodel-security-securityclientsessionclosemessagereceived.md │ │ │ │ ├── system-servicemodel-security-securityclientsessioncloseresponsesent.md │ │ │ │ ├── system-servicemodel-security-securityclientsessionclosesent.md │ │ │ │ ├── system-servicemodel-security-securityclientsessionkeyrenewed.md │ │ │ │ ├── system-servicemodel-security-securityclientsessionpreviouskeydiscarded.md │ │ │ │ ├── system-servicemodel-security-securitycontexttokencachefull.md │ │ │ │ ├── system-servicemodel-security-securityidentitydeterminationfailure.md │ │ │ │ ├── system-servicemodel-security-securityidentitydeterminationsuccess.md │ │ │ │ ├── system-servicemodel-security-securityidentityhostnamenormalizationfailure.md │ │ │ │ ├── system-servicemodel-security-securityidentityverificationfailure.md │ │ │ │ ├── system-servicemodel-security-securityidentityverificationsuccess.md │ │ │ │ ├── system-servicemodel-security-securityimpersonationfailure.md │ │ │ │ ├── system-servicemodel-security-securityimpersonationsuccess.md │ │ │ │ ├── system-servicemodel-security-securityinactivesessionfaulted.md │ │ │ │ ├── system-servicemodel-security-securitynegotiationprocessingfailure.md │ │ │ │ ├── system-servicemodel-security-securitynewserversessionkeyissued.md │ │ │ │ ├── system-servicemodel-security-securitypendingserversessionactivated.md │ │ │ │ ├── system-servicemodel-security-securitypendingserversessionadded.md │ │ │ │ ├── system-servicemodel-security-securitypendingserversessionclosed.md │ │ │ │ ├── system-servicemodel-security-securityserversessionabortedfaultsent.md │ │ │ │ ├── system-servicemodel-security-securityserversessionclosereceived.md │ │ │ │ ├── system-servicemodel-security-securityserversessioncloseresponsereceived.md │ │ │ │ ├── system-servicemodel-security-securityserversessionkeyupdated.md │ │ │ │ ├── system-servicemodel-security-securityserversessionrenewalfaultsent.md │ │ │ │ ├── system-servicemodel-security-securitysessionabortedfaultreceived.md │ │ │ │ ├── system-servicemodel-security-securitysessionabortedfaultsendfailure.md │ │ │ │ ├── system-servicemodel-security-securitysessionclosedresponsereceived.md │ │ │ │ ├── system-servicemodel-security-securitysessionclosedresponsesendfailure.md │ │ │ │ ├── system-servicemodel-security-securitysessioncloseresponsesent.md │ │ │ │ ├── system-servicemodel-security-securitysessiondemuxfailure.md │ │ │ │ ├── system-servicemodel-security-securitysessionkeyrenewalfaultreceived.md │ │ │ │ ├── system-servicemodel-security-securitysessionredirectapplied.md │ │ │ │ ├── system-servicemodel-security-securitysessionrenewfaultsendfailure.md │ │ │ │ ├── system-servicemodel-security-securitysessionrequestoroperationfailure.md │ │ │ │ ├── system-servicemodel-security-securitysessionrequestoroperationsuccess.md │ │ │ │ ├── system-servicemodel-security-securitysessionresponderoperationfailure.md │ │ │ │ ├── system-servicemodel-security-securitysessionserverclosesendfailure.md │ │ │ │ ├── system-servicemodel-security-securitysessionserverclosesent.md │ │ │ │ ├── system-servicemodel-security-securityspntosidmappingfailure.md │ │ │ │ ├── system-servicemodel-security-securitytokenauthenticatorclosed.md │ │ │ │ ├── system-servicemodel-security-securitytokenauthenticatoropened.md │ │ │ │ ├── system-servicemodel-security-securitytokenproviderclosed.md │ │ │ │ ├── system-servicemodel-security-securitytokenprovideropened.md │ │ │ │ ├── system-servicemodel-security-servicesecuritynegotiationcompleted.md │ │ │ │ ├── system-servicemodel-security-spnegoclientnegotiationcompleted.md │ │ │ │ ├── system-servicemodel-security-spnegoservicenegotiationcompleted.md │ │ │ │ ├── system-servicemodel-servicechannellifetime.md │ │ │ │ ├── system-servicemodel-servicehostbaseaddresses.md │ │ │ │ ├── system-servicemodel-servicehostcreation.md │ │ │ │ ├── system-servicemodel-servicehosterroronreleaseperformancecounter.md │ │ │ │ ├── system-servicemodel-servicehostfaulted.md │ │ │ │ ├── system-servicemodel-servicehosttimeoutonclose.md │ │ │ │ ├── system-servicemodel-serviceoperationexceptiononreply.md │ │ │ │ ├── system-servicemodel-serviceoperationmissingreply.md │ │ │ │ ├── system-servicemodel-serviceoperationmissingreplycontext.md │ │ │ │ ├── system-servicemodel-servicethrottlelimitreached.md │ │ │ │ ├── system-servicemodel-skipbehavior.md │ │ │ │ ├── system-servicemodel-transportlisten.md │ │ │ │ ├── system-servicemodel-txasyncabort.md │ │ │ │ ├── system-servicemodel-txcompletionstatusabortedonsessionclose.md │ │ │ │ ├── system-servicemodel-txcompletionstatuscompletedforasyncabort.md │ │ │ │ ├── system-servicemodel-txcompletionstatuscompletedforautocomplete.md │ │ │ │ ├── system-servicemodel-txcompletionstatuscompletedforerror.md │ │ │ │ ├── system-servicemodel-txcompletionstatuscompletedforsetcomplete.md │ │ │ │ ├── system-servicemodel-txcompletionstatuscompletedfortacosc.md │ │ │ │ ├── system-servicemodel-txcompletionstatusremainsattached.md │ │ │ │ ├── system-servicemodel-txfailedtonegotiateoletx.md │ │ │ │ ├── system-servicemodel-txreleaseserviceinstanceoncompletion.md │ │ │ │ ├── system-servicemodel-txsourcetxscoperequiredisattachedtransaction.md │ │ │ │ ├── system-servicemodel-txsourcetxscoperequirediscreatenewtransaction.md │ │ │ │ ├── system-servicemodel-txsourcetxscoperequiredistransactedtransport.md │ │ │ │ ├── system-servicemodel-txsourcetxscoperequiredistransactionflow.md │ │ │ │ ├── system-servicemodel-understoodmessageheader.md │ │ │ │ ├── system-servicemodel-unhandledaction.md │ │ │ │ ├── system-servicemodel-unhandledexceptioninuseroperation.md │ │ │ │ ├── system-servicemodel-warnhelppageenablednobaseaddress.md │ │ │ │ ├── system-servicemodel-warnservicehealthenablednobaseaddress.md │ │ │ │ ├── system-servicemodel-wsmexnoncriticalwsdlexporterror.md │ │ │ │ ├── system-servicemodel-wsmexnoncriticalwsdlimporterror.md │ │ │ │ ├── toc.yml │ │ │ │ ├── trace-type-summary.md │ │ │ │ ├── traces-reference.md │ │ │ │ ├── transfer.md │ │ │ │ ├── using-service-trace-viewer-for-viewing-correlated-traces-and-troubleshooting.md │ │ │ │ └── using-tracing-to-troubleshoot-your-application.md │ │ │ ├── viewing-message-logs.md │ │ │ └── wmi │ │ │ │ ├── activitytransfer.md │ │ │ │ ├── appdomaininfo.md │ │ │ │ ├── aspnetcompatibilityrequirementsattribute.md │ │ │ │ ├── asymmetricsecuritybindingelement.md │ │ │ │ ├── behavior-class.md │ │ │ │ ├── binarymessageencodingbindingelement.md │ │ │ │ ├── binding.md │ │ │ │ ├── bindingelement.md │ │ │ │ ├── callbackbehavior.md │ │ │ │ ├── channel-class.md │ │ │ │ ├── channelpoolsettings.md │ │ │ │ ├── clientcredentials.md │ │ │ │ ├── clientviabehavior.md │ │ │ │ ├── compositeduplexbindingelement.md │ │ │ │ ├── connectionorientedtransportbindingelement.md │ │ │ │ ├── contract.md │ │ │ │ ├── custombindingelement.md │ │ │ │ ├── deliveryrequirementsattribute.md │ │ │ │ ├── endpoint.md │ │ │ │ ├── getoperationcounterinstancename.md │ │ │ │ ├── httpstransportbindingelement.md │ │ │ │ ├── httptransportbindingelement.md │ │ │ │ ├── index.md │ │ │ │ ├── localservicesecuritysettings.md │ │ │ │ ├── matchallendpointbehavior.md │ │ │ │ ├── messageencodingbindingelement.md │ │ │ │ ├── msmqbindingelementbase.md │ │ │ │ ├── msmqintegrationbindingelement.md │ │ │ │ ├── msmqtransportbindingelement.md │ │ │ │ ├── mtommessageencodingbindingelement.md │ │ │ │ ├── mustunderstandbehavior.md │ │ │ │ ├── namedpipeconnectionpoolsettings.md │ │ │ │ ├── namedpipetransportbindingelement.md │ │ │ │ ├── onewaybindingelement.md │ │ │ │ ├── operation-class.md │ │ │ │ ├── operationbehaviorattribute.md │ │ │ │ ├── peercustomresolverbindingelement.md │ │ │ │ ├── peerresolverbindingelement.md │ │ │ │ ├── peersecuritysettings.md │ │ │ │ ├── peertransportbindingelement.md │ │ │ │ ├── peertransportsecuritysettings.md │ │ │ │ ├── pnrppeerresolverbindingelement.md │ │ │ │ ├── privacynoticebindingelement.md │ │ │ │ ├── reliablesessionbindingelement.md │ │ │ │ ├── securitybindingelement.md │ │ │ │ ├── service.md │ │ │ │ ├── serviceappdomain.md │ │ │ │ ├── serviceauthorizationbehavior.md │ │ │ │ ├── servicebehaviorattribute.md │ │ │ │ ├── servicecredentials.md │ │ │ │ ├── servicedebugbehavior.md │ │ │ │ ├── servicemetadatabehavior.md │ │ │ │ ├── servicesecurityauditbehavior.md │ │ │ │ ├── servicethrottlingbehavior.md │ │ │ │ ├── servicetimeoutsbehavior.md │ │ │ │ ├── servicetoendpointassociation.md │ │ │ │ ├── sslstreamsecuritybindingelement.md │ │ │ │ ├── symmetricsecuritybindingelement.md │ │ │ │ ├── synchronousreceivebehavior.md │ │ │ │ ├── tcpconnectionpoolsettings.md │ │ │ │ ├── tcptransportbindingelement.md │ │ │ │ ├── textmessageencodingbindingelement.md │ │ │ │ ├── toc.yml │ │ │ │ ├── tracelistener.md │ │ │ │ ├── tracelistenerargument.md │ │ │ │ ├── transactedbatchingbehavior.md │ │ │ │ ├── transactionflowattribute.md │ │ │ │ ├── transactionflowbindingelement.md │ │ │ │ ├── transportbindingelement.md │ │ │ │ ├── transportsecuritybindingelement.md │ │ │ │ ├── usemanagedpresentationbindingelement.md │ │ │ │ ├── windowsstreamsecuritybindingelement.md │ │ │ │ ├── wmi-class-reference.md │ │ │ │ ├── wsat-traceevent.md │ │ │ │ ├── wsat-traceprovider.md │ │ │ │ ├── wsat-tracerecord.md │ │ │ │ ├── xmldictionaryreaderquotas.md │ │ │ │ └── xmlserializeroperationbehavior.md │ │ ├── endpoint-creation-overview.md │ │ ├── endpoints.md │ │ ├── extending │ │ │ ├── bindings-and-binding-elements.md │ │ │ ├── change-cryptographic-provider-x509-certificate-private-key.md │ │ │ ├── channel-model-overview.md │ │ │ ├── choosing-a-message-exchange-pattern.md │ │ │ ├── client-channel-factories-and-channels.md │ │ │ ├── client-channel-level-programming.md │ │ │ ├── configuration-and-metadata-support.md │ │ │ ├── configuring-and-extending-the-runtime-with-behaviors.md │ │ │ ├── creating-a-bindingelement.md │ │ │ ├── creating-user-defined-bindings.md │ │ │ ├── custom-authorization.md │ │ │ ├── custom-bindings.md │ │ │ ├── custom-credential-and-credential-validation.md │ │ │ ├── custom-encoders.md │ │ │ ├── custom-message-formatters.md │ │ │ ├── custom-stream-upgrades.md │ │ │ ├── custom-tokens.md │ │ │ ├── data-contract-surrogates.md │ │ │ ├── developing-channels.md │ │ │ ├── exporting-custom-metadata-for-a-wcf-extension.md │ │ │ ├── extending-bindings.md │ │ │ ├── extending-clients.md │ │ │ ├── extending-dispatchers.md │ │ │ ├── extending-encoders-and-serializers.md │ │ │ ├── extending-hosting-using-servicehostfactory.md │ │ │ ├── extending-security.md │ │ │ ├── extending-servicehost-and-the-service-model-layer.md │ │ │ ├── extending-the-channel-layer.md │ │ │ ├── extending-the-metadata-system.md │ │ │ ├── extensible-objects.md │ │ │ ├── handling-exceptions-and-faults.md │ │ │ ├── how-to-compare-claims.md │ │ │ ├── how-to-configure-a-custom-ws-metadata-exchange-binding.md │ │ │ ├── how-to-create-a-custom-authorization-manager-for-a-service.md │ │ │ ├── how-to-create-a-custom-authorization-policy.md │ │ │ ├── how-to-create-a-custom-claim.md │ │ │ ├── how-to-create-a-custom-client-identity-verifier.md │ │ │ ├── how-to-create-a-custom-principal-identity.md │ │ │ ├── how-to-create-a-custom-security-token-authenticator.md │ │ │ ├── how-to-create-a-custom-security-token-provider.md │ │ │ ├── how-to-create-a-custom-token.md │ │ │ ├── how-to-create-a-service-that-employs-a-custom-certificate-validator.md │ │ │ ├── how-to-customize-a-system-provided-binding.md │ │ │ ├── how-to-export-custom-policy-assertions.md │ │ │ ├── how-to-export-custom-wsdl.md │ │ │ ├── how-to-import-custom-policy-assertions.md │ │ │ ├── how-to-import-custom-wsdl.md │ │ │ ├── how-to-inspect-and-modify-messages-on-the-service.md │ │ │ ├── how-to-inspect-or-modify-messages-on-the-client.md │ │ │ ├── how-to-inspect-or-modify-parameters.md │ │ │ ├── how-to-lock-down-endpoints-in-the-enterprise.md │ │ │ ├── how-to-retrieve-metadata-over-a-non-mex-binding.md │ │ │ ├── how-to-use-separate-x-509-certificates-for-signing-and-encryption.md │ │ │ ├── how-to-write-an-extension-for-the-servicecontractgenerator.md │ │ │ ├── importing-custom-metadata-for-a-wcf-extension.md │ │ │ ├── index.md │ │ │ ├── media │ │ │ │ ├── channelstatetranitionshighleveldiagram.gif │ │ │ │ ├── dddea4a2-0bb4-4921-9bf4-20d4d82c3da5.gif │ │ │ │ ├── e4971edd-a59f-4571-b36f-7e6b2f0d610f.gif │ │ │ │ ├── wcfc-basicthreemepsc.gif │ │ │ │ ├── wcfc-channelstackhighlevelc.gif │ │ │ │ ├── wcfc-dispatchruntimearchc.gif │ │ │ │ ├── wcfc-sessionandsessionlesschannelsc.gif │ │ │ │ ├── wcfc-soap1-1andsoap1-2faultcomparisonc.gif │ │ │ │ ├── wcfc-tracinginchannelsc.gif │ │ │ │ ├── wcfc-wcfcchannelsigure3omumtreec.gif │ │ │ │ ├── wcfc-wcfchannelsguire7ico-closeflowchartc.gif │ │ │ │ ├── wcfc-wcfchannelsigure1highlevelc.gif │ │ │ │ ├── wcfc-wcfchannelsigure2highlevelfactgoriesc.gif │ │ │ │ ├── wcfc-wcfchannelsigure5statetransitionsdetailsc.gif │ │ │ │ ├── wcfc-wcfchannelsigure8ico-abortflowchartc.gif │ │ │ │ └── wcfc-wcfchannelsigurecoopenflowchartf.gif │ │ │ ├── overriding-the-identity-of-a-service-for-authentication.md │ │ │ ├── publishing-and-retrieving-metadata-over-a-custom-binding.md │ │ │ ├── service-channel-level-programming.md │ │ │ ├── service-channel-listeners-and-channels.md │ │ │ ├── specifying-a-custom-crypto-algorithm.md │ │ │ ├── toc.yml │ │ │ ├── understanding-state-changes.md │ │ │ ├── walkthrough-creating-custom-client-and-service-credentials.md │ │ │ └── ws-metadataexchange-bindings.md │ │ ├── feature-details │ │ │ ├── access-control-mechanisms.md │ │ │ ├── accessing-services-using-a-client.md │ │ │ ├── accessing-wcf-services-with-a-windows-store-client-app.md │ │ │ ├── adding-a-service-reference-in-a-workflow-solution.md │ │ │ ├── adding-online-and-offline-status.md │ │ │ ├── adopting-wcf.md │ │ │ ├── ajax-integration-and-json-support.md │ │ │ ├── anticipating-adopting-the-wcf-easing-future-integration.md │ │ │ ├── anticipating-adopting-wcf-migration.md │ │ │ ├── architecture-of-syndication.md │ │ │ ├── auditing-security-events.md │ │ │ ├── authentication-in-wcf.md │ │ │ ├── authorization-in-wcf.md │ │ │ ├── batching-messages-in-a-transaction.md │ │ │ ├── best-practices-for-queued-communication.md │ │ │ ├── best-practices-for-reliable-sessions.md │ │ │ ├── best-practices-for-security-in-wcf.md │ │ │ ├── bindings-and-security.md │ │ │ ├── bindings.md │ │ │ ├── building-a-peer-channel-application.md │ │ │ ├── caching-support-for-wcf-web-http-services.md │ │ │ ├── calling-a-rest-style-service-from-a-wcf-service.md │ │ │ ├── cert-val-diff-https-ssl-over-tcp-and-soap.md │ │ │ ├── changing-the-cache-sharing-levels-for-send-activities.md │ │ │ ├── channel-factory-and-caching.md │ │ │ ├── choosing-a-filter.md │ │ │ ├── choosing-a-message-encoder.md │ │ │ ├── choosing-a-transport.md │ │ │ ├── claim-creation-and-resource-values.md │ │ │ ├── claims-and-denying-access-to-resources.md │ │ │ ├── claims-and-tokens.md │ │ │ ├── client-app-discovery-proxy-to-find-a-service.md │ │ │ ├── client-architecture.md │ │ │ ├── client-configuration.md │ │ │ ├── clients.md │ │ │ ├── collection-types-in-data-contracts.md │ │ │ ├── common-security-scenarios.md │ │ │ ├── comparing-aspnet-web-services-to-wcf-based-on-development.md │ │ │ ├── comparing-aspnet-web-services-to-wcf-based-on-purpose-and-standards-used.md │ │ │ ├── comparing-transactions-in-com-and-servicemodel.md │ │ │ ├── config-wcf-service-with-aspnet-web-service.md │ │ │ ├── config-workflow-unhandled-exception-workflowservicehost.md │ │ │ ├── configuration-based-activation-in-iis-and-was.md │ │ │ ├── configuring-discovery-in-a-configuration-file.md │ │ │ ├── configuring-http-and-https.md │ │ │ ├── configuring-iis-for-wcf.md │ │ │ ├── configuring-serialization-in-a-workflow-service.md │ │ │ ├── configuring-system-provided-bindings.md │ │ │ ├── configuring-the-net-tcp-port-sharing-service.md │ │ │ ├── configuring-the-wpa--service-for-use-with-wcf.md │ │ │ ├── configuring-timeout-values-on-a-binding.md │ │ │ ├── configuring-workflowservicehost.md │ │ │ ├── configuring-ws-atomic-transaction-support.md │ │ │ ├── context-exchange-protocol.md │ │ │ ├── contracts.md │ │ │ ├── controlling-serialization-and-deserialization-with-serializationbinder.md │ │ │ ├── converting-a-nettcpbinding-application-to-a-peer-channel-application.md │ │ │ ├── correlation-overview.md │ │ │ ├── correlation.md │ │ │ ├── create-a-service-arbitrary-data-using-wcf.md │ │ │ ├── create-an-ajax-wcf-asp-net-client.md │ │ │ ├── creating-a-custom-header-that-is-signed-and-or-encrypted.md │ │ │ ├── creating-a-long-running-workflow-service.md │ │ │ ├── creating-multicasting-applications-using-the-udp-transport.md │ │ │ ├── creating-wcf-ajax-services-without-aspnet.md │ │ │ ├── creating-wcf-services-for-aspnet-ajax.md │ │ │ ├── custom-filters.md │ │ │ ├── data-contract-equivalence.md │ │ │ ├── data-contract-known-types.md │ │ │ ├── data-contract-names.md │ │ │ ├── data-contract-schema-reference.md │ │ │ ├── data-contract-serializer.md │ │ │ ├── data-contract-versioning.md │ │ │ ├── data-member-default-values.md │ │ │ ├── data-member-order.md │ │ │ ├── data-transfer-and-serialization.md │ │ │ ├── data-transfer-architectural-overview.md │ │ │ ├── debugging-windows-authentication-errors.md │ │ │ ├── delegation-and-impersonation-with-wcf.md │ │ │ ├── denial-of-service.md │ │ │ ├── deploying-an-internet-information-services-hosted-wcf-service.md │ │ │ ├── diagnosing-transactional-applications.md │ │ │ ├── diff-in-queue-in-vista-server-2003-windows-xp.md │ │ │ ├── diff-service-certificate-validation-ie-and-wcf.md │ │ │ ├── discoverable-service-that-registers-with-the-discovery-proxy.md │ │ │ ├── discovery-announcements-and-announcement-client.md │ │ │ ├── discovery-find-and-findcriteria.md │ │ │ ├── discovery-versioning.md │ │ │ ├── discoveryclient-and-dynamicendpoint.md │ │ │ ├── distributed-application-security.md │ │ │ ├── duplex-services.md │ │ │ ├── durable-duplex-correlation.md │ │ │ ├── elevation-of-privilege.md │ │ │ ├── enabling-transaction-flow.md │ │ │ ├── encoding-binary-objects-with-bytestream-encoder.md │ │ │ ├── encryption-of-digital-signatures.md │ │ │ ├── endpoint-addresses.md │ │ │ ├── endpoints-addresses-bindings-and-contracts.md │ │ │ ├── enumeration-types-in-data-contracts.md │ │ │ ├── error-handling.md │ │ │ ├── exporting-and-importing-metadata.md │ │ │ ├── exporting-schemas-from-classes.md │ │ │ ├── extended-protection-for-authentication-overview.md │ │ │ ├── federation-and-issued-tokens.md │ │ │ ├── federation-and-trust.md │ │ │ ├── federation.md │ │ │ ├── filtering.md │ │ │ ├── finding-claims-in-a-claimset.md │ │ │ ├── flowing-transactions-into-and-out-of-workflow-services.md │ │ │ ├── forward-compatible-data-contracts.md │ │ │ ├── generating-a-wcf-client-from-service-metadata.md │ │ │ ├── grouping-queued-messages-in-a-session.md │ │ │ ├── hosting-in-a-managed-application.md │ │ │ ├── hosting-in-a-windows-service-application.md │ │ │ ├── hosting-in-internet-information-services.md │ │ │ ├── hosting-in-windows-process-activation-service.md │ │ │ ├── hosting-workflow-services-overview.md │ │ │ ├── hosting-workflow-services.md │ │ │ ├── hosting.md │ │ │ ├── how-the-wcf-syndication-object-model-maps-to-atom-and-rss.md │ │ │ ├── how-to-access-a-service-from-a-workflow-application.md │ │ │ ├── how-to-access-a-wse-3-0-service-with-a-wcf-client.md │ │ │ ├── how-to-access-services-with-a-duplex-contract.md │ │ │ ├── how-to-access-wcf-services-with-one-way-and-request-reply-contracts.md │ │ │ ├── how-to-add-an-aspnet-ajax-endpoint-without-using-configuration.md │ │ │ ├── how-to-allow-metadata-requests-while-authorizing.md │ │ │ ├── how-to-audit-wcf-security-events.md │ │ │ ├── how-to-authenticate-with-a-user-name-and-password.md │ │ │ ├── how-to-call-operations-asynchronously-using-a-channel-factory.md │ │ │ ├── how-to-call-wcf-service-operations-asynchronously.md │ │ │ ├── how-to-configure-a-local-issuer.md │ │ │ ├── how-to-configure-a-port-with-an-ssl-certificate.md │ │ │ ├── how-to-configure-a-wcf-client-to-interoperate-with-wse3-0-services.md │ │ │ ├── how-to-configure-a-wcf-service-to-use-port-sharing.md │ │ │ ├── how-to-configure-an-iis-hosted-wcf-service-with-ssl.md │ │ │ ├── how-to-configure-com-service-settings.md │ │ │ ├── how-to-configure-credentials-on-a-federation-service.md │ │ │ ├── how-to-configure-idle-behavior-with-workflowservicehost.md │ │ │ ├── how-to-configure-persistence-with-workflowservicehost.md │ │ │ ├── how-to-configure-tracking-with-workflowservicehost.md │ │ │ ├── how-to-configure-wcf-services-to-interoperate-with-wse-3-0-clients.md │ │ │ ├── how-to-consistently-reference-x-509-certificates.md │ │ │ ├── how-to-control-service-instancing.md │ │ │ ├── how-to-create-a-basic-atom-feed.md │ │ │ ├── how-to-create-a-basic-data-contract-for-a-class-or-structure.md │ │ │ ├── how-to-create-a-basic-rss-feed.md │ │ │ ├── how-to-create-a-basic-wcf-web-http-service.md │ │ │ ├── how-to-create-a-channel-factory-and-use-it-to-create-and-manage-channels.md │ │ │ ├── how-to-create-a-custom-binding-using-the-securitybindingelement.md │ │ │ ├── how-to-create-a-custom-reliable-session-binding-with-https.md │ │ │ ├── how-to-create-a-duplex-contract.md │ │ │ ├── how-to-create-a-duplex-federated-binding.md │ │ │ ├── how-to-create-a-federated-client.md │ │ │ ├── how-to-create-a-one-way-contract.md │ │ │ ├── how-to-create-a-request-reply-contract.md │ │ │ ├── how-to-create-a-secure-session.md │ │ │ ├── how-to-create-a-security-context-token-for-a-secure-session.md │ │ │ ├── how-to-create-a-security-token-service.md │ │ │ ├── how-to-create-a-securitybindingelement-for-a-specified-authentication-mode.md │ │ │ ├── how-to-create-a-service-endpoint-in-code.md │ │ │ ├── how-to-create-a-service-endpoint-in-configuration.md │ │ │ ├── how-to-create-a-service-that-requires-sessions.md │ │ │ ├── how-to-create-a-service-with-a-contract-interface.md │ │ │ ├── how-to-create-a-supporting-credential.md │ │ │ ├── how-to-create-a-transactional-service.md │ │ │ ├── how-to-create-a-wcf-contract-with-a-class.md │ │ │ ├── how-to-create-a-wcf-service-that-communicates-over-websockets.md │ │ │ ├── how-to-create-a-workflow-service-with-messaging-activities.md │ │ │ ├── how-to-create-a-wsfederationhttpbinding.md │ │ │ ├── how-to-create-temporary-certificates-for-use-during-development.md │ │ │ ├── how-to-deploy-a-com-integration-application.md │ │ │ ├── how-to-determine-the-discovery-version-of-a-probe-request.md │ │ │ ├── how-to-disable-encryption-of-digital-signatures.md │ │ │ ├── how-to-disable-secure-sessions-on-a-wsfederationhttpbinding.md │ │ │ ├── how-to-dynamic-update.md │ │ │ ├── how-to-enable-message-replay-detection.md │ │ │ ├── how-to-enable-streaming.md │ │ │ ├── how-to-enable-the-net-tcp-port-sharing-service.md │ │ │ ├── how-to-error-handling.md │ │ │ ├── how-to-exchange-messages-with-wcf-endpoints-and-message-queuing-applications.md │ │ │ ├── how-to-exchange-messages-within-a-reliable-session.md │ │ │ ├── how-to-exchange-queued-messages-with-wcf-endpoints.md │ │ │ ├── how-to-export-metadata-from-service-endpoints.md │ │ │ ├── how-to-expose-a-contract-to-soap-and-web-clients.md │ │ │ ├── how-to-expose-a-feed-as-both-atom-and-rss.md │ │ │ ├── how-to-host-a-wcf-service-in-a-managed-windows-service.md │ │ │ ├── how-to-host-a-wcf-service-in-iis.md │ │ │ ├── how-to-host-a-wcf-service-in-was.md │ │ │ ├── how-to-host-a-workflow-service-with-windows-server-app-fabric.md │ │ │ ├── how-to-implement-a-discovery-proxy.md │ │ │ ├── how-to-import-metadata-into-service-endpoints.md │ │ │ ├── how-to-install-and-configure-wcf-activation-components.md │ │ │ ├── how-to-make-x-509-certificates-accessible-to-wcf.md │ │ │ ├── how-to-migrate-ajax-enabled-aspnet-web-services-to-wcf.md │ │ │ ├── how-to-obtain-a-certificate-wcf.md │ │ │ ├── how-to-programmatically-add-discoverability-to-a-wcf-service-and-client.md │ │ │ ├── how-to-publish-metadata-for-a-service-using-a-configuration-file.md │ │ │ ├── how-to-publish-metadata-for-a-service-using-code.md │ │ │ ├── how-to-register-and-configure-a-service-moniker.md │ │ │ ├── how-to-replace-the-wcf-url-reservation-with-a-restricted-reservation.md │ │ │ ├── how-to-retrieve-metadata-and-implement-a-compliant-service.md │ │ │ ├── how-to-retrieve-the-thumbprint-of-a-certificate.md │ │ │ ├── how-to-secure-a-service-with-an-x-509-certificate.md │ │ │ ├── how-to-secure-messages-within-reliable-sessions.md │ │ │ ├── how-to-secure-metadata-endpoints.md │ │ │ ├── how-to-serialize-and-deserialize-json-data.md │ │ │ ├── how-to-service-data-partitioning.md │ │ │ ├── how-to-service-versioning.md │ │ │ ├── how-to-set-a-max-clock-skew.md │ │ │ ├── how-to-set-up-a-signature-confirmation.md │ │ │ ├── how-to-specify-channel-security-credentials.md │ │ │ ├── how-to-test-the-discovery-proxy.md │ │ │ ├── how-to-use-a-custom-user-name-and-password-validator.md │ │ │ ├── how-to-use-a-service-moniker-with-metadata-exchange-contracts.md │ │ │ ├── how-to-use-a-service-moniker-with-wsdl-contracts.md │ │ │ ├── how-to-use-configuration-to-add-an-aspnet-ajax-endpoint.md │ │ │ ├── how-to-use-filters.md │ │ │ ├── how-to-use-metadataexchangeclient-to-retrieve-metadata.md │ │ │ ├── how-to-use-metadataresolver-to-obtain-binding-metadata-dynamically.md │ │ │ ├── how-to-use-multiple-security-tokens-of-the-same-type.md │ │ │ ├── how-to-use-svcutil-exe-to-download-metadata-documents.md │ │ │ ├── how-to-use-svcutil-exe-to-export-metadata-from-compiled-service-code.md │ │ │ ├── how-to-use-svcutil-exe-to-validate-compiled-service-code.md │ │ │ ├── how-to-use-the-aspnet-authorization-manager-role-provider-with-a-service.md │ │ │ ├── how-to-use-the-aspnet-membership-provider.md │ │ │ ├── how-to-use-the-aspnet-role-provider-with-a-service.md │ │ │ ├── how-to-use-the-channelfactory.md │ │ │ ├── how-to-use-the-com-service-model-configuration-tool.md │ │ │ ├── how-to-use-transport-security-and-message-credentials.md │ │ │ ├── how-to-view-certificates-with-the-mmc-snap-in.md │ │ │ ├── http-post-and-http-get-requests-for-aspnet-ajax-endpoints.md │ │ │ ├── http-transport-security.md │ │ │ ├── implementing-a-discovery-proxy.md │ │ │ ├── importing-schema-to-generate-classes.md │ │ │ ├── index.md │ │ │ ├── information-disclosure.md │ │ │ ├── inside-the-custompeerresolverservice-client-registrations.md │ │ │ ├── integrating-enterprise-services-transactional-components.md │ │ │ ├── integrating-with-com-applications-overview.md │ │ │ ├── integrating-with-com-applications.md │ │ │ ├── integrating-with-com-plus-applications-overview.md │ │ │ ├── integrating-with-com-plus-applications.md │ │ │ ├── internet-information-services-hosting-best-practices.md │ │ │ ├── internet-unsecured-client-and-service.md │ │ │ ├── interop-with-aspnet-web-services.md │ │ │ ├── interoperability-and-integration.md │ │ │ ├── interoperability-with-pox-applications.md │ │ │ ├── interoperability-with-web-services-enhancements-3-0.md │ │ │ ├── interoperable-object-references.md │ │ │ ├── intranet-unsecured-client-and-service.md │ │ │ ├── large-data-and-streaming.md │ │ │ ├── limiting-message-distribution.md │ │ │ ├── managing-claims-and-authorization-with-the-identity-model.md │ │ │ ├── mapping-between-json-and-xml.md │ │ │ ├── media │ │ │ │ ├── 0c9f9baa-2439-4ef9-92f4-43c242d85d0d.gif │ │ │ │ ├── 1c8618d4-0005-4022-beb6-32fd087a8c3c.gif │ │ │ │ ├── 1fb10a61-7e1d-42f5-b1af-195bfee5b3c6.gif │ │ │ │ ├── 4f3695e0-fb0b-4c5b-afac-75f8860d2bb0.jpg │ │ │ │ ├── 8f7b8968-899f-4538-a9e8-0eaa872a291c.gif │ │ │ │ ├── 8fa2e931-0cfb-4aaa-9272-91d652b85d8d.gif │ │ │ │ ├── ado-net-entity-data-model-item-template.png │ │ │ │ ├── appfabricconfiguration-general.gif │ │ │ │ ├── appfabricconfiguration-management.gif │ │ │ │ ├── appfabricconfiguration-monitoring.gif │ │ │ │ ├── appfabricconfiguration-persistence.gif │ │ │ │ ├── appfabricconfiguration-security.gif │ │ │ │ ├── b361a565-831c-4c10-90d7-66d8eeece0a1.gif │ │ │ │ ├── configuring-serialization-in-a-workflow-service │ │ │ │ │ ├── known-types-properties.png │ │ │ │ │ ├── setting-serializer-property.png │ │ │ │ │ └── type-collection-editor.gif │ │ │ │ ├── create-an-ajax-wcf-asp-net-client │ │ │ │ │ ├── add-wcf-service.png │ │ │ │ │ └── new-asp-net-web-app-type.png │ │ │ │ ├── creating-a-long-running-workflow-service │ │ │ │ │ ├── add-an-assign-activity.png │ │ │ │ │ ├── add-correlationinitializers.png │ │ │ │ │ ├── add-receive-two-parameters.png │ │ │ │ │ ├── add-the-itemid-variable.png │ │ │ │ │ ├── add-variables-sequential-service-activity.gif │ │ │ │ │ ├── assign-result-of-service-call.png │ │ │ │ │ ├── correlateson-setting.png │ │ │ │ │ ├── send-reply-activity-property.png │ │ │ │ │ ├── set-properties-for-receive-content.png │ │ │ │ │ ├── set-properties-for-reply-activities.png │ │ │ │ │ ├── set-property-for-sendreplytoadditem.gif │ │ │ │ │ ├── set-receive-activities-properties.png │ │ │ │ │ ├── set-receive-activity-properties.png │ │ │ │ │ ├── setreplycontent-for-sendreplytostartorder-activity.png │ │ │ │ │ ├── start-action-specific-page-option.png │ │ │ │ │ └── use-local-web-server.png │ │ │ │ ├── distributed-queue-figure.jpg │ │ │ │ ├── f4157312-b17c-416c-a5ee-fa7b54db211b.gif │ │ │ │ ├── federation │ │ │ │ │ ├── federated-security-implementation.gif │ │ │ │ │ ├── federation-myservice-service-call-process.gif │ │ │ │ │ ├── myservice-security-token-service-b.gif │ │ │ │ │ ├── myserviceendpoint-details.gif │ │ │ │ │ └── typical-federated-security-scenario.gif │ │ │ │ ├── flowing-transactions-into-and-out-of-workflow-services │ │ │ │ │ ├── add-activity-project.jpg │ │ │ │ │ ├── add-receive-activity.jpg │ │ │ │ │ ├── add-transactedreceivescope-variables.jpg │ │ │ │ │ ├── add-workflow-service.jpg │ │ │ │ │ ├── add-writeline-activity.jpg │ │ │ │ │ ├── after-adding-printtransactioninfo.jpg │ │ │ │ │ ├── after-adding-sbr-writeline.jpg │ │ │ │ │ ├── after-adding-writelines.jpg │ │ │ │ │ ├── client-add-cbs-writeline.jpg │ │ │ │ │ ├── client-complete-workflow.jpg │ │ │ │ │ ├── client-reply-message-settings.jpg │ │ │ │ │ ├── client-send-activity-settings.jpg │ │ │ │ │ ├── receive-message-settings.jpg │ │ │ │ │ ├── reply-message-settings.jpg │ │ │ │ │ ├── send-message-settings.jpg │ │ │ │ │ ├── service-complete-workflow.jpg │ │ │ │ │ ├── transactedreceivescope-activity.jpg │ │ │ │ │ └── transactionscope-variables.jpg │ │ │ │ ├── how-to-access-a-service-from-a-workflow-application │ │ │ │ │ ├── add-instring-variable.jpg │ │ │ │ │ ├── add-new-project-dialog.jpg │ │ │ │ │ ├── add-service-reference-dialog.jpg │ │ │ │ │ ├── add-service-reference.jpg │ │ │ │ │ ├── bind-arguments-variables.jpg │ │ │ │ │ ├── complete-client-workflow.jpg │ │ │ │ │ ├── echo-activity-toolbox.jpg │ │ │ │ │ ├── ie-wcf-help-page-uri.jpg │ │ │ │ │ └── startup-project-options.jpg │ │ │ │ ├── how-to-create-a-workflow-service-with-messaging-activities │ │ │ │ │ ├── add-variable-msg-string.jpg │ │ │ │ │ ├── adding-parameters-content.jpg │ │ │ │ │ ├── asp-net-dev-server-icon.jpg │ │ │ │ │ ├── cancreateinstance-property.jpg │ │ │ │ │ ├── default-workflow-service.jpg │ │ │ │ │ ├── define-operation-name.jpg │ │ │ │ │ ├── outmsg-parameters-content.jpg │ │ │ │ │ ├── project-properties-dialog.jpg │ │ │ │ │ ├── receiveandsendreply-template.jpg │ │ │ │ │ ├── toolbox-messaging-section.jpg │ │ │ │ │ └── wcf-service-help-page.jpg │ │ │ │ ├── how-to-host-a-workflow-service-with-windows-server-app-fabric │ │ │ │ │ ├── app-fabric-auto-start-configuration.gif │ │ │ │ │ ├── app-fabric-dashboard.gif │ │ │ │ │ ├── app-fabric-throttling-configuration.gif │ │ │ │ │ └── persisted-workflow-instance-detail.gif │ │ │ │ ├── internet-unsecured-client-and-service │ │ │ │ │ └── public-unsecured-internet.gif │ │ │ │ ├── intranet-unsecured-client-and-service │ │ │ │ │ └── unsecured-web-client-service.gif │ │ │ │ ├── managing-claims-and-authorization-with-the-identity-model │ │ │ │ │ ├── claims-sets-hierarchy.gif │ │ │ │ │ └── multiple-claim-sets-same-issuing-claim-set.gif │ │ │ │ ├── message-security-with-a-certificate-client │ │ │ │ │ └── client-with-certificate.gif │ │ │ │ ├── mg-addsslbinding.jpg │ │ │ │ ├── mg-createselfsignedcert.jpg │ │ │ │ ├── mg-inetmgrhome.jpg │ │ │ │ ├── mg-mycert.jpg │ │ │ │ ├── mg-mycertbinding.jpg │ │ │ │ ├── mg-servercertificatewindow.jpg │ │ │ │ ├── mg-sitebindingsdialog.jpg │ │ │ │ ├── mg-sslsettingsforvdir.jpg │ │ │ │ ├── mg-vdirsslsettings.JPG │ │ │ │ ├── mmc-add-certificate-snap-in.png │ │ │ │ ├── mmc-certificate-snap-in-selected.png │ │ │ │ ├── qconceptual-figure1c.gif │ │ │ │ ├── qwithtransactions-figure3.gif │ │ │ │ ├── scfc-turnfeaturesonoroff5s.gif │ │ │ │ ├── side-by-side-versioning-in-workflowservicehost │ │ │ │ │ ├── definitionidentity-property.bmp │ │ │ │ │ └── definitionidentity-workflowidentity.bmp │ │ │ │ ├── sts-b.gif │ │ │ │ ├── transaction-protocols │ │ │ │ │ └── transaction-managers-flow.gif │ │ │ │ ├── transport-security-with-basic-authentication │ │ │ │ │ └── transport-security-basic-authentication.gif │ │ │ │ ├── transport-security-with-windows-authentication │ │ │ │ │ └── secured-windows-authentication.gif │ │ │ │ ├── troubleshooting-queued-messaging │ │ │ │ │ └── enable-distributed-transaction-coordinator-access.jpg │ │ │ │ ├── was-activation-architecture │ │ │ │ │ └── windows-process-application-service-architecture.gif │ │ │ │ ├── wcf-services-and-aspnet │ │ │ │ │ └── windows-communication-foundation-services-asp-dotnet-configuration.gif │ │ │ │ ├── wcf-web-http-service-help-page │ │ │ │ │ ├── windows-communication-foundation-rest-help-page-detail.gif │ │ │ │ │ └── windows-communication-foundation-rest-help-page.gif │ │ │ │ ├── wcfc-trunfeaturesonoroff3s.gif │ │ │ │ ├── wcfc-trustedsubsystemc.gif │ │ │ │ ├── wcfc-turnfeaturesonoroffs.gif │ │ │ │ ├── wcfc-turningfeaturesonoroff2.gif │ │ │ │ ├── windows-features-iis.png │ │ │ │ ├── workflow-service-host-internals │ │ │ │ │ ├── workflow-service-host-high-level-overview.gif │ │ │ │ │ ├── workflow-service-host-message-flow.gif │ │ │ │ │ ├── workflow-service-host-open.gif │ │ │ │ │ ├── workflow-service-host-receive-message-cancreateinstance.gif │ │ │ │ │ └── workflow-service-host-receive-message.gif │ │ │ │ └── xsi-recap.gif │ │ │ ├── message-filters.md │ │ │ ├── message-security-in-wcf.md │ │ │ ├── message-security-with-a-certificate-client.md │ │ │ ├── message-security-with-a-user-name-client.md │ │ │ ├── message-security-with-a-windows-client-without-credential-negotiation.md │ │ │ ├── message-security-with-a-windows-client.md │ │ │ ├── message-security-with-an-anonymous-client.md │ │ │ ├── message-security-with-issued-tokens.md │ │ │ ├── message-security-with-mutual-certificates.md │ │ │ ├── messaging-activities.md │ │ │ ├── messaging-protocols.md │ │ │ ├── metadata-architecture-overview.md │ │ │ ├── metadata-formats.md │ │ │ ├── metadata.md │ │ │ ├── middle-tier-client-applications.md │ │ │ ├── migrating-aspnet-web-services-to-wcf.md │ │ │ ├── migrating-net-remoting-applications-to-wcf.md │ │ │ ├── migrating-wse-3-0-web-services-to-wcf.md │ │ │ ├── mixing-trust-protocols-in-federated-scenarios.md │ │ │ ├── net-tcp-port-sharing.md │ │ │ ├── one-way-services.md │ │ │ ├── ordered-processing-of-messages-in-single-concurrency-mode.md │ │ │ ├── out-of-order-message-processing.md │ │ │ ├── partial-trust-best-practices.md │ │ │ ├── partial-trust-feature-compatibility.md │ │ │ ├── partial-trust.md │ │ │ ├── peer-channel-concepts.md │ │ │ ├── peer-channel-scenarios.md │ │ │ ├── peer-channel-security.md │ │ │ ├── peer-meshes.md │ │ │ ├── peer-nodes.md │ │ │ ├── peer-resolvers.md │ │ │ ├── peer-to-peer-networking.md │ │ │ ├── performance-considerations.md │ │ │ ├── poison-message-handling.md │ │ │ ├── preventing-replay-attacks-when-a-wcf-service-is-hosted-in-a-web-farm.md │ │ │ ├── programming-wcf-security.md │ │ │ ├── publishing-metadata.md │ │ │ ├── queues-and-reliable-sessions.md │ │ │ ├── queues-in-wcf.md │ │ │ ├── queues-overview.md │ │ │ ├── queuing-in-wcf.md │ │ │ ├── readme-for-extended-protection-authentication-sample.md │ │ │ ├── reliable-messaging-protocol-version-1-0.md │ │ │ ├── reliable-messaging-protocol-version-1-1.md │ │ │ ├── reliable-sessions-overview.md │ │ │ ├── reliable-sessions.md │ │ │ ├── replay-attacks.md │ │ │ ├── request-reply-correlation.md │ │ │ ├── request-reply-services.md │ │ │ ├── retrieving-metadata.md │ │ │ ├── routing-contracts.md │ │ │ ├── routing-introduction.md │ │ │ ├── routing-scenarios.md │ │ │ ├── routing-service.md │ │ │ ├── routing.md │ │ │ ├── saml-tokens-and-claims.md │ │ │ ├── schema-import-and-export.md │ │ │ ├── secure-conversations-and-secure-sessions.md │ │ │ ├── secure-sessions.md │ │ │ ├── securing-messages-using-message-security.md │ │ │ ├── securing-messages-using-transport-security.md │ │ │ ├── securing-peer-channel-applications.md │ │ │ ├── securing-services-and-clients.md │ │ │ ├── security-behaviors-in-wcf.md │ │ │ ├── security-capabilities-with-custom-bindings.md │ │ │ ├── security-concepts-used-in-wcf.md │ │ │ ├── security-concepts.md │ │ │ ├── security-considerations-for-data.md │ │ │ ├── security-considerations-for-secure-sessions.md │ │ │ ├── security-considerations-in-wcf.md │ │ │ ├── security-considerations-with-metadata.md │ │ │ ├── security-guidance-and-best-practices.md │ │ │ ├── security-negotiation-and-timeouts.md │ │ │ ├── security-overview.md │ │ │ ├── security-protocols-version-1-0.md │ │ │ ├── security-protocols.md │ │ │ ├── security.md │ │ │ ├── securitybindingelement-authentication-modes.md │ │ │ ├── selecting-a-credential-type.md │ │ │ ├── serializable-types.md │ │ │ ├── serialization-and-deserialization.md │ │ │ ├── serializing-in-json-with-message-level-programming.md │ │ │ ├── service-endpoints-and-queue-addressing.md │ │ │ ├── service-identity-and-authentication.md │ │ │ ├── service-returns-arbitrary-data-using-the-wcf-web.md │ │ │ ├── servicedescription-and-wsdl-reference.md │ │ │ ├── servicemodel-attributes-and-servicedescription-reference.md │ │ │ ├── servicemodel-transaction-attributes.md │ │ │ ├── servicemodel-transaction-configuration.md │ │ │ ├── sessions-instancing-and-concurrency.md │ │ │ ├── side-by-side-versioning-in-workflowservicehost.md │ │ │ ├── specify-the-certificate-authority-chain-verify-signatures-wcf.md │ │ │ ├── specifying-data-transfer-in-service-contracts.md │ │ │ ├── stand-alone-json-serialization.md │ │ │ ├── standard-endpoints.md │ │ │ ├── startup-time-of-wcf-client-applications-using-the-xmlserializer.md │ │ │ ├── streaming-message-transfer.md │ │ │ ├── support-for-json-and-other-data-transfer-formats.md │ │ │ ├── supported-deployment-scenarios.md │ │ │ ├── supporting-multiple-iis-site-bindings.md │ │ │ ├── syndication-extensibility.md │ │ │ ├── system-web-routing-integration.md │ │ │ ├── tampering.md │ │ │ ├── toc.yml │ │ │ ├── transaction-models.md │ │ │ ├── transaction-protocols-version-1-0.md │ │ │ ├── transaction-protocols.md │ │ │ ├── transactional-support-in-system-servicemodel.md │ │ │ ├── transactions-in-wcf.md │ │ │ ├── transactions-overview.md │ │ │ ├── transport-quotas.md │ │ │ ├── transport-security-overview.md │ │ │ ├── transport-security-with-an-anonymous-client.md │ │ │ ├── transport-security-with-basic-authentication.md │ │ │ ├── transport-security-with-certificate-authentication.md │ │ │ ├── transport-security-with-windows-authentication.md │ │ │ ├── transport-security.md │ │ │ ├── transports.md │ │ │ ├── troubleshooting-correlation.md │ │ │ ├── troubleshooting-queued-messaging.md │ │ │ ├── trusted-subsystem.md │ │ │ ├── types-supported-by-the-data-contract-serializer.md │ │ │ ├── understanding-generated-client-code.md │ │ │ ├── understanding-http-authentication.md │ │ │ ├── unsupported-scenarios.md │ │ │ ├── uritemplate-and-uritemplatetable.md │ │ │ ├── use-the-wcf-service-moniker-without-registration.md │ │ │ ├── using-a-custom-binding-with-the-discovery-client-channel.md │ │ │ ├── using-a-data-contract-resolver.md │ │ │ ├── using-contracts-in-workflow.md │ │ │ ├── using-data-contracts.md │ │ │ ├── using-dead-letter-queues-to-handle-message-transfer-failures.md │ │ │ ├── using-impersonation-with-transport-security.md │ │ │ ├── using-jsonp.md │ │ │ ├── using-message-contracts.md │ │ │ ├── using-metadata.md │ │ │ ├── using-multiple-authentication-schemes-with-wcf.md │ │ │ ├── using-servicethrottlingbehavior-to-control-wcf-service-performance.md │ │ │ ├── using-the-discovery-client-channel.md │ │ │ ├── using-the-message-class.md │ │ │ ├── using-the-nethttpbinding.md │ │ │ ├── using-the-xmlserializer-class.md │ │ │ ├── using-ws-atomictransaction.md │ │ │ ├── version-tolerant-serialization-callbacks.md │ │ │ ├── was-activation-architecture.md │ │ │ ├── wcf-and-internationalized-domain-names.md │ │ │ ├── wcf-and-websockets.md │ │ │ ├── wcf-discovery-object-model.md │ │ │ ├── wcf-discovery-overview.md │ │ │ ├── wcf-discovery.md │ │ │ ├── wcf-security-terminology.md │ │ │ ├── wcf-services-and-aspnet.md │ │ │ ├── wcf-syndication-overview.md │ │ │ ├── wcf-syndication.md │ │ │ ├── wcf-web-http-error-handling.md │ │ │ ├── wcf-web-http-formatting.md │ │ │ ├── wcf-web-http-programming-model-overview.md │ │ │ ├── wcf-web-http-programming-model.md │ │ │ ├── wcf-web-http-programming-object-model.md │ │ │ ├── wcf-web-http-service-help-page.md │ │ │ ├── web-hosting-a-queued-application.md │ │ │ ├── web-services-protocols-interoperability-guide.md │ │ │ ├── web-services-protocols-supported-by-system-provided-interoperability-bindings.md │ │ │ ├── workflow-control-endpoint.md │ │ │ ├── workflow-service-host-extensibility.md │ │ │ ├── workflow-service-host-internals.md │ │ │ ├── workflow-services-overview.md │ │ │ ├── workflow-services.md │ │ │ ├── working-with-certificates.md │ │ │ ├── working-with-nats-and-firewalls.md │ │ │ ├── wsdl-and-policy.md │ │ │ └── xml-and-ado-net-types-in-data-contracts.md │ │ ├── feedback-and-community.md │ │ ├── find-private-key-tool-findprivatekey-exe.md │ │ ├── fundamental-concepts.md │ │ ├── general-reference.md │ │ ├── generating-data-type-classes-from-xml.md │ │ ├── getting-started-tutorial.md │ │ ├── glossary.md │ │ ├── guide-to-the-documentation.md │ │ ├── guidelines-and-best-practices.md │ │ ├── host-a-wcf-service-net-framework-3-5-iis--net-framework-4.md │ │ ├── hosting-services.md │ │ ├── how-to-create-a-wcf-client.md │ │ ├── how-to-declare-faults-in-service-contracts.md │ │ ├── how-to-define-a-wcf-service-contract.md │ │ ├── how-to-examine-the-security-context.md │ │ ├── how-to-host-a-wcf-service-in-a-managed-application.md │ │ ├── how-to-host-and-run-a-basic-wcf-service.md │ │ ├── how-to-impersonate-a-client-on-a-service.md │ │ ├── how-to-implement-a-wcf-contract.md │ │ ├── how-to-implement-an-asynchronous-service-operation.md │ │ ├── how-to-restrict-access-with-the-principalpermissionattribute-class.md │ │ ├── how-to-secure-a-service-with-windows-credentials.md │ │ ├── how-to-set-the-protectionlevel-property.md │ │ ├── how-to-set-the-security-mode.md │ │ ├── how-to-specify-a-client-binding-in-code.md │ │ ├── how-to-specify-a-client-binding-in-configuration.md │ │ ├── how-to-specify-a-service-binding-in-code.md │ │ ├── how-to-specify-a-service-binding-in-configuration.md │ │ ├── how-to-specify-client-credential-values.md │ │ ├── how-to-specify-the-client-credential-type.md │ │ ├── how-to-use-a-wcf-client.md │ │ ├── implementing-service-contracts.md │ │ ├── index.md │ │ ├── interpreting-error-codes-returned-by-wsatconfig-exe.md │ │ ├── introduction-to-extensibility.md │ │ ├── load-balancing.md │ │ ├── media │ │ │ ├── 1060d9d2-c9c8-4e0a-9988-cdc2f7030f17.gif │ │ │ ├── 1df215cb-b344-4f36-a20d-195999bda741.gif │ │ │ ├── 29fa00ac-cf78-46e5-822d-56222fff61d1.gif │ │ │ ├── 2f628580-b80f-45a7-925b-616c96426c0e.gif │ │ │ ├── 558943c4-17cf-4c12-9405-677e995ac387.gif │ │ │ ├── 5dc8e0eb-1c32-4076-8c66-594935beaee9.gif │ │ │ ├── 6f7f4191-df2b-4592-8998-8379769e2d32.gif │ │ │ ├── 74255b6e-7c47-46ef-8e53-870c76b04c3f.gif │ │ │ ├── 7457c4ed-8383-4ac7-bada-bcb27409da58.gif │ │ │ ├── 7c66e994-2476-4260-a0db-98948b9af197.gif │ │ │ ├── 7d908807-4967-4f6d-9226-d52125db69ca.gif │ │ │ ├── 8a728f91-5f80-4a95-afe8-0b6acd6e0317.gif │ │ │ ├── a0493e95-653e-4af8-84a4-4d09a400bc31.gif │ │ │ ├── b2d9850e-f362-4ae5-bb8d-9f6f3ca036a5.gif │ │ │ ├── contract-first-tool │ │ │ │ ├── advanced-contract-settings.png │ │ │ │ ├── contract-first-options.png │ │ │ │ └── service-contract-types.png │ │ │ ├── d7b135f6-ec7d-45d7-9913-037ab30e4c26.gif │ │ │ ├── de4f586c-c5dd-41ec-b1c3-ac56b4dfa35c.gif │ │ │ ├── wcf-architecture.gif │ │ │ ├── wcfc-defaultactivityc.gif │ │ │ └── wcfc-executionactivityiconc.GIF │ │ ├── migrating-from-net-remoting-to-wcf.md │ │ ├── operating-system-resources-required-by-wcf.md │ │ ├── privacy-information.md │ │ ├── publishing-metadata-endpoints.md │ │ ├── reliable-services.md │ │ ├── renaming-a-wcf-service.md │ │ ├── samples │ │ │ ├── address-headers.md │ │ │ ├── addressing.md │ │ │ ├── ajax-service-using-complex-types-sample.md │ │ │ ├── ajax-service-using-http-post.md │ │ │ ├── ajax-service-with-json-and-xml-sample.md │ │ │ ├── ajax-service-without-configuration.md │ │ │ ├── ajax.md │ │ │ ├── announcements-sample.md │ │ │ ├── asmx-client-with-a-wcf-service.md │ │ │ ├── aspnet-caching-integration.md │ │ │ ├── aspnet-compatibility.md │ │ │ ├── authorization-policy.md │ │ │ ├── authorizing-access-to-service-operations.md │ │ │ ├── basic-ajax-service.md │ │ │ ├── basic-binding.md │ │ │ ├── basic-data-contract.md │ │ │ ├── basic-http-service.md │ │ │ ├── basic-sample.md │ │ │ ├── basic.md │ │ │ ├── basicbinding-with-transport-security.md │ │ │ ├── basicbinding.md │ │ │ ├── behavior-security.md │ │ │ ├── behaviors.md │ │ │ ├── binding-extensibility.md │ │ │ ├── binding.md │ │ │ ├── building-the-samples.md │ │ │ ├── channel-factory.md │ │ │ ├── channels-extensibility.md │ │ │ ├── chunking-channel.md │ │ │ ├── circular-tracing.md │ │ │ ├── client-interoperability.md │ │ │ ├── client-validation.md │ │ │ ├── client.md │ │ │ ├── concurrency.md │ │ │ ├── concurrencymode-reentrant.md │ │ │ ├── configuration-channel-factory.md │ │ │ ├── configuration-sample.md │ │ │ ├── configurationcodegenerator.md │ │ │ ├── contract.md │ │ │ ├── cryptographic-agility-in-wcf-security.md │ │ │ ├── custom-binding-imperative.md │ │ │ ├── custom-binding-reliable-session-over-https.md │ │ │ ├── custom-binding-reliable-session.md │ │ │ ├── custom-binding-security.md │ │ │ ├── custom-binding-transport-and-encoding.md │ │ │ ├── custom-binding.md │ │ │ ├── custom-channel-dispatcher.md │ │ │ ├── custom-find-criteria.md │ │ │ ├── custom-lifetime.md │ │ │ ├── custom-message-encoder-compression-encoder.md │ │ │ ├── custom-message-encoder-custom-text-encoder.md │ │ │ ├── custom-message-filter.md │ │ │ ├── custom-message-interceptor.md │ │ │ ├── custom-secure-metadata-endpoint.md │ │ │ ├── custom-service-host.md │ │ │ ├── custom-token.md │ │ │ ├── custom-wsdl-publication.md │ │ │ ├── customchannelstester.md │ │ │ ├── data-binding-in-a-windows-forms-client.md │ │ │ ├── data-binding-in-a-wpf-client.md │ │ │ ├── data-binding-in-an-aspnet-client.md │ │ │ ├── data-binding-scenarios.md │ │ │ ├── data-contracts.md │ │ │ ├── datacontract-surrogate.md │ │ │ ├── datacontractresolver.md │ │ │ ├── datacontractserializer-datacontractresolver-netdatacontractserializer.md │ │ │ ├── datacontractserializer-sample.md │ │ │ ├── dead-letter-queues.md │ │ │ ├── default-message-contract.md │ │ │ ├── default-nettcpbinding.md │ │ │ ├── default-service-behavior.md │ │ │ ├── design-patterns-list-based-publish-subscribe.md │ │ │ ├── discovery-router-service.md │ │ │ ├── discovery-samples.md │ │ │ ├── discovery-security-sample.md │ │ │ ├── discovery-with-scopes-sample.md │ │ │ ├── dispatch-by-body-element.md │ │ │ ├── duplex.md │ │ │ ├── durable-instance-context.md │ │ │ ├── durable-issued-token-provider.md │ │ │ ├── etw-tracing.md │ │ │ ├── expected-exceptions.md │ │ │ ├── extended-protection-policy.md │ │ │ ├── extending-control-over-error-handling-and-reporting.md │ │ │ ├── extending-tracing.md │ │ │ ├── extensibility.md │ │ │ ├── fault-contract.md │ │ │ ├── federation-sample.md │ │ │ ├── feed-formatter-json.md │ │ │ ├── findprivatekey.md │ │ │ ├── firewall-instructions.md │ │ │ ├── getting-started-sample.md │ │ │ ├── hello-world-with-the-routing-service.md │ │ │ ├── hosting.md │ │ │ ├── httpcookiesession.md │ │ │ ├── iis-hosting-using-inline-code.md │ │ │ ├── iis-server-certificate-installation-instructions.md │ │ │ ├── imperative.md │ │ │ ├── impersonating-the-client.md │ │ │ ├── index.md │ │ │ ├── installing-message-queuing-msmq.md │ │ │ ├── instancing-extensibility.md │ │ │ ├── instancing-initialization.md │ │ │ ├── instancing.md │ │ │ ├── internet-information-service-hosting-instructions.md │ │ │ ├── interop-extensibility.md │ │ │ ├── interoperating-with-asmx-web-services.md │ │ │ ├── json-serialization.md │ │ │ ├── jsonp.md │ │ │ ├── known-types.md │ │ │ ├── knownassemblyattribute.md │ │ │ ├── local-channel.md │ │ │ ├── loosely-typed-extensions-sample.md │ │ │ ├── management.md │ │ │ ├── media │ │ │ │ ├── chunking-channel │ │ │ │ │ ├── chunking-channel-receive.gif │ │ │ │ │ └── chunking-channel-send.gif │ │ │ │ └── iiscertificate-wizard.GIF │ │ │ ├── membership-and-role-provider.md │ │ │ ├── message-contracts.md │ │ │ ├── message-correlation.md │ │ │ ├── message-encoder-extensibility.md │ │ │ ├── message-inspectors.md │ │ │ ├── message-queueing-integration.md │ │ │ ├── message-queuing-to-wcf.md │ │ │ ├── message-security-anonymous.md │ │ │ ├── message-security-binding.md │ │ │ ├── message-security-certificate.md │ │ │ ├── message-security-over-message-queuing.md │ │ │ ├── message-security-sample.md │ │ │ ├── message-security-user-name.md │ │ │ ├── message-security-windows.md │ │ │ ├── metadata-extensibility.md │ │ │ ├── metadata-publishing-behavior.md │ │ │ ├── msmq-activation.md │ │ │ ├── mtom-encoding.md │ │ │ ├── multiple-contracts.md │ │ │ ├── multiple-endpoints-at-a-single-listenuri.md │ │ │ ├── multiple-endpoints.md │ │ │ ├── namedpipe-activation.md │ │ │ ├── net-binding.md │ │ │ ├── net-msmq-binding.md │ │ │ ├── net-tcp-port-sharing-sample.md │ │ │ ├── netnamedpipebinding.md │ │ │ ├── nettcpbinding.md │ │ │ ├── object-references.md │ │ │ ├── one-time-setup-procedure-for-the-wcf-samples.md │ │ │ ├── one-way.md │ │ │ ├── operation-formatter-and-operation-selector.md │ │ │ ├── operationcontextscope.md │ │ │ ├── pii-security-lockdown.md │ │ │ ├── poco-support.md │ │ │ ├── poison-message-handling-in-msmq-4-0.md │ │ │ ├── pooling.md │ │ │ ├── reliable-secure-profile.md │ │ │ ├── retrieve-metadata.md │ │ │ ├── route-by-body.md │ │ │ ├── routing-services.md │ │ │ ├── running-the-samples.md │ │ │ ├── saml-token-provider.md │ │ │ ├── scenario.md │ │ │ ├── security-extensibility.md │ │ │ ├── security-in-wcf.md │ │ │ ├── security-validation.md │ │ │ ├── self-host.md │ │ │ ├── service-auditing-behavior.md │ │ │ ├── service-contracts.md │ │ │ ├── service-debug-behavior.md │ │ │ ├── service-description.md │ │ │ ├── service-identity-sample.md │ │ │ ├── service-interoperability.md │ │ │ ├── service-security.md │ │ │ ├── service-transaction-behavior.md │ │ │ ├── services.md │ │ │ ├── session.md │ │ │ ├── sessions-and-queues.md │ │ │ ├── set-up-instructions.md │ │ │ ├── setting-the-use-and-style-properties.md │ │ │ ├── simplified-configuration-for-wcf-services.md │ │ │ ├── soap-and-http-endpoints.md │ │ │ ├── srmp.md │ │ │ ├── stand-alone-diagnostics-feed-sample.md │ │ │ ├── stream.md │ │ │ ├── streaming-feeds-sample.md │ │ │ ├── strongly-typed-extensions-sample.md │ │ │ ├── supporting-tokens.md │ │ │ ├── syndication-extensibility-samples.md │ │ │ ├── syndication.md │ │ │ ├── systemwebrouting-integration-sample.md │ │ │ ├── tcp-activation.md │ │ │ ├── throttling.md │ │ │ ├── toc.yml │ │ │ ├── token-authenticator.md │ │ │ ├── token-provider.md │ │ │ ├── tool-samples.md │ │ │ ├── tracing-and-message-logging.md │ │ │ ├── transacted-msmq-binding.md │ │ │ ├── transport-custom-transactions-over-udp-sample.md │ │ │ ├── transport-extensibility.md │ │ │ ├── transport-udp.md │ │ │ ├── transport-wse-3-0-tcp-interoperability.md │ │ │ ├── trusted-facade-service.md │ │ │ ├── two-way-communication.md │ │ │ ├── typed-client.md │ │ │ ├── udp-activation.md │ │ │ ├── untyped-request-reply.md │ │ │ ├── unwrapped-messages.md │ │ │ ├── uritemplate-sample.md │ │ │ ├── uritemplate-table-dispatcher-sample.md │ │ │ ├── uritemplate-table-sample.md │ │ │ ├── usage-of-serialization-binder.md │ │ │ ├── usage-of-standard-endpoints.md │ │ │ ├── use-close-abort-release-wcf-client-resources.md │ │ │ ├── user-name-password-validator.md │ │ │ ├── using-performance-counters.md │ │ │ ├── using-the-wcf-moniker-with-com-clients.md │ │ │ ├── virtual-directory-setup-instructions.md │ │ │ ├── volatile-queued-communication.md │ │ │ ├── wcf-analytic-tracing.md │ │ │ ├── wcf-services-and-event-tracing-for-windows.md │ │ │ ├── wcf-to-message-queuing.md │ │ │ ├── weakly-typed-json-serialization-sample.md │ │ │ ├── web.md │ │ │ ├── webcontenttypemapper-sample.md │ │ │ ├── windows-process-activation.md │ │ │ ├── windows-service-host.md │ │ │ ├── wmi-provider.md │ │ │ ├── workflow-discovery-sample.md │ │ │ ├── ws-2007-federation-http-binding.md │ │ │ ├── ws-binding.md │ │ │ ├── ws-dual-http.md │ │ │ ├── ws-reliable-session.md │ │ │ ├── ws-transaction-flow.md │ │ │ ├── ws-transport-security.md │ │ │ ├── ws-transport-with-message-credential.md │ │ │ ├── wshttpbinding.md │ │ │ ├── wsstreamedhttpbinding.md │ │ │ ├── x-509-certificate-validator.md │ │ │ ├── xmlreader-sample.md │ │ │ ├── xmlserializer-faults.md │ │ │ └── xmlserializer-sample.md │ │ ├── securing-clients.md │ │ ├── securing-services.md │ │ ├── sending-and-receiving-faults.md │ │ ├── service-trace-viewer-tool-svctraceviewer-exe.md │ │ ├── service-versioning.md │ │ ├── servicemodel-metadata-utility-tool-svcutil-exe.md │ │ ├── servicemodelreg-exe.md │ │ ├── services-and-transactions.md │ │ ├── simplified-configuration.md │ │ ├── specifying-an-endpoint-address.md │ │ ├── specifying-and-handling-faults-in-contracts-and-services.md │ │ ├── specifying-client-run-time-behavior.md │ │ ├── specifying-service-run-time-behavior.md │ │ ├── synchronous-and-asynchronous-operations.md │ │ ├── system-provided-bindings.md │ │ ├── toc.yml │ │ ├── tools.md │ │ ├── troubleshooting-setup-issues.md │ │ ├── troubleshooting-the-getting-started-tutorial.md │ │ ├── understanding-protection-level.md │ │ ├── using-bindings-to-configure-services-and-clients.md │ │ ├── using-sessions.md │ │ ├── using-the-wcf-development-tools.md │ │ ├── wcf-and-aspnet-web-api.md │ │ ├── wcf-and-net-framework-client-profile.md │ │ ├── wcf-client-overview.md │ │ ├── wcf-error-handling.md │ │ ├── wcf-service-host-wcfsvchost-exe.md │ │ ├── wcf-service-publishing.md │ │ ├── wcf-simplification-features.md │ │ ├── wcf-test-client-wcftestclient-exe.md │ │ ├── wcf-troubleshooting-quickstart.md │ │ ├── wcf-vs-templates.md │ │ ├── whats-new.md │ │ ├── whats-wcf.md │ │ ├── workflow-service-registration-tool-wfservicesreg-exe.md │ │ ├── ws-atomictransaction-configuration-mmc-snap-in.md │ │ └── ws-atomictransaction-configuration-utility-wsatconfig-exe.md │ ├── whats-new │ │ ├── index.md │ │ ├── media │ │ │ ├── button-themes-after.png │ │ │ ├── button-themes-before.png │ │ │ ├── combo-disabled-after.png │ │ │ ├── combo-disabled-before.png │ │ │ ├── comboboxstylekey-after.png │ │ │ ├── comboboxstylekey-before.png │ │ │ ├── default-link-style-after.png │ │ │ ├── default-link-style-before.png │ │ │ ├── expander-after.png │ │ │ ├── expander-before.png │ │ │ ├── radio-button-after.png │ │ │ ├── radio-button-before.png │ │ │ ├── selectiontextbrush-property.png │ │ │ ├── sort-indicator-after.png │ │ │ ├── sort-indicator-before.png │ │ │ ├── tooltip.png │ │ │ ├── wf-disabled-after.png │ │ │ └── wf-disabled-before.png │ │ ├── obsolete-members.md │ │ ├── obsolete-types.md │ │ ├── toc.yml │ │ ├── whats-new-in-accessibility.md │ │ └── whats-obsolete.md │ ├── windows-services │ │ ├── how-to-add-installers-to-your-service-application.md │ │ ├── how-to-continue-a-windows-service-visual-basic.md │ │ ├── how-to-create-windows-services.md │ │ ├── how-to-debug-windows-service-applications.md │ │ ├── how-to-install-and-uninstall-services.md │ │ ├── how-to-log-information-about-services.md │ │ ├── how-to-pause-a-windows-service-visual-basic.md │ │ ├── how-to-specify-the-security-context-for-services.md │ │ ├── how-to-start-services.md │ │ ├── how-to-write-services-programmatically.md │ │ ├── index.md │ │ ├── introduction-to-windows-service-applications.md │ │ ├── media │ │ │ ├── new-project-dialog.png │ │ │ ├── windows-service-description.png │ │ │ ├── windows-service-event-viewer.png │ │ │ ├── windows-service-installer-properties.png │ │ │ ├── windows-service-properties.png │ │ │ ├── windows-service-rename.png │ │ │ ├── windowsservice-servicename.PNG │ │ │ └── windowsservices-serviceswindow.PNG │ │ ├── service-application-programming-architecture.md │ │ ├── toc.yml │ │ ├── troubleshooting-debugging-windows-services.md │ │ ├── troubleshooting-service-application-wont-install.md │ │ └── walkthrough-creating-a-windows-service-application-in-the-component-designer.md │ ├── windows-workflow-foundation │ │ ├── 100-workflowinstancerecord.md │ │ ├── 1001-workflowapplicationcompleted.md │ │ ├── 1002-workflowapplicationterminated.md │ │ ├── 1003-workflowinstancecanceled.md │ │ ├── 1004-workflowinstanceaborted.md │ │ ├── 1005-workflowapplicationidled.md │ │ ├── 1006-workflowapplicationunhandledexception.md │ │ ├── 1007-workflowapplicationpersisted.md │ │ ├── 1008-workflowapplicationunloaded.md │ │ ├── 1009-activityscheduled.md │ │ ├── 101-workflowinstanceunhandledexceptionrecord.md │ │ ├── 1010-activitycompleted.md │ │ ├── 1011-scheduleexecuteactivityworkitem.md │ │ ├── 1012-startexecuteactivityworkitem.md │ │ ├── 1013-completeexecuteactivityworkitem.md │ │ ├── 1014-schedulecompletionworkitem.md │ │ ├── 1015-startcompletionworkitem.md │ │ ├── 1016-completecompletionworkitem.md │ │ ├── 1017-schedulecancelactivityworkitem.md │ │ ├── 1018-startcancelactivityworkitem.md │ │ ├── 1019-completecancelactivityworkitem.md │ │ ├── 102-workflowinstanceabortedrecord.md │ │ ├── 1020-createbookmark.md │ │ ├── 1021-schedulebookmarkworkitem.md │ │ ├── 1022-startbookmarkworkitem.md │ │ ├── 1023-completebookmarkworkitem.md │ │ ├── 1024-createbookmarkscope.md │ │ ├── 1025-bookmarkscopeinitialized.md │ │ ├── 1026-scheduletransactioncontextworkitem.md │ │ ├── 1027-starttransactioncontextworkitem.md │ │ ├── 1028-completetransactioncontextworkitem.md │ │ ├── 1029-schedulefaultworkitem.md │ │ ├── 103-activitystaterecord.md │ │ ├── 1030-startfaultworkitem.md │ │ ├── 1031-completefaultworkitem.md │ │ ├── 1032-scheduleruntimeworkitem.md │ │ ├── 1033-startruntimeworkitem.md │ │ ├── 1034-completeruntimeworkitem.md │ │ ├── 1035-runtimetransactionset.md │ │ ├── 1036-runtimetransactioncompletionrequested.md │ │ ├── 1037-runtimetransactioncomplete.md │ │ ├── 1038-enternopersistblock.md │ │ ├── 1039-exitnopersistblock.md │ │ ├── 104-activityscheduledrecord.md │ │ ├── 1040-inargumentbound.md │ │ ├── 1041-workflowapplicationpersistableidle.md │ │ ├── 105-faultpropagationrecord.md │ │ ├── 106-cancelrequestrecord.md │ │ ├── 107-bookmarkresumptionrecord.md │ │ ├── 108-customtrackingrecordinfo.md │ │ ├── 110-customtrackingrecordwarning.md │ │ ├── 1101-workflowactivitystart.md │ │ ├── 1102-workflowactivitystop.md │ │ ├── 1103-workflowactivitysuspend.md │ │ ├── 1104-workflowactivityresume.md │ │ ├── 111-customtrackingrecorderror.md │ │ ├── 112-workflowinstancesuspendedrecord.md │ │ ├── 1124-invokemethodisstatic.md │ │ ├── 1125-invokemethodisnotstatic.md │ │ ├── 1126-invokedmethodthrewexception.md │ │ ├── 113-workflowinstanceterminatedrecord.md │ │ ├── 1131-invokemethoduseasyncpattern.md │ │ ├── 1132-invokemethoddoesnotuseasyncpattern.md │ │ ├── 114-workflowinstancerecordwithid.md │ │ ├── 1140-flowchartstart.md │ │ ├── 1141-flowchartempty.md │ │ ├── 1143-flowchartnextnull.md │ │ ├── 1146-flowchartswitchcase.md │ │ ├── 1147-flowchartswitchdefault.md │ │ ├── 1148-flowchartswitchcasenotfound.md │ │ ├── 115-workflowinstanceabortedrecordwithid.md │ │ ├── 1150-compensationstate.md │ │ ├── 116-workflowinstancesuspendedrecordwithid.md │ │ ├── 117-workflowinstanceterminatedrecordwithid.md │ │ ├── 118-workflowinstanceunhandledexceptionrecordwithid.md │ │ ├── 119-workflowinstanceupdatedrecord.md │ │ ├── 1223-switchcasenotfound.md │ │ ├── 1449-wfmessagereceived.md │ │ ├── 1450-wfmessagesent.md │ │ ├── 2021-executeworkitemstart.md │ │ ├── 2022-executeworkitemstop.md │ │ ├── 2023-sendmessagechannelcachemiss.md │ │ ├── 2024-internalcachemetadatastart.md │ │ ├── 2025-internalcachemetadatastop.md │ │ ├── 2026-compilevbexpressionstart.md │ │ ├── 2027-cacherootmetadatastart.md │ │ ├── 2028-cacherootmetadatastop.md │ │ ├── 2029-compilevbexpressionstop.md │ │ ├── 225-tracecorrelationkeys.md │ │ ├── 2576-trycatchexceptionfromtry.md │ │ ├── 2577-trycatchexceptionduringcancelation.md │ │ ├── 2578-trycatchexceptionfromcatchorfinally.md │ │ ├── 3501-inferredcontractdescription.md │ │ ├── 3502-inferredoperationdescription.md │ │ ├── 3503-duplicatecorrelationquery.md │ │ ├── 3507-serviceendpointadded.md │ │ ├── 3508-trackingprofilenotfound.md │ │ ├── 3550-bufferoutofordermessagenoinstance.md │ │ ├── 3551-bufferoutofordermessagenobookmark.md │ │ ├── 3552-maxpendingmessagesperchannelexceeded.md │ │ ├── 3557-transactedreceivescopeendcommitfailed.md │ │ ├── 39456-trackingrecorddropped.md │ │ ├── 39457-trackingrecordraised.md │ │ ├── 39458-trackingrecordtruncated.md │ │ ├── 39459-trackingdataextracted.md │ │ ├── 39460-trackingvaluenotserializable.md │ │ ├── 4201-endsqlcommandexecute.md │ │ ├── 4202-startsqlcommandexecute.md │ │ ├── 4203-renewlocksystemerror.md │ │ ├── 4205-foundprocessingerror.md │ │ ├── 4206-unlockinstanceexception.md │ │ ├── 4207-maximumretriesexceededforsqlcommand.md │ │ ├── 4208-retryingsqlcommandduetosqlerror.md │ │ ├── 4209-timeoutopeningsqlconnection.md │ │ ├── 4210-sqlexceptioncaught.md │ │ ├── 4211-queuingsqlretry.md │ │ ├── 4212-lockretrytimeout.md │ │ ├── 4213-runnableinstancesdetectionerror.md │ │ ├── 4214-instancelocksrecoveryerror.md │ │ ├── 440-startsignpostevent.md │ │ ├── 441-stopsignpostevent.md │ │ ├── 57398-maxinstancesexceeded.md │ │ ├── activity-authoring-options-in-wf.md │ │ ├── activity-definition-scoping-and-visibility.md │ │ ├── activity-tree-inspection.md │ │ ├── architecture.md │ │ ├── authoring-workflows-activities-and-expressions-using-imperative-code.md │ │ ├── binding-a-custom-activity-property-to-a-designer-control.md │ │ ├── bookmarks.md │ │ ├── collection-activities-in-wf.md │ │ ├── compensation.md │ │ ├── conceptual-overview.md │ │ ├── configuring-activity-validation.md │ │ ├── configuring-tracking-for-a-workflow.md │ │ ├── connection-string-and-connection-string-name.md │ │ ├── consuming-odata-feeds-from-a-workflow.md │ │ ├── contract-first-workflow-service-development.md │ │ ├── control-flow-activities-in-wf.md │ │ ├── creating-an-activity-at-runtime-with-dynamicactivity.md │ │ ├── creating-asynchronous-activities-in-wf.md │ │ ├── creating-custom-flow-control-activities.md │ │ ├── csharp-expressions.md │ │ ├── custom-tracking-records.md │ │ ├── customizing-the-workflow-design-experience.md │ │ ├── data-model.md │ │ ├── debugging-workflows.md │ │ ├── declarative-constraints.md │ │ ├── deprecated-types.md │ │ ├── designing-and-implementing-custom-activities.md │ │ ├── designing-workflows.md │ │ ├── dynamic-update.md │ │ ├── error-handling-activities-in-wf.md │ │ ├── error-handling-in-asynchronous-activities.md │ │ ├── exceptions-transactions-and-compensation.md │ │ ├── exceptions.md │ │ ├── exposing-data-with-cachemetadata.md │ │ ├── expressions.md │ │ ├── extend.md │ │ ├── feature-specifics.md │ │ ├── flowchart-activities-in-wf.md │ │ ├── flowchart-workflows.md │ │ ├── fundamental-concepts.md │ │ ├── getting-started-tutorial.md │ │ ├── glossary.md │ │ ├── guide-to-the-documentation.md │ │ ├── host-lock-renewal-period.md │ │ ├── hosting-workflows.md │ │ ├── how-to-create-a-custom-activity-designer.md │ │ ├── how-to-create-a-custom-activity-template.md │ │ ├── how-to-create-a-custom-instance-store.md │ │ ├── how-to-create-a-custom-persistence-participant.md │ │ ├── how-to-create-a-custom-tracking-participant.md │ │ ├── how-to-create-a-flowchart-workflow.md │ │ ├── how-to-create-a-sequential-workflow.md │ │ ├── how-to-create-a-state-machine-workflow.md │ │ ├── how-to-create-a-workflow-service-that-consumes-an-existing-service-contract.md │ │ ├── how-to-create-a-workflow.md │ │ ├── how-to-create-an-activity.md │ │ ├── how-to-create-and-run-a-long-running-workflow.md │ │ ├── how-to-deserialize-instance-data-properties.md │ │ ├── how-to-display-validation-errors-in-a-rehosted-designer.md │ │ ├── how-to-enable-persistence-for-workflows-and-workflow-services.md │ │ ├── how-to-enable-sql-persistence-for-workflows-and-workflow-services.md │ │ ├── how-to-host-multiple-versions-of-a-workflow-side-by-side.md │ │ ├── how-to-query-for-non-persisted-instances.md │ │ ├── how-to-run-a-workflow.md │ │ ├── how-to-update-the-definition-of-a-running-workflow-instance.md │ │ ├── imperative-code-based-validation.md │ │ ├── index.md │ │ ├── instance-activation.md │ │ ├── instance-completion-action.md │ │ ├── instance-encoding-option.md │ │ ├── instance-locked-exception-action.md │ │ ├── instance-stores.md │ │ ├── invoking-activity-validation.md │ │ ├── media │ │ │ ├── 44c79d1d-178b-4487-87ed-3e33015a3842.gif │ │ │ ├── configuring-tracking-for-a-workflow │ │ │ │ └── tracking-event-viewer.png │ │ │ ├── consuming-odata-feeds-from-a-workflow │ │ │ │ └── add-service-reference-dialog.gif │ │ │ ├── csharp-expressions │ │ │ │ └── auto-surround-sequence-activity.png │ │ │ ├── how-to-create-a-flowchart-workflow │ │ │ │ └── completed-windows-workflow-flowchart.png │ │ │ ├── how-to-create-a-sequential-workflow │ │ │ │ └── complete-sequential-workflow.jpg │ │ │ ├── how-to-create-a-state-machine-workflow │ │ │ │ └── complete-state-machine-workflow.jpg │ │ │ ├── how-to-create-and-run-a-long-running-workflow │ │ │ │ └── windows-workflow-foundation-workflowhostform.png │ │ │ ├── overview │ │ │ │ └── workflow-component-interatction.gif │ │ │ ├── performance │ │ │ │ ├── basic-compensation-workflows-wf3-wf4.gif │ │ │ │ ├── complex-memory-usage-wf3-wf4.gif │ │ │ │ ├── complex-workflow-throughput-workflow.gif │ │ │ │ ├── complex-workflow-wf3-wf4.gif │ │ │ │ ├── correlation-persistence-graph.gif │ │ │ │ ├── correlation-throughput-graph.gif │ │ │ │ ├── correlation-throughput-workflow.gif │ │ │ │ ├── latency-results-graph.gif │ │ │ │ ├── latency-throughput-environment-setup.gif │ │ │ │ ├── nested-sequence-workflow.gif │ │ │ │ ├── number-activities-equation.gif │ │ │ │ ├── online-store-performance-graph.gif │ │ │ │ ├── performance-test-chart.gif │ │ │ │ ├── performance-test-data.gif │ │ │ │ ├── performance-test-environment.gif │ │ │ │ ├── persist-workflow-wf3-wf4.gif │ │ │ │ ├── replicator-parallel-wf3-wf4.gif │ │ │ │ ├── throughput-performance-results.gif │ │ │ │ ├── throughput-persistence-graph.gif │ │ │ │ ├── wf3-number-activities-equation.gif │ │ │ │ ├── wf3-workflow-snippet.gif │ │ │ │ ├── wf4-correlationscope-workflow.gif │ │ │ │ ├── workflow-receive-activity.gif │ │ │ │ ├── workflow-tracking-costs.gif │ │ │ │ └── workflow-variation-compare-table.gif │ │ │ ├── pick-activity │ │ │ │ └── pick-activity-two-branches.jpg │ │ │ ├── state-machine-workflows │ │ │ │ ├── complete-state-machine-workflow.jpg │ │ │ │ └── state-machine-section-toolbox.jpg │ │ │ ├── tracking-participants │ │ │ │ └── tracking-data-event-tracing-windows-provider.gif │ │ │ ├── wf-features-in-the-rehosted-workflow-designer │ │ │ │ ├── auto-connect-points-start-node.png │ │ │ │ ├── auto-insert-connecting-line.png │ │ │ │ ├── auto-surround-sequence-activity.png │ │ │ │ ├── auto-surround-write-line-activity.png │ │ │ │ ├── complete-state-machine-workflow.jpg │ │ │ │ ├── designer-annotations-context-menu.png │ │ │ │ ├── designer-context-menu.png │ │ │ │ ├── outline-view-in-workflow-designer.jpg │ │ │ │ └── pan-button-workflow-designer.png │ │ │ ├── whats-new-in-wf-in-dotnet │ │ │ │ ├── auto-connect-points-start-node.png │ │ │ │ ├── auto-insert-connecting-line.png │ │ │ │ ├── auto-surround-sequence-activity.png │ │ │ │ ├── auto-surround-write-line-activity.png │ │ │ │ ├── complete-state-machine-workflow.jpg │ │ │ │ ├── designer-annotations-context-menu.png │ │ │ │ ├── designer-context-menu.png │ │ │ │ ├── outline-view-in-workflow-designer.jpg │ │ │ │ └── pan-button-workflow-designer.png │ │ │ └── workflow-tracking-and-tracing │ │ │ │ └── workflow-tracking-infrastructure.gif │ │ ├── migration-activity-in-wf.md │ │ ├── migration-guidance.md │ │ ├── modeling-cancellation-behavior-in-workflows.md │ │ ├── nativeactivity-base-class.md │ │ ├── net-framework-3-0-wf-in-net-framework-4-interop.md │ │ ├── net-framework-4-5-built-in-activity-library.md │ │ ├── non-persisted-workflow-instances.md │ │ ├── overview.md │ │ ├── pausing-and-resuming-a-workflow.md │ │ ├── performance.md │ │ ├── persistence-best-practices.md │ │ ├── persistence-database-schema.md │ │ ├── persistence-participants.md │ │ ├── pick-activity.md │ │ ├── primitives-activities-in-wf.md │ │ ├── procedural-workflows.md │ │ ├── programming.md │ │ ├── properties-of-sql-workflow-instance-store.md │ │ ├── properties-vs-arguments.md │ │ ├── rehosting-the-workflow-designer.md │ │ ├── required-arguments-and-overload-groups.md │ │ ├── runnable-instances-detection-period.md │ │ ├── runtime-activities-in-wf.md │ │ ├── samples │ │ │ ├── accessing-operationcontext.md │ │ │ ├── activity-library.md │ │ │ ├── application.md │ │ │ ├── asynchronous-communication.md │ │ │ ├── basic.md │ │ │ ├── bookmark-resolver-for-workflowhostingendpoint.md │ │ │ ├── built-in-activities.md │ │ │ ├── code-bodied.md │ │ │ ├── corporate-purchase-process.md │ │ │ ├── creating-and-running-a-workflow-instance.md │ │ │ ├── custom-activities.md │ │ │ ├── custom-activity-designers.md │ │ │ ├── custom-composite-designers-workflow-item-presenter.md │ │ │ ├── custom-composite-designers-workflow-items-presenter.md │ │ │ ├── custom-composite-using-native-activity.md │ │ │ ├── custom-tracking.md │ │ │ ├── database-access-activities.md │ │ │ ├── designer-rehosting.md │ │ │ ├── designer.md │ │ │ ├── document-approval-process.md │ │ │ ├── execution.md │ │ │ ├── external-ruleset-toolkit.md │ │ │ ├── externalized-policy-activity-in-net-framework-4-5.md │ │ │ ├── fault-handling-in-a-flowchart-activity-using-trycatch.md │ │ │ ├── get-workflowinstanceid.md │ │ │ ├── hiring-process.md │ │ │ ├── index.md │ │ │ ├── linq-message-query-correlation.md │ │ │ ├── load-from-xaml.md │ │ │ ├── media │ │ │ │ ├── 71f08d57-e8f2-499e-8151-ece2cbdcabfd.gif │ │ │ │ ├── document-approval-process │ │ │ │ │ └── document-approval-process.jpg │ │ │ │ ├── external-ruleset-toolkit │ │ │ │ │ ├── ruleset-browser-dialog.gif │ │ │ │ │ ├── ruleset-editor-dialog.gif │ │ │ │ │ ├── ruleset-selector-dialog.gif │ │ │ │ │ ├── ruleset-toolkit-overview.gif │ │ │ │ │ └── validation-errors-dialog.png │ │ │ │ └── programming-model-item-tree │ │ │ │ │ └── workflow-designer-architecture.jpg │ │ │ ├── non-generic-foreach.md │ │ │ ├── non-generic-parallelforeach.md │ │ │ ├── programming-model-item-tree.md │ │ │ ├── property-grid-extensibility.md │ │ │ ├── removing-the-view-state-the-designer-adds-to-an-xaml-file.md │ │ │ ├── scenario.md │ │ │ ├── sendmail-custom-activity.md │ │ │ ├── sql-tracking.md │ │ │ ├── suspended-instance-management.md │ │ │ ├── throttled-parallel-foreach.md │ │ │ ├── toc.yml │ │ │ ├── tracking-events-into-event-tracing-in-windows.md │ │ │ ├── tracking.md │ │ │ ├── using-editing-scope.md │ │ │ ├── using-the-expressiontextbox-in-a-custom-activity-designer.md │ │ │ ├── using-the-pick-activity.md │ │ │ ├── visual-workflow-tracking.md │ │ │ ├── workflowhostingendpoint-resume-bookmark.md │ │ │ └── wpf-and-wf-integration-in-xaml.md │ │ ├── security.md │ │ ├── serializing-workflows-and-activities-to-and-from-xaml.md │ │ ├── sql-server-persistence-database.md │ │ ├── sql-workflow-instance-store.md │ │ ├── state-machine-activities-in-wf.md │ │ ├── state-machine-workflows.md │ │ ├── store-extensibility.md │ │ ├── support-for-queries.md │ │ ├── task-1-create-a-new-wpf-app.md │ │ ├── task-2-host-the-workflow-designer.md │ │ ├── task-3-create-the-toolbox-and-propertygrid-panes.md │ │ ├── toc.yml │ │ ├── tracking-events-reference.md │ │ ├── tracking-participants.md │ │ ├── tracking-profiles.md │ │ ├── tracking-records.md │ │ ├── transaction-activities-in-wf.md │ │ ├── using-a-custom-activity.md │ │ ├── using-a-custom-expression-editor.md │ │ ├── using-activity-delegates.md │ │ ├── using-activity-extensions.md │ │ ├── using-and-creating-activities.md │ │ ├── using-custom-activity-designers-and-templates.md │ │ ├── using-the-modelitem-editing-context.md │ │ ├── using-tracking-to-troubleshoot-applications.md │ │ ├── using-workflowidentity-and-versioning.md │ │ ├── using-workflowinvoker-and-workflowapplication.md │ │ ├── variable-and-argument-tracking.md │ │ ├── variables-and-arguments.md │ │ ├── waiting-for-input-in-a-workflow.md │ │ ├── wf-features-in-the-rehosted-workflow-designer.md │ │ ├── wf-migration-guidance.md │ │ ├── whats-new-in-wf-in-dotnet.md │ │ ├── whats-new.md │ │ ├── workflow-activity-authoring-using-the-activity-class.md │ │ ├── workflow-activity-authoring-using-the-codeactivity-class.md │ │ ├── workflow-execution-properties.md │ │ ├── workflow-hosting-options.md │ │ ├── workflow-persistence.md │ │ ├── workflow-security.md │ │ ├── workflow-tracing.md │ │ ├── workflow-tracking-and-tracing.md │ │ └── workflow-transactions.md │ ├── winforms │ │ ├── additional-security-considerations-in-windows-forms.md │ │ ├── adjusting-the-size-and-scale-of-windows-forms.md │ │ ├── advanced │ │ │ ├── about-gdi-managed-code.md │ │ │ ├── alpha-blending-lines-and-fills.md │ │ │ ├── antialiasing-with-lines-and-curves.md │ │ │ ├── application-settings-architecture.md │ │ │ ├── application-settings-attributes.md │ │ │ ├── application-settings-for-custom-controls.md │ │ │ ├── application-settings-for-windows-forms.md │ │ │ ├── application-settings-overview.md │ │ │ ├── bezier-splines-in-gdi.md │ │ │ ├── bi-directional-support-for-windows-forms-applications.md │ │ │ ├── brushes-and-filled-shapes-in-gdi.md │ │ │ ├── cardinal-splines-in-gdi.md │ │ │ ├── com-interop-by-displaying-a-windows-form-shadow.md │ │ │ ├── constructing-and-drawing-curves.md │ │ │ ├── constructing-and-drawing-paths.md │ │ │ ├── control-help-using-tooltips.md │ │ │ ├── coordinate-systems-and-transformations.md │ │ │ ├── cropping-and-scaling-images-in-gdi.md │ │ │ ├── display-of-asian-characters-with-the-imemode-property.md │ │ │ ├── double-buffered-graphics.md │ │ │ ├── drag-and-drop-operations-and-clipboard-support.md │ │ │ ├── drawing-positioning-and-cloning-images-in-gdi.md │ │ │ ├── effects-of-modifying-base-form-appearance.md │ │ │ ├── ellipses-and-arcs-in-gdi.md │ │ │ ├── getting-started-with-graphics-programming.md │ │ │ ├── global-and-local-transformations.md │ │ │ ├── globalizing-windows-forms.md │ │ │ ├── graphics-and-drawing-in-windows-forms.md │ │ │ ├── graphics-overview-windows-forms.md │ │ │ ├── graphics-paths-in-gdi.md │ │ │ ├── help-systems-in-windows-forms-applications.md │ │ │ ├── how-to-add-data-to-the-clipboard.md │ │ │ ├── how-to-add-multiple-sets-of-settings-to-your-application-in-csharp.md │ │ │ ├── how-to-align-drawn-text.md │ │ │ ├── how-to-apply-gamma-correction-to-a-gradient.md │ │ │ ├── how-to-arrange-mdi-child-forms.md │ │ │ ├── how-to-capture-user-input-from-a-printdialog-at-run-time.md │ │ │ ├── how-to-change-the-value-of-a-setting-between-application-sessions.md │ │ │ ├── how-to-change-the-value-of-an-existing-setting-at-design-time.md │ │ │ ├── how-to-choose-the-printers-attached-to-user-computer-in-windows-forms.md │ │ │ ├── how-to-complete-windows-forms-print-jobs.md │ │ │ ├── how-to-construct-font-families-and-fonts.md │ │ │ ├── how-to-convert-a-bmp-image-to-a-png-image.md │ │ │ ├── how-to-copy-and-paste-an-elementhost-control-at-design-time.md │ │ │ ├── how-to-copy-pixels-for-reducing-flicker-in-windows-forms.md │ │ │ ├── how-to-create-a-bitmap-at-run-time.md │ │ │ ├── how-to-create-a-linear-gradient.md │ │ │ ├── how-to-create-a-new-setting-at-design-time.md │ │ │ ├── how-to-create-a-path-gradient.md │ │ │ ├── how-to-create-a-pen.md │ │ │ ├── how-to-create-a-private-font-collection.md │ │ │ ├── how-to-create-a-shaped-windows-form.md │ │ │ ├── how-to-create-a-solid-brush.md │ │ │ ├── how-to-create-application-settings.md │ │ │ ├── how-to-create-figures-from-lines-curves-and-shapes.md │ │ │ ├── how-to-create-graphics-objects-for-drawing.md │ │ │ ├── how-to-create-mdi-child-forms.md │ │ │ ├── how-to-create-mdi-parent-forms.md │ │ │ ├── how-to-create-standard-windows-forms-print-jobs.md │ │ │ ├── how-to-create-thumbnail-images.md │ │ │ ├── how-to-create-vertical-text.md │ │ │ ├── how-to-crop-and-scale-images.md │ │ │ ├── how-to-determine-the-active-mdi-child.md │ │ │ ├── how-to-determine-the-parameters-supported-by-an-encoder.md │ │ │ ├── how-to-display-pop-up-help.md │ │ │ ├── how-to-draw-a-custom-dashed-line.md │ │ │ ├── how-to-draw-a-filled-ellipse-on-a-windows-form.md │ │ │ ├── how-to-draw-a-filled-rectangle-on-a-windows-form.md │ │ │ ├── how-to-draw-a-line-filled-with-a-texture.md │ │ │ ├── how-to-draw-a-line-on-a-windows-form.md │ │ │ ├── how-to-draw-a-line-with-line-caps.md │ │ │ ├── how-to-draw-a-sequence-of-bezier-splines.md │ │ │ ├── how-to-draw-a-single-bezier-spline.md │ │ │ ├── how-to-draw-an-existing-bitmap-to-the-screen.md │ │ │ ├── how-to-draw-an-outlined-shape.md │ │ │ ├── how-to-draw-cardinal-splines.md │ │ │ ├── how-to-draw-opaque-and-semitransparent-lines.md │ │ │ ├── how-to-draw-text-at-a-specified-location.md │ │ │ ├── how-to-draw-text-on-a-windows-form.md │ │ │ ├── how-to-draw-text-with-gdi.md │ │ │ ├── how-to-draw-vertical-text-on-a-windows-form.md │ │ │ ├── how-to-draw-with-opaque-and-semitransparent-brushes.md │ │ │ ├── how-to-draw-wrapped-text-in-a-rectangle.md │ │ │ ├── how-to-enumerate-installed-fonts.md │ │ │ ├── how-to-extract-the-icon-associated-with-a-file-in-windows-forms.md │ │ │ ├── how-to-fill-a-shape-with-a-hatch-pattern.md │ │ │ ├── how-to-fill-a-shape-with-a-solid-color.md │ │ │ ├── how-to-fill-a-shape-with-an-image-texture.md │ │ │ ├── how-to-fill-open-figures.md │ │ │ ├── how-to-flatten-a-curved-path-into-a-line.md │ │ │ ├── how-to-improve-performance-by-avoiding-automatic-scaling.md │ │ │ ├── how-to-inherit-forms-using-the-inheritance-picker-dialog-box.md │ │ │ ├── how-to-inherit-windows-forms.md │ │ │ ├── how-to-join-lines.md │ │ │ ├── how-to-list-installed-decoders.md │ │ │ ├── how-to-list-installed-encoders.md │ │ │ ├── how-to-load-and-display-metafiles.md │ │ │ ├── how-to-manually-manage-buffered-graphics.md │ │ │ ├── how-to-manually-render-buffered-graphics.md │ │ │ ├── how-to-obtain-font-metrics.md │ │ │ ├── how-to-perform-drag-and-drop-operations-between-applications.md │ │ │ ├── how-to-print-a-multi-page-text-file-in-windows-forms.md │ │ │ ├── how-to-print-a-windows-form.md │ │ │ ├── how-to-print-graphics-in-windows-forms.md │ │ │ ├── how-to-print-in-windows-forms-using-print-preview.md │ │ │ ├── how-to-provide-help-in-a-windows-application.md │ │ │ ├── how-to-read-image-metadata.md │ │ │ ├── how-to-read-settings-at-run-time-with-csharp.md │ │ │ ├── how-to-reduce-graphics-flicker-with-double-buffering-for-forms-and-controls.md │ │ │ ├── how-to-render-images-with-gdi.md │ │ │ ├── how-to-retrieve-data-from-the-clipboard.md │ │ │ ├── how-to-rotate-colors.md │ │ │ ├── how-to-rotate-reflect-and-skew-images.md │ │ │ ├── how-to-send-data-to-the-active-mdi-child.md │ │ │ ├── how-to-set-jpeg-compression-level.md │ │ │ ├── how-to-set-pen-width-and-alignment.md │ │ │ ├── how-to-set-tab-stops-in-drawn-text.md │ │ │ ├── how-to-set-the-color-of-a-pen.md │ │ │ ├── how-to-shear-colors.md │ │ │ ├── how-to-support-com-interop-by-displaying-each-windows-form-on-its-own-thread.md │ │ │ ├── how-to-tile-a-shape-with-an-image.md │ │ │ ├── how-to-translate-image-colors.md │ │ │ ├── how-to-use-a-color-matrix-to-set-alpha-values-in-images.md │ │ │ ├── how-to-use-a-color-matrix-to-transform-a-single-color.md │ │ │ ├── how-to-use-a-color-remap-table.md │ │ │ ├── how-to-use-a-pen-to-draw-lines.md │ │ │ ├── how-to-use-a-pen-to-draw-rectangles.md │ │ │ ├── how-to-use-antialiasing-with-text.md │ │ │ ├── how-to-use-clipping-with-a-region.md │ │ │ ├── how-to-use-compositing-mode-to-control-alpha-blending.md │ │ │ ├── how-to-use-hit-testing-with-a-region.md │ │ │ ├── how-to-use-interpolation-mode-to-control-image-quality-during-scaling.md │ │ │ ├── how-to-use-the-modifiers-and-generatemember-properties.md │ │ │ ├── how-to-validate-application-settings.md │ │ │ ├── how-to-write-user-settings-at-run-time-with-csharp.md │ │ │ ├── images-bitmaps-and-metafiles.md │ │ │ ├── index.md │ │ │ ├── integrating-user-help-in-windows-forms.md │ │ │ ├── international-fonts-in-windows-forms-and-controls.md │ │ │ ├── lines-curves-and-shapes.md │ │ │ ├── managing-the-state-of-a-graphics-object.md │ │ │ ├── matrix-representation-of-transformations.md │ │ │ ├── media │ │ │ │ ├── aboutgdip02-art01.gif │ │ │ │ ├── aboutgdip02-art02.gif │ │ │ │ ├── aboutgdip02-art03.gif │ │ │ │ ├── aboutgdip02-art04.gif │ │ │ │ ├── aboutgdip02-art05.gif │ │ │ │ ├── aboutgdip02-art06.gif │ │ │ │ ├── aboutgdip02-art07.gif │ │ │ │ ├── aboutgdip02-art08.gif │ │ │ │ ├── aboutgdip02-art09.gif │ │ │ │ ├── aboutgdip02-art10.gif │ │ │ │ ├── aboutgdip02-art11a.gif │ │ │ │ ├── aboutgdip02-art12.gif │ │ │ │ ├── aboutgdip02-art13.gif │ │ │ │ ├── aboutgdip02-art14.gif │ │ │ │ ├── aboutgdip02-art15.gif │ │ │ │ ├── aboutgdip02-art16.gif │ │ │ │ ├── aboutgdip02-art17.gif │ │ │ │ ├── aboutgdip02-art18.gif │ │ │ │ ├── aboutgdip02-art19.gif │ │ │ │ ├── aboutgdip02-art20.gif │ │ │ │ ├── aboutgdip02-art21.gif │ │ │ │ ├── aboutgdip02-art22.gif │ │ │ │ ├── aboutgdip02-art23.gif │ │ │ │ ├── aboutgdip02-art24.gif │ │ │ │ ├── aboutgdip02-art25.gif │ │ │ │ ├── aboutgdip02-art26.gif │ │ │ │ ├── aboutgdip02-art27.gif │ │ │ │ ├── aboutgdip02-art28.gif │ │ │ │ ├── aboutgdip02-art29.gif │ │ │ │ ├── aboutgdip02-art30.gif │ │ │ │ ├── aboutgdip02-art31.gif │ │ │ │ ├── aboutgdip02-art32a.gif │ │ │ │ ├── aboutgdip02-art33.gif │ │ │ │ ├── aboutgdip02-art34.gif │ │ │ │ ├── aboutgdip02-art35.gif │ │ │ │ ├── aboutgdip02-art36.gif │ │ │ │ ├── aboutgdip03-art01.gif │ │ │ │ ├── aboutgdip03-art02.gif │ │ │ │ ├── aboutgdip03-art03.gif │ │ │ │ ├── aboutgdip03-art03a.gif │ │ │ │ ├── aboutgdip03-art04.gif │ │ │ │ ├── aboutgdip03-art05.gif │ │ │ │ ├── aboutgdip03-art06.gif │ │ │ │ ├── aboutgdip03-art07.gif │ │ │ │ ├── aboutgdip05-art01.gif │ │ │ │ ├── aboutgdip05-art02.gif │ │ │ │ ├── aboutgdip05-art03.gif │ │ │ │ ├── aboutgdip05-art04.gif │ │ │ │ ├── aboutgdip05-art05.gif │ │ │ │ ├── aboutgdip05-art06.gif │ │ │ │ ├── aboutgdip05-art07.gif │ │ │ │ ├── aboutgdip05-art08.gif │ │ │ │ ├── aboutgdip05-art09.gif │ │ │ │ ├── aboutgdip05-art10.gif │ │ │ │ ├── aboutgdip05-art12.gif │ │ │ │ ├── aboutgdip05-art13.gif │ │ │ │ ├── aboutgdip05-art14.gif │ │ │ │ ├── aboutgdip05-art15.gif │ │ │ │ ├── aboutgdip05-art16.gif │ │ │ │ ├── how-to-apply-gamma-correction-to-a-gradient │ │ │ │ │ └── two-rectangles-gamma-gradient.png │ │ │ │ ├── how-to-create-a-linear-gradient │ │ │ │ │ ├── gradient-ellipse-rectangle.png │ │ │ │ │ ├── gradient-line-ellipse-rectangle.png │ │ │ │ │ └── gradient-line-ellipse.png │ │ │ │ ├── how-to-create-a-path-gradient │ │ │ │ │ ├── focus-scales-aqua-inner-outer-ellipse.png │ │ │ │ │ ├── gradient-brush-filled-triangle.png │ │ │ │ │ ├── gradient-painted-path-gradient-brush.png │ │ │ │ │ ├── gradient-path-center-point-outside.png │ │ │ │ │ ├── gradient-path-extended-beyond-boundary.png │ │ │ │ │ ├── gradient-path-filled-ellipse-center-point.png │ │ │ │ │ └── gradient-path-filled-ellipse.png │ │ │ │ ├── how-to-create-a-private-font-collection │ │ │ │ │ └── various-fonts-text-output.png │ │ │ │ ├── how-to-create-thumbnail-images │ │ │ │ │ └── construct-thumbnail-image.png │ │ │ │ ├── how-to-create-vertical-text │ │ │ │ │ └── vertical-font-text-graphic.png │ │ │ │ ├── how-to-crop-and-scale-images │ │ │ │ │ └── original-image-cropped-image.png │ │ │ │ ├── how-to-draw-a-custom-dashed-line │ │ │ │ │ └── dashed-line-illustration.gif │ │ │ │ ├── how-to-draw-a-line-filled-with-a-texture │ │ │ │ │ └── bitmap-textured-ellipse.png │ │ │ │ ├── how-to-draw-a-line-with-line-caps │ │ │ │ │ └── line-cap-arrowhead-example.gif │ │ │ │ ├── how-to-draw-a-sequence-of-bezier-splines │ │ │ │ │ └── bezier-spline-seven-points.png │ │ │ │ ├── how-to-draw-a-single-bezier-spline │ │ │ │ │ └── bezier-spline-illustration.png │ │ │ │ ├── how-to-draw-an-existing-bitmap-to-the-screen │ │ │ │ │ └── bitmap-specified-position.png │ │ │ │ ├── how-to-draw-cardinal-splines │ │ │ │ │ ├── bell-shaped-cardinal-spline.png │ │ │ │ │ ├── closed-cardinal-spine.png │ │ │ │ │ └── three-cardinal-splines.png │ │ │ │ ├── how-to-draw-opaque-and-semitransparent-lines │ │ │ │ │ └── opaque-semitransparent-lines.png │ │ │ │ ├── how-to-draw-text-at-a-specified-location │ │ │ │ │ └── font-text-specified-point.png │ │ │ │ ├── how-to-draw-with-opaque-and-semitransparent-brushes │ │ │ │ │ └── compositingquality-ellipse-semitransparent.png │ │ │ │ ├── how-to-draw-wrapped-text-in-a-rectangle │ │ │ │ │ └── drawstring-method-font-text.png │ │ │ │ ├── how-to-enumerate-installed-fonts │ │ │ │ │ └── list-installed-font-families.png │ │ │ │ ├── how-to-fill-a-shape-with-a-hatch-pattern │ │ │ │ │ └── ellipse-filled-hatch.png │ │ │ │ ├── how-to-fill-open-figures │ │ │ │ │ └── fill-path-alternate-mode.png │ │ │ │ ├── how-to-improve-performance-by-avoiding-automatic-scaling │ │ │ │ │ └── two-scaled-texture-images.png │ │ │ │ ├── how-to-inherit-forms-using-the-inheritance-picker-dialog-box │ │ │ │ │ └── visual-basic-inheritance-glyph.gif │ │ │ │ ├── how-to-join-lines │ │ │ │ │ └── joined-beveled-lines.gif │ │ │ │ ├── how-to-load-and-display-metafiles │ │ │ │ │ └── metafile-drawn-specified-location.png │ │ │ │ ├── how-to-obtain-font-metrics │ │ │ │ │ ├── convert-font-units-example.png │ │ │ │ │ ├── example-output-code-arial-font.png │ │ │ │ │ └── various-font-metrics.png │ │ │ │ ├── how-to-rotate-colors │ │ │ │ │ ├── original-color-rotated-images.png │ │ │ │ │ ├── rotation-about-blue-axis.gif │ │ │ │ │ ├── rotation-about-three-axes.gif │ │ │ │ │ ├── rotation-red-green-blue-axes.gif │ │ │ │ │ └── visualization-color-rotation.gif │ │ │ │ ├── how-to-rotate-reflect-and-skew-images │ │ │ │ │ ├── reflected-skewed-rotated-illustration.gif │ │ │ │ │ ├── reflected-skewed-rotated-metafile.png │ │ │ │ │ └── reflected-skewed-rotated-photo.png │ │ │ │ ├── how-to-set-pen-width-and-alignment │ │ │ │ │ ├── green-pixels-centered-line.gif │ │ │ │ │ ├── green-pixels-centered-rectangle.gif │ │ │ │ │ └── green-pixels-inside-rectangle.gif │ │ │ │ ├── how-to-set-tab-stops-in-drawn-text │ │ │ │ │ └── tab-list-names-test-scores.png │ │ │ │ ├── how-to-shear-colors │ │ │ │ │ └── original-image-sheared-image.png │ │ │ │ ├── how-to-tile-a-shape-with-an-image │ │ │ │ │ ├── rectangle-tile-200x200.gif │ │ │ │ │ ├── rectangle-tiled-image-horizontal-flip.gif │ │ │ │ │ ├── rectangle-tiled-image-horizontal-vertical-flip.gif │ │ │ │ │ └── rectangle-tiled-image-no-flip.gif │ │ │ │ ├── how-to-translate-image-colors │ │ │ │ │ └── original-image-translate-colors.png │ │ │ │ ├── how-to-use-a-color-matrix-to-set-alpha-values-in-images │ │ │ │ │ └── alpha-blending-matrix.png │ │ │ │ ├── how-to-use-a-color-matrix-to-transform-a-single-color │ │ │ │ │ ├── 5x5-identity-matrix-color-transformation.gif │ │ │ │ │ ├── color-transformation.png │ │ │ │ │ └── multiplication-color-matrix.gif │ │ │ │ ├── how-to-use-a-color-remap-table │ │ │ │ │ └── original-image-remap-colors.png │ │ │ │ ├── how-to-use-a-pen-to-draw-rectangles │ │ │ │ │ └── drawn-rectangle-black-lines-dotted-lines.gif │ │ │ │ ├── how-to-use-antialiasing-with-text │ │ │ │ │ └── antialiasing-text-quality-settings.png │ │ │ │ ├── how-to-use-clipping-with-a-region │ │ │ │ │ └── clipped-strings-polygon.png │ │ │ │ ├── how-to-use-compositing-mode-to-control-alpha-blending │ │ │ │ │ ├── blend-ellipses-background.png │ │ │ │ │ └── ellipses-blended-background.png │ │ │ │ ├── how-to-use-interpolation-mode-to-control-image-quality-during-scaling │ │ │ │ │ └── varied-interpolation-settings.png │ │ │ │ ├── managing-the-state-of-a-graphics-object │ │ │ │ │ ├── set-clipping-region-setclip-method.png │ │ │ │ │ └── set-rotation-pen-width-drawellipse-method.png │ │ │ │ ├── using-a-gradient-brush-to-fill-shapes │ │ │ │ │ └── rectangle-ellipse-gradient-brush.png │ │ │ │ ├── using-nested-graphics-containers │ │ │ │ │ ├── nested-container-clipped-lines.png │ │ │ │ │ ├── nested-containers-illustration.png │ │ │ │ │ └── nested-containers-three-strings.png │ │ │ │ ├── using-transformations-to-scale-colors │ │ │ │ │ ├── four-bar-scale-multiple-colors.png │ │ │ │ │ └── four-bar-scale-one-color.png │ │ │ │ ├── walkthrough-creating-an-accessible-windows-based-application │ │ │ │ │ └── visual-basic-pizza-order-form.gif │ │ │ │ └── walkthrough-demonstrating-visual-inheritance │ │ │ │ │ └── visual-basic-inheritance-glyph.gif │ │ │ ├── metafiles-in-gdi.md │ │ │ ├── multiple-document-interface-mdi-applications.md │ │ │ ├── networking-in-windows-forms-applications.md │ │ │ ├── open-and-closed-curves-in-gdi.md │ │ │ ├── overview-of-graphics.md │ │ │ ├── pens-lines-and-rectangles-in-gdi.md │ │ │ ├── polygons-in-gdi.md │ │ │ ├── power-management-in-windows-forms.md │ │ │ ├── properties-on-windows-forms-controls-that-support-accessibility-guidelines.md │ │ │ ├── recoloring-images.md │ │ │ ├── regions-in-gdi.md │ │ │ ├── restricting-the-drawing-surface-in-gdi.md │ │ │ ├── structure-of-the-graphics-interface.md │ │ │ ├── system-information-and-windows-forms.md │ │ │ ├── three-categories-of-graphics-services.md │ │ │ ├── toc.yml │ │ │ ├── types-of-bitmaps.md │ │ │ ├── types-of-coordinate-systems.md │ │ │ ├── using-a-brush-to-fill-shapes.md │ │ │ ├── using-a-gradient-brush-to-fill-shapes.md │ │ │ ├── using-a-pen-to-draw-lines-and-shapes.md │ │ │ ├── using-application-settings-and-user-settings.md │ │ │ ├── using-double-buffering.md │ │ │ ├── using-fonts-and-text.md │ │ │ ├── using-graphics-containers.md │ │ │ ├── using-image-encoders-and-decoders-in-managed-gdi.md │ │ │ ├── using-managed-graphics-classes.md │ │ │ ├── using-nested-graphics-containers.md │ │ │ ├── using-regions.md │ │ │ ├── using-the-world-transformation.md │ │ │ ├── using-transformations-in-managed-gdi.md │ │ │ ├── using-transformations-to-scale-colors.md │ │ │ ├── using-wpf-controls.md │ │ │ ├── vector-graphics-overview.md │ │ │ ├── walkthrough-arranging-wpf-content-on-windows-forms-at-design-time.md │ │ │ ├── walkthrough-assigning-wpf-content-on-windows-forms-at-design-time.md │ │ │ ├── walkthrough-creating-an-accessible-windows-based-application.md │ │ │ ├── walkthrough-creating-new-wpf-content-on-windows-forms-at-design-time.md │ │ │ ├── walkthrough-demonstrating-visual-inheritance.md │ │ │ ├── walkthrough-performing-a-drag-and-drop-operation-in-windows-forms.md │ │ │ ├── walkthrough-styling-wpf-content.md │ │ │ ├── why-transformation-order-is-significant.md │ │ │ ├── windows-forms-accessibility.md │ │ │ ├── windows-forms-and-unmanaged-applications-overview.md │ │ │ ├── windows-forms-and-unmanaged-applications.md │ │ │ ├── windows-forms-print-support.md │ │ │ ├── windows-forms-visual-inheritance.md │ │ │ └── working-with-images-bitmaps-icons-and-metafiles.md │ │ ├── automatic-scaling-in-windows-forms.md │ │ ├── change-notification-in-windows-forms-data-binding.md │ │ ├── changing-the-appearance-of-windows-forms.md │ │ ├── clickonce-deployment-for-windows-forms.md │ │ ├── controls │ │ │ ├── access-objects-in-a-wf-datagridviewcomboboxcell-drop-down-list.md │ │ │ ├── access-specific-items-in-a-wf-combobox-listbox-or-checkedlistbox.md │ │ │ ├── accessing-frames-in-the-managed-html-document-object-model.md │ │ │ ├── accessing-unexposed-members-on-the-managed-html-document-object-model.md │ │ │ ├── add-and-remove-columns-in-the-datagrid-using-the-designer.md │ │ │ ├── add-and-remove-items-from-a-wf-combobox.md │ │ │ ├── add-and-remove-items-with-wf-listview-control-using-the-designer.md │ │ │ ├── add-and-remove-menu-items-with-wf-contextmenu-component.md │ │ │ ├── add-and-remove-nodes-with-wf-treeview-control-using-the-designer.md │ │ │ ├── add-and-remove-tabs-with-wf-tabcontrol-using-the-designer.md │ │ │ ├── add-custom-information-to-a-treeview-or-listview-control-wf.md │ │ │ ├── add-tables-and-columns-to-wf-datagrid-control-using-the-designer.md │ │ │ ├── add-tooltips-to-individual-cells-in-a-wf-datagridview-control.md │ │ │ ├── app-icons-to-the-taskbar-with-wf-notifyicon.md │ │ │ ├── attributes-in-windows-forms-controls.md │ │ │ ├── autogenerate-columns-in-a-data-bound-wf-datagridview-control.md │ │ │ ├── automatically-resize-cells-when-content-changes-in-the-datagrid.md │ │ │ ├── autosize-behavior-in-the-tablelayoutpanel-control.md │ │ │ ├── autosize-property-overview.md │ │ │ ├── backgroundworker-component-overview.md │ │ │ ├── backgroundworker-component.md │ │ │ ├── basic-column-row-and-cell-features-wf-datagridview-control.md │ │ │ ├── basic-formatting-and-styling-in-the-windows-forms-datagridview-control.md │ │ │ ├── best-practices-for-scaling-the-windows-forms-datagridview-control.md │ │ │ ├── best-practices-for-the-tablelayoutpanel-control.md │ │ │ ├── bind-data-to-the-datagrid-using-the-designer.md │ │ │ ├── bind-wf-controls-with-the-bindingsource.md │ │ │ ├── bind-wf-datagrid-control-to-a-data-source-using-the-designer.md │ │ │ ├── bindingnavigator-control-overview-windows-forms.md │ │ │ ├── bindingnavigator-control-windows-forms.md │ │ │ ├── bindingsource-component-architecture.md │ │ │ ├── bindingsource-component-overview.md │ │ │ ├── bindingsource-component.md │ │ │ ├── button-control-overview-windows-forms.md │ │ │ ├── button-control-windows-forms.md │ │ │ ├── cell-styles-in-the-windows-forms-datagridview-control.md │ │ │ ├── change-displayed-data-at-run-time-wf-datagrid-control.md │ │ │ ├── change-the-border-and-gridline-styles-in-the-datagrid.md │ │ │ ├── change-the-order-of-columns-in-the-datagrid-using-the-designer.md │ │ │ ├── change-the-type-of-a-wf-datagridview-column-using-the-designer.md │ │ │ ├── checkbox-control-overview-windows-forms.md │ │ │ ├── checkbox-control-windows-forms.md │ │ │ ├── checkedlistbox-control-overview-windows-forms.md │ │ │ ├── checkedlistbox-control-windows-forms.md │ │ │ ├── colordialog-component-overview-windows-forms.md │ │ │ ├── colordialog-component-windows-forms.md │ │ │ ├── column-fill-mode-in-the-windows-forms-datagridview-control.md │ │ │ ├── column-sort-modes-in-the-windows-forms-datagridview-control.md │ │ │ ├── column-types-in-the-windows-forms-datagridview-control.md │ │ │ ├── combobox-control-overview-windows-forms.md │ │ │ ├── combobox-control-windows-forms.md │ │ │ ├── considerations-when-hosting-an-activex-control-on-a-windows-form.md │ │ │ ├── constituent-controls.md │ │ │ ├── contextmenu-component-overview-windows-forms.md │ │ │ ├── contextmenu-component-windows-forms.md │ │ │ ├── contextmenustrip-control-overview.md │ │ │ ├── contextmenustrip-control.md │ │ │ ├── control-type-recommendations.md │ │ │ ├── controls-to-use-on-windows-forms.md │ │ │ ├── controls-with-built-in-owner-drawing-support.md │ │ │ ├── create-a-basic-wf-toolstrip-with-standard-items-using-the-designer.md │ │ │ ├── create-a-lookup-table-for-a-wf-combobox-listbox.md │ │ │ ├── create-a-master-detail-form-using-two-datagridviews.md │ │ │ ├── create-a-multipane-user-interface-with-wf-using-the-designer.md │ │ │ ├── create-and-set-a-custom-renderer-for-the-toolstrip-control-in-wf.md │ │ │ ├── create-master-details-lists-with-wf-datagrid-control-using-the-designer.md │ │ │ ├── creating-a-master-detail-form-using-two-datagridviews.md │ │ │ ├── creating-a-wf-control-design-time-features.md │ │ │ ├── creating-an-explorer-style-interface-with-the-listview-and-treeview.md │ │ │ ├── custom-control-painting-and-rendering.md │ │ │ ├── customize-cells-and-columns-in-the-datagrid-by-extending-behavior.md │ │ │ ├── customize-the-appearance-of-cells-in-the-datagrid.md │ │ │ ├── customize-the-appearance-of-rows-in-the-datagrid.md │ │ │ ├── customizing-the-windows-forms-datagridview-control.md │ │ │ ├── data-display-modes-in-the-windows-forms-datagridview-control.md │ │ │ ├── data-entry-in-the-windows-forms-datagridview-control.md │ │ │ ├── data-formatting-in-the-windows-forms-datagridview-control.md │ │ │ ├── datagrid-control-overview-windows-forms.md │ │ │ ├── datagrid-control-windows-forms.md │ │ │ ├── datagridview-control-architecture-windows-forms.md │ │ │ ├── datagridview-control-code-directory-windows-forms.md │ │ │ ├── datagridview-control-overview-windows-forms.md │ │ │ ├── datagridview-control-scenarios-windows-forms.md │ │ │ ├── datagridview-control-technology-summary-windows-forms.md │ │ │ ├── datagridview-control-windows-forms.md │ │ │ ├── datetimepicker-control-overview-windows-forms.md │ │ │ ├── datetimepicker-control-windows-forms.md │ │ │ ├── default-cell-styles-datagridview.md │ │ │ ├── default-functionality-in-the-windows-forms-datagridview-control.md │ │ │ ├── default-keyboard-and-mouse-handling-in-the-windows-forms-datagridview-control.md │ │ │ ├── defining-a-property-in-windows-forms-controls.md │ │ │ ├── defining-an-event-in-windows-forms-controls.md │ │ │ ├── defining-default-values-with-the-shouldserialize-and-reset-methods.md │ │ │ ├── design-time-errors-in-the-windows-forms-designer.md │ │ │ ├── designate-a-wf-button-as-the-accept-button-using-the-designer.md │ │ │ ├── designate-a-wf-button-as-the-cancel-button-using-the-designer.md │ │ │ ├── determine-when-formatting-attributes-change-wf-richtextbox-control.md │ │ │ ├── determine-which-panel-wf-statusbar-control-was-clicked.md │ │ │ ├── developing-a-composite-windows-forms-control.md │ │ │ ├── developing-custom-windows-forms-controls.md │ │ │ ├── developing-windows-forms-controls-at-design-time.md │ │ │ ├── dialog-box-controls-and-components-windows-forms.md │ │ │ ├── differences-between-the-windows-forms-datagridview-and-datagrid-controls.md │ │ │ ├── disable-buttons-in-a-button-column-in-the-datagrid.md │ │ │ ├── display-a-date-in-a-custom-format-with-wf-datetimepicker-control.md │ │ │ ├── display-a-web-page-from-a-wf-linklabel-control-visual-basic.md │ │ │ ├── display-error-icons-for-form-validation-with-wf-errorprovider.md │ │ │ ├── display-more-than-one-month-wf-monthcalendar-control.md │ │ │ ├── display-specific-days-in-bold-with-wf-monthcalendar-control.md │ │ │ ├── displaying-data-in-the-windows-forms-datagridview-control.md │ │ │ ├── domainupdown-control-overview-windows-forms.md │ │ │ ├── domainupdown-control-windows-forms.md │ │ │ ├── enable-column-reordering-in-the-datagrid-using-the-designer.md │ │ │ ├── enable-drag-and-drop-operations-with-wf-richtextbox-control.md │ │ │ ├── enable-tile-view-in-a-wf-listview-control-using-the-designer.md │ │ │ ├── enable-users-to-copy-multiple-cells-to-the-clipboard-datagridview.md │ │ │ ├── errorprovider-component-overview-windows-forms.md │ │ │ ├── errorprovider-component-windows-forms.md │ │ │ ├── events-in-windows-forms-controls.md │ │ │ ├── filedialog-class.md │ │ │ ├── flowlayoutpanel-control-overview.md │ │ │ ├── flowlayoutpanel-control-windows-forms.md │ │ │ ├── folderbrowserdialog-component-overview-windows-forms.md │ │ │ ├── folderbrowserdialog-component-windows-forms.md │ │ │ ├── fontdialog-component-overview-windows-forms.md │ │ │ ├── fontdialog-component-windows-forms.md │ │ │ ├── freeze-columns-in-the-datagrid-using-the-designer.md │ │ │ ├── get-and-set-the-current-cell-wf-datagridview-control.md │ │ │ ├── group-controls-with-wf-panel-control-using-the-designer.md │ │ │ ├── groupbox-control-overview-windows-forms.md │ │ │ ├── groupbox-control-windows-forms.md │ │ │ ├── handle-errors-that-occur-during-data-entry-in-the-datagrid.md │ │ │ ├── handling-errors-that-occur-during-data-entry-in-the-datagrid.md │ │ │ ├── handling-user-input.md │ │ │ ├── helpprovider-component-overview-windows-forms.md │ │ │ ├── helpprovider-component-windows-forms.md │ │ │ ├── hide-columns-in-the-datagrid-using-the-designer.md │ │ │ ├── how-to-access-objects-bound-to-windows-forms-datagridview-rows.md │ │ │ ├── how-to-access-the-html-source-in-the-managed-html-document-object-model.md │ │ │ ├── how-to-access-the-managed-html-document-object-model.md │ │ │ ├── how-to-add-a-control-to-a-tab-page-using-the-designer.md │ │ │ ├── how-to-add-a-control-to-a-tab-page.md │ │ │ ├── how-to-add-a-control-to-a-toolstripcontentpanel.md │ │ │ ├── how-to-add-a-custom-place-to-a-file-dialog-box.md │ │ │ ├── how-to-add-a-toolstripcontainer-to-a-form.md │ │ │ ├── how-to-add-activex-controls-to-windows-forms.md │ │ │ ├── how-to-add-and-remove-items-with-the-windows-forms-listview-control.md │ │ │ ├── how-to-add-and-remove-nodes-with-the-windows-forms-treeview-control.md │ │ │ ├── how-to-add-and-remove-tabs-with-the-windows-forms-tabcontrol.md │ │ │ ├── how-to-add-buttons-to-a-toolbar-control-using-the-designer.md │ │ │ ├── how-to-add-buttons-to-a-toolbar-control.md │ │ │ ├── how-to-add-columns-to-the-windows-forms-listview-control-using-the-designer.md │ │ │ ├── how-to-add-columns-to-the-windows-forms-listview-control.md │ │ │ ├── how-to-add-controls-to-windows-forms.md │ │ │ ├── how-to-add-controls-without-a-user-interface-to-windows-forms.md │ │ │ ├── how-to-add-enhancements-to-toolstripmenuitems.md │ │ │ ├── how-to-add-items-to-windows-forms-domainupdown-controls-programmatically.md │ │ │ ├── how-to-add-menu-items-to-a-contextmenustrip.md │ │ │ ├── how-to-add-or-remove-imagelist-images-with-the-designer.md │ │ │ ├── how-to-add-or-remove-images-with-the-windows-forms-imagelist-component.md │ │ │ ├── how-to-add-panels-to-a-statusbar-control.md │ │ │ ├── how-to-add-search-capabilities-to-a-listview-control.md │ │ │ ├── how-to-add-tables-and-columns-to-the-windows-forms-datagrid-control.md │ │ │ ├── how-to-add-to-or-remove-from-a-collection-of-controls-at-run-time.md │ │ │ ├── how-to-add-toolstrip-items-dynamically.md │ │ │ ├── how-to-add-web-browser-capabilities-to-a-windows-forms-application.md │ │ │ ├── how-to-align-a-control-to-the-edges-of-forms-at-design-time.md │ │ │ ├── how-to-align-a-control-to-the-edges-of-forms.md │ │ │ ├── how-to-align-and-stretch-a-control-in-a-tablelayoutpanel-control.md │ │ │ ├── how-to-align-multiple-controls-on-windows-forms.md │ │ │ ├── how-to-anchor-and-dock-child-controls-in-a-flowlayoutpanel-control.md │ │ │ ├── how-to-anchor-and-dock-child-controls-in-a-tablelayoutpanel-control.md │ │ │ ├── how-to-anchor-controls-on-windows-forms.md │ │ │ ├── how-to-append-a-menustrip-to-an-mdi-parent-window-windows-forms.md │ │ │ ├── how-to-apply-attributes-in-windows-forms-controls.md │ │ │ ├── how-to-associate-a-contextmenustrip-with-a-control.md │ │ │ ├── how-to-associate-a-shortcut-menu-with-a-windows-forms-notifyicon-component.md │ │ │ ├── how-to-attach-a-shortcut-menu-to-a-treenode-using-the-designer.md │ │ │ ├── how-to-attach-a-shortcut-menu-to-a-treeview-node.md │ │ │ ├── how-to-author-composite-controls.md │ │ │ ├── how-to-author-controls-for-windows-forms.md │ │ │ ├── how-to-bind-a-windows-forms-combobox-or-listbox-control-to-data.md │ │ │ ├── how-to-bind-a-windows-forms-control-to-a-factory-object.md │ │ │ ├── how-to-bind-a-windows-forms-control-to-a-type-using-the-designer.md │ │ │ ├── how-to-bind-a-windows-forms-control-to-a-type.md │ │ │ ├── how-to-bind-data-to-the-maskedtextbox-control.md │ │ │ ├── how-to-bind-data-to-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-bind-objects-to-windows-forms-datagridview-controls.md │ │ │ ├── how-to-bind-the-windows-forms-datagrid-control-to-a-data-source.md │ │ │ ├── how-to-bind-to-a-web-service-using-the-windows-forms-bindingsource.md │ │ │ ├── how-to-bind-windows-forms-controls-to-dbnull-database-values.md │ │ │ ├── how-to-change-monthcalendar-control-appearance.md │ │ │ ├── how-to-change-styles-on-an-element-in-the-managed-html-document-object-model.md │ │ │ ├── how-to-change-the-appearance-of-the-windows-forms-colordialog-component.md │ │ │ ├── how-to-change-the-appearance-of-the-windows-forms-linklabel-control.md │ │ │ ├── how-to-change-the-appearance-of-the-windows-forms-tabcontrol.md │ │ │ ├── how-to-change-the-appearance-of-toolstrip-text-and-images-in-windows-forms.md │ │ │ ├── how-to-change-the-delay-of-the-windows-forms-tooltip-component.md │ │ │ ├── how-to-change-the-order-of-columns-in-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-change-the-spacing-and-alignment-of-toolstrip-items-in-windows-forms.md │ │ │ ├── how-to-choose-folders-with-the-windows-forms-folderbrowserdialog-component.md │ │ │ ├── how-to-configure-contextmenustrip-check-margins-and-image-margins.md │ │ │ ├── how-to-configure-menustrip-check-margins-and-image-margins.md │ │ │ ├── how-to-control-the-insertion-point-in-a-windows-forms-textbox-control.md │ │ │ ├── how-to-copy-toolstripmenuitems.md │ │ │ ├── how-to-create-a-border-around-a-windows-forms-control-using-padding.md │ │ │ ├── how-to-create-a-lookup-table-with-the-windows-forms-bindingsource-component.md │ │ │ ├── how-to-create-a-multipane-user-interface-with-windows-forms.md │ │ │ ├── how-to-create-a-password-text-box-with-the-windows-forms-textbox-control.md │ │ │ ├── how-to-create-a-professionally-styled-toolstrip-control.md │ │ │ ├── how-to-create-a-read-only-text-box-windows-forms.md │ │ │ ├── how-to-create-a-resizable-windows-form-for-data-entry.md │ │ │ ├── how-to-create-a-windows-explorer-style-interface-on-a-windows-form.md │ │ │ ├── how-to-create-a-windows-forms-control-that-shows-progress.md │ │ │ ├── how-to-create-access-keys-for-windows-forms-controls.md │ │ │ ├── how-to-create-access-keys-with-windows-forms-label-controls.md │ │ │ ├── how-to-create-an-html-document-viewer-in-a-windows-forms-application.md │ │ │ ├── how-to-create-an-mdi-form-with-menu-merging-and-toolstrip-controls.md │ │ │ ├── how-to-create-an-mdi-form-with-toolstrippanel-controls.md │ │ │ ├── how-to-create-an-mdi-window-list-with-menustrip-windows-forms.md │ │ │ ├── how-to-create-an-unbound-windows-forms-datagridview-control.md │ │ │ ├── how-to-create-master-detail-lists-with-the-windows-forms-datagrid-control.md │ │ │ ├── how-to-create-toggle-buttons-in-toolstrip-controls.md │ │ │ ├── how-to-create-variable-sized-text-in-a-combobox-control.md │ │ │ ├── how-to-custom-draw-a-toolstrip-control.md │ │ │ ├── how-to-customize-colors-in-toolstrip-applications.md │ │ │ ├── how-to-customize-data-formatting-in-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-customize-item-addition-with-the-windows-forms-bindingsource.md │ │ │ ├── how-to-customize-sorting-in-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-define-an-icon-for-a-toolbar-button-using-the-designer.md │ │ │ ├── how-to-define-an-icon-for-a-toolbar-button.md │ │ │ ├── how-to-define-resize-and-positioning-behavior-in-a-split-window.md │ │ │ ├── how-to-define-z-ordering-of-docked-toolstrip-controls.md │ │ │ ├── how-to-delete-or-hide-columns-in-the-windows-forms-datagrid-control.md │ │ │ ├── how-to-design-a-windows-forms-layout-that-responds-well-to-localization.md │ │ │ ├── how-to-designate-a-windows-forms-button-as-the-accept-button.md │ │ │ ├── how-to-designate-a-windows-forms-button-as-the-cancel-button.md │ │ │ ├── how-to-detect-when-the-mouse-pointer-is-over-a-toolstripitem.md │ │ │ ├── how-to-determine-checked-items-in-the-windows-forms-checkedlistbox-control.md │ │ │ ├── how-to-determine-page-properties-using-the-pagesetupdialog-component.md │ │ │ ├── how-to-determine-which-treeview-node-was-clicked-windows-forms.md │ │ │ ├── how-to-develop-a-simple-windows-forms-control.md │ │ │ ├── how-to-disable-tab-pages.md │ │ │ ├── how-to-disable-toolstripmenuitems-using-the-designer.md │ │ │ ├── how-to-disable-toolstripmenuitems.md │ │ │ ├── how-to-display-a-control-in-the-choose-toolbox-items-dialog-box.md │ │ │ ├── how-to-display-an-insertion-mark-in-a-windows-forms-listview-control.md │ │ │ ├── how-to-display-icons-for-the-windows-forms-listview-control.md │ │ │ ├── how-to-display-images-in-cells-of-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-display-option-buttons-in-a-menustrip-windows-forms.md │ │ │ ├── how-to-display-print-preview-in-windows-forms-applications.md │ │ │ ├── how-to-display-scroll-bars-in-the-windows-forms-richtextbox-control.md │ │ │ ├── how-to-display-side-aligned-tabs-with-tabcontrol.md │ │ │ ├── how-to-display-subitems-in-columns-with-the-windows-forms-listview-control.md │ │ │ ├── how-to-display-the-printdialog-component.md │ │ │ ├── how-to-display-time-with-the-datetimepicker-control.md │ │ │ ├── how-to-display-web-style-links-with-the-windows-forms-richtextbox-control.md │ │ │ ├── how-to-dock-controls-on-windows-forms.md │ │ │ ├── how-to-download-a-file-in-the-background.md │ │ │ ├── how-to-edit-columns-and-rows-in-a-tablelayoutpanel-control.md │ │ │ ├── how-to-enable-autocomplete-in-toolstrip-controls-in-windows-forms.md │ │ │ ├── how-to-enable-check-margins-and-image-margins-in-contextmenustrip-controls.md │ │ │ ├── how-to-enable-column-reordering-in-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-enable-reordering-of-toolstrip-items-at-run-time-in-windows-forms.md │ │ │ ├── how-to-enable-the-tab-key-to-move-out-of-a-toolstrip-control.md │ │ │ ├── how-to-enable-tile-view-in-a-windows-forms-listview-control.md │ │ │ ├── how-to-expose-properties-of-constituent-controls.md │ │ │ ├── how-to-format-data-in-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-format-the-windows-forms-datagrid-control-using-the-designer.md │ │ │ ├── how-to-format-the-windows-forms-datagrid-control.md │ │ │ ├── how-to-freeze-columns-in-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-give-your-control-a-transparent-background.md │ │ │ ├── how-to-group-controls-with-the-windows-forms-groupbox-control.md │ │ │ ├── how-to-group-items-in-a-windows-forms-listview-control-using-the-designer.md │ │ │ ├── how-to-group-items-in-a-windows-forms-listview-control.md │ │ │ ├── how-to-group-windows-forms-radiobutton-controls-to-function-as-a-set.md │ │ │ ├── how-to-handle-errors-and-exceptions-that-occur-with-databinding.md │ │ │ ├── how-to-handle-the-contextmenustrip-opening-event.md │ │ │ ├── how-to-hide-column-headers-in-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-hide-columns-in-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-hide-toolstripmenuitems-using-the-designer.md │ │ │ ├── how-to-hide-toolstripmenuitems.md │ │ │ ├── how-to-host-controls-in-windows-forms-datagridview-cells.md │ │ │ ├── how-to-implement-a-custom-layout-engine.md │ │ │ ├── how-to-implement-a-custom-toolstriprenderer.md │ │ │ ├── how-to-implement-a-form-that-uses-a-background-operation.md │ │ │ ├── how-to-implement-virtual-mode-in-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-inherit-from-existing-windows-forms-controls.md │ │ │ ├── how-to-inherit-from-the-control-class.md │ │ │ ├── how-to-inherit-from-the-usercontrol-class.md │ │ │ ├── how-to-insert-a-menustrip-into-an-mdi-drop-down-menu-windows-forms.md │ │ │ ├── how-to-iterate-through-all-nodes-of-a-windows-forms-treeview-control.md │ │ │ ├── how-to-join-toolstrippanels.md │ │ │ ├── how-to-layer-objects-on-windows-forms.md │ │ │ ├── how-to-load-a-picture-using-the-designer-windows-forms.md │ │ │ ├── how-to-load-a-sound-asynchronously-within-a-windows-form.md │ │ │ ├── how-to-load-files-into-the-windows-forms-richtextbox-control.md │ │ │ ├── how-to-lock-controls-to-windows-forms.md │ │ │ ├── how-to-loop-a-sound-playing-on-a-windows-form.md │ │ │ ├── how-to-make-columns-read-only-in-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-make-thread-safe-calls-to-windows-forms-controls.md │ │ │ ├── how-to-make-your-control-invisible-at-run-time.md │ │ │ ├── how-to-manage-toolstrip-overflow-in-windows-forms.md │ │ │ ├── how-to-manipulate-bands-in-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-manipulate-columns-in-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-manipulate-rows-in-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-modify-the-size-or-placement-of-a-picture-at-run-time-windows-forms.md │ │ │ ├── how-to-move-a-toolstrip-out-of-a-toolstripcontainer-onto-a-form.md │ │ │ ├── how-to-move-toolstripmenuitems.md │ │ │ ├── how-to-navigate-data-with-the-windows-forms-bindingnavigator-control.md │ │ │ ├── how-to-navigate-to-a-url-with-the-webbrowser-control.md │ │ │ ├── how-to-open-files-using-the-openfiledialog-component.md │ │ │ ├── how-to-opt-out-of-file-dialog-box-automatic-upgrade.md │ │ │ ├── how-to-play-a-beep-from-a-windows-form.md │ │ │ ├── how-to-play-a-sound-embedded-in-a-resource-from-a-windows-form.md │ │ │ ├── how-to-play-a-sound-from-a-windows-form.md │ │ │ ├── how-to-play-a-system-sound-from-a-windows-form.md │ │ │ ├── how-to-position-a-toolstripitem-on-a-toolstrip.md │ │ │ ├── how-to-position-controls-on-windows-forms.md │ │ │ ├── how-to-print-with-a-webbrowser-control.md │ │ │ ├── how-to-provide-a-toolbox-bitmap-for-a-control.md │ │ │ ├── how-to-provide-standard-menu-items-to-a-form.md │ │ │ ├── how-to-put-quotation-marks-in-a-string-windows-forms.md │ │ │ ├── how-to-raise-change-notifications-using-the-bindingsource-resetitem-method.md │ │ │ ├── how-to-reassign-existing-controls-to-a-different-parent.md │ │ │ ├── how-to-remove-a-toolstripmenuitem-from-an-mdi-drop-down-menu-windows-forms.md │ │ │ ├── how-to-remove-items-from-windows-forms-domainupdown-controls.md │ │ │ ├── how-to-render-a-visual-style-element.md │ │ │ ├── how-to-resize-controls-on-windows-forms.md │ │ │ ├── how-to-respond-to-clicks-in-the-windows-forms-datagrid-control.md │ │ │ ├── how-to-respond-to-windows-forms-button-clicks.md │ │ │ ├── how-to-respond-to-windows-forms-checkbox-clicks.md │ │ │ ├── how-to-run-an-operation-in-the-background.md │ │ │ ├── how-to-save-files-using-the-savefiledialog-component.md │ │ │ ├── how-to-save-files-with-the-windows-forms-richtextbox-control.md │ │ │ ├── how-to-select-a-range-of-dates-in-the-windows-forms-monthcalendar-control.md │ │ │ ├── how-to-select-an-item-in-the-windows-forms-listview-control.md │ │ │ ├── how-to-select-text-in-the-windows-forms-textbox-control.md │ │ │ ├── how-to-set-alternating-row-styles-for-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-set-and-return-dates-with-the-windows-forms-datetimepicker-control.md │ │ │ ├── how-to-set-default-cell-styles-for-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-set-font-and-color-styles-in-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-set-font-attributes-for-the-windows-forms-richtextbox-control.md │ │ │ ├── how-to-set-grid-options-for-all-windows-forms.md │ │ │ ├── how-to-set-icons-for-the-windows-forms-treeview-control.md │ │ │ ├── how-to-set-options-with-windows-forms-checkbox-controls.md │ │ │ ├── how-to-set-pictures-at-run-time-windows-forms.md │ │ │ ├── how-to-set-the-background-of-a-windows-forms-panel-using-the-designer.md │ │ │ ├── how-to-set-the-background-of-a-windows-forms-panel.md │ │ │ ├── how-to-set-the-format-for-the-windows-forms-numericupdown-control.md │ │ │ ├── how-to-set-the-image-displayed-by-a-windows-forms-control.md │ │ │ ├── how-to-set-the-input-mask.md │ │ │ ├── how-to-set-the-selection-mode-of-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-set-the-size-of-status-bar-panels.md │ │ │ ├── how-to-set-the-sizing-modes-of-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-set-the-tab-order-on-windows-forms.md │ │ │ ├── how-to-set-the-text-displayed-by-a-windows-forms-control.md │ │ │ ├── how-to-set-the-toolstrip-renderer-at-run-time.md │ │ │ ├── how-to-set-the-toolstrip-renderer-for-an-application.md │ │ │ ├── how-to-set-the-value-displayed-by-the-windows-forms-progressbar-control.md │ │ │ ├── how-to-set-tooltips-for-controls-on-a-windows-form-at-design-time.md │ │ │ ├── how-to-set-up-automatic-menu-merging-for-mdi-applications.md │ │ │ ├── how-to-share-bound-data-across-forms-using-the-bindingsource-component.md │ │ │ ├── how-to-show-a-color-palette-with-the-colordialog-component.md │ │ │ ├── how-to-show-a-font-list-with-the-fontdialog-component.md │ │ │ ├── how-to-size-a-windows-forms-label-control-to-fit-its-contents.md │ │ │ ├── how-to-span-rows-and-columns-in-a-tablelayoutpanel-control.md │ │ │ ├── how-to-specify-the-edit-mode-for-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-split-a-window-horizontally-using-the-designer.md │ │ │ ├── how-to-split-a-window-horizontally.md │ │ │ ├── how-to-test-the-run-time-behavior-of-a-usercontrol.md │ │ │ ├── how-to-trigger-menu-events-for-toolbar-buttons.md │ │ │ ├── how-to-use-a-background-thread-to-search-for-files.md │ │ │ ├── how-to-use-a-control-rendering-class.md │ │ │ ├── how-to-use-the-spring-property-interactively-in-a-statusstrip.md │ │ │ ├── how-to-use-toolstrippanels-for-mdi.md │ │ │ ├── how-to-use-tooltips-in-toolstrip-controls.md │ │ │ ├── how-to-validate-data-in-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-validate-input-with-the-windows-forms-datagrid-control.md │ │ │ ├── how-to-view-multiple-lines-in-the-windows-forms-textbox-control.md │ │ │ ├── how-to-work-with-image-columns-in-the-windows-forms-datagridview-control.md │ │ │ ├── how-to-wrap-a-windows-forms-control-with-toolstripcontrolhost.md │ │ │ ├── hscrollbar-and-vscrollbar-controls-overview-windows-forms.md │ │ │ ├── hscrollbar-and-vscrollbar-controls-windows-forms.md │ │ │ ├── imagelist-component-overview-windows-forms.md │ │ │ ├── imagelist-component-windows-forms.md │ │ │ ├── implement-two-way-com-between-dhtml-and-client.md │ │ │ ├── implementing-virtual-mode-jit-data-loading-in-the-datagrid.md │ │ │ ├── implementing-virtual-mode-wf-datagridview-control.md │ │ │ ├── index.md │ │ │ ├── keyboard-shortcuts-for-the-windows-forms-datagrid-control.md │ │ │ ├── known-folder-guids-for-file-dialog-custom-places.md │ │ │ ├── label-control-overview-windows-forms.md │ │ │ ├── label-control-windows-forms.md │ │ │ ├── labeling-individual-windows-forms-controls-and-providing-shortcuts-to-them.md │ │ │ ├── layout-in-windows-forms-controls.md │ │ │ ├── limitations-of-the-timer-component-interval-property.md │ │ │ ├── link-to-an-object-or-web-page-with-wf-linklabel-control.md │ │ │ ├── linklabel-control-overview-windows-forms.md │ │ │ ├── linklabel-control-windows-forms.md │ │ │ ├── listbox-control-overview-windows-forms.md │ │ │ ├── listbox-control-windows-forms.md │ │ │ ├── listview-control-overview-windows-forms.md │ │ │ ├── listview-control-windows-forms.md │ │ │ ├── load-save-and-cancel-bindingnavigator.md │ │ │ ├── mainmenu-component-overview-windows-forms.md │ │ │ ├── mainmenu-component-windows-forms.md │ │ │ ├── make-columns-read-only-in-the-datagrid-using-the-designer.md │ │ │ ├── margin-and-padding-in-windows-forms-controls.md │ │ │ ├── maskedtextbox-control-windows-forms.md │ │ │ ├── media │ │ │ │ ├── bindingnavigator-control-overview-windows-forms │ │ │ │ │ └── bindingnavigator-control-form.gif │ │ │ │ ├── cell-styles-in-the-windows-forms-datagridview-control │ │ │ │ │ ├── datagridviewcells-inheritance-diagram.gif │ │ │ │ │ └── datagridviewcells-value-inheritance-diagram.gif │ │ │ │ ├── creating-a-wf-control-design-time-features │ │ │ │ │ └── demo-marquee-control.gif │ │ │ │ ├── datagrid-control-overview-windows-forms │ │ │ │ │ ├── datagrid-bound-multiple-tables.gif │ │ │ │ │ ├── show-hide-parent-rows.gif │ │ │ │ │ └── visual-basic-columns.gif │ │ │ │ ├── datagridview-control-architecture-windows-forms │ │ │ │ │ ├── datagridviewcell-object-model.gif │ │ │ │ │ ├── datagridviewcolumn-object-model.gif │ │ │ │ │ ├── datagridviewediting-object-model.gif │ │ │ │ │ ├── datagridviewelement-object-model.gif │ │ │ │ │ └── datagridviewrow-object-model.gif │ │ │ │ ├── enable-tile-view-in-a-wf-listview-control-using-the-designer │ │ │ │ │ └── tile-view-in-listview-control.gif │ │ │ │ ├── errorprovider-component-overview-windows-forms │ │ │ │ │ └── vb-error-provider-icon.gif │ │ │ │ ├── how-to-display-an-insertion-mark-in-a-windows-forms-listview-control │ │ │ │ │ └── listview-insertion-mark.gif │ │ │ │ ├── how-to-enable-tile-view-in-a-windows-forms-listview-control │ │ │ │ │ └── tile-view-in-listview-control.gif │ │ │ │ ├── how-to-group-items-in-a-windows-forms-listview-control-using-the-designer │ │ │ │ │ └── odd-even-list-view-groups.gif │ │ │ │ ├── net-bindsrcdatabindarch.gif │ │ │ │ ├── net-flpanchorexp.gif │ │ │ │ ├── toolstrip-control-architecture │ │ │ │ │ ├── toolstrip-object-model.gif │ │ │ │ │ └── toolstripitem-object-model.gif │ │ │ │ ├── visual-studio-ellipsis-button.png │ │ │ │ ├── vs-flpanchor2.gif │ │ │ │ ├── vs-tlpanchor.gif │ │ │ │ ├── vs-tlpanchor2.gif │ │ │ │ ├── vs-tlpanchor3.gif │ │ │ │ ├── vs-winformpadmargin.gif │ │ │ │ ├── vs-winformsmttagglyph.gif │ │ │ │ ├── windows-forms-designer-error-page-collapsed.png │ │ │ │ └── windows-forms-designer-error-page-expanded.png │ │ │ ├── menustrip-control-overview-windows-forms.md │ │ │ ├── menustrip-control-windows-forms.md │ │ │ ├── merging-menu-items-in-the-windows-forms-menustrip-control.md │ │ │ ├── method-implementation-in-custom-controls.md │ │ │ ├── monthcalendar-control-overview-windows-forms.md │ │ │ ├── monthcalendar-control-windows-forms.md │ │ │ ├── move-through-a-dataset-with-wf-bindingnavigator-control.md │ │ │ ├── multithreading-in-windows-forms-controls.md │ │ │ ├── notifyicon-component-overview-windows-forms.md │ │ │ ├── notifyicon-component-windows-forms.md │ │ │ ├── numericupdown-control-overview-windows-forms.md │ │ │ ├── numericupdown-control-windows-forms.md │ │ │ ├── openfiledialog-component-overview-windows-forms.md │ │ │ ├── openfiledialog-component-windows-forms.md │ │ │ ├── overriding-the-onpaint-method.md │ │ │ ├── overview-of-using-controls-in-windows-forms.md │ │ │ ├── pagesetupdialog-component-overview-windows-forms.md │ │ │ ├── pagesetupdialog-component-windows-forms.md │ │ │ ├── panel-control-overview-windows-forms.md │ │ │ ├── panel-control-windows-forms.md │ │ │ ├── perform-a-custom-action-based-on-changes-in-a-cell-of-a-datagrid.md │ │ │ ├── performance-tuning-in-the-windows-forms-datagridview-control.md │ │ │ ├── performing-common-tasks-using-smart-tags-on-wf-controls.md │ │ │ ├── picturebox-control-overview-windows-forms.md │ │ │ ├── picturebox-control-windows-forms.md │ │ │ ├── prevent-row-addition-and-deletion-datagridview.md │ │ │ ├── prevent-row-addition-and-deletion-in-the-datagrid-using-the-designer.md │ │ │ ├── printdialog-component-overview-windows-forms.md │ │ │ ├── printdialog-component-windows-forms.md │ │ │ ├── printdocument-component-overview-windows-forms.md │ │ │ ├── printdocument-component-windows-forms.md │ │ │ ├── printpreviewcontrol-control-overview-windows-forms.md │ │ │ ├── printpreviewcontrol-control-windows-forms.md │ │ │ ├── printpreviewdialog-control-overview-windows-forms.md │ │ │ ├── printpreviewdialog-control-windows-forms.md │ │ │ ├── programmatically-resize-cells-to-fit-content-in-the-datagrid.md │ │ │ ├── programming-with-cells-rows-and-columns-in-the-datagrid.md │ │ │ ├── progressbar-control-overview-windows-forms.md │ │ │ ├── progressbar-control-windows-forms.md │ │ │ ├── properties-in-windows-forms-controls.md │ │ │ ├── property-changed-events.md │ │ │ ├── providing-accessibility-information-for-controls-on-a-windows-form.md │ │ │ ├── putting-controls-on-windows-forms.md │ │ │ ├── radiobutton-control-overview-windows-forms.md │ │ │ ├── radiobutton-control-windows-forms.md │ │ │ ├── raise-change-notifications--bindingsource.md │ │ │ ├── reflect-data-source-updates-in-a-wf-control-with-the-bindingsource.md │ │ │ ├── remove-autogenerated-columns-from-a-wf-datagridview-control.md │ │ │ ├── rendering-a-windows-forms-control.md │ │ │ ├── rendering-controls-with-visual-styles.md │ │ │ ├── resizing-columns-and-rows-in-the-windows-forms-datagridview-control.md │ │ │ ├── richtextbox-control-overview-windows-forms.md │ │ │ ├── richtextbox-control-windows-forms.md │ │ │ ├── run-procedures-at-set-intervals-with-wf-timer-component.md │ │ │ ├── savefiledialog-component-overview-windows-forms.md │ │ │ ├── savefiledialog-component-windows-forms.md │ │ │ ├── selected-cells-rows-and-columns-datagridview.md │ │ │ ├── selection-and-clipboard-use-with-the-windows-forms-datagridview-control.md │ │ │ ├── selection-modes-in-the-windows-forms-datagridview-control.md │ │ │ ├── serializing-collections-designerserializationvisibilityattribute.md │ │ │ ├── set-alternating-row-styles-for-the-datagrid-using-the-designer.md │ │ │ ├── set-and-return-numeric-values-with-wf-numericupdown-control.md │ │ │ ├── set-indents-hanging-indents-bulleted-paragraphs-with-wf-richtextbox.md │ │ │ ├── set-the-sort-modes-for-columns-wf-datagridview-control.md │ │ │ ├── sizing-options-in-the-windows-forms-datagridview-control.md │ │ │ ├── sort-and-filter-ado-net-data-with-wf-bindingsource-component.md │ │ │ ├── sort-the-contents-of-a-wf-combobox-listbox-or-checkedlistbox-control.md │ │ │ ├── sorting-data-in-the-windows-forms-datagridview-control.md │ │ │ ├── soundplayer-class-overview.md │ │ │ ├── soundplayer-class.md │ │ │ ├── specify-default-values-for-new-rows-in-the-datagrid.md │ │ │ ├── splitcontainer-control-overview-windows-forms.md │ │ │ ├── splitcontainer-control-windows-forms.md │ │ │ ├── splitter-control-overview-windows-forms.md │ │ │ ├── splitter-control-windows-forms.md │ │ │ ├── statusbar-control-overview-windows-forms.md │ │ │ ├── statusbar-control-windows-forms.md │ │ │ ├── statusstrip-control-overview.md │ │ │ ├── statusstrip-control.md │ │ │ ├── stretch-a-toolstriptextbox-to-fill-the-remaining-width-of-a-toolstrip-wf.md │ │ │ ├── tabcontrol-control-overview-windows-forms.md │ │ │ ├── tabcontrol-control-windows-forms.md │ │ │ ├── tablelayoutpanel-control-overview.md │ │ │ ├── tablelayoutpanel-control-windows-forms.md │ │ │ ├── textbox-control-overview-windows-forms.md │ │ │ ├── textbox-control-windows-forms.md │ │ │ ├── timer-component-overview-windows-forms.md │ │ │ ├── timer-component-windows-forms.md │ │ │ ├── toc.yml │ │ │ ├── toolbar-control-overview-windows-forms.md │ │ │ ├── toolbar-control-windows-forms.md │ │ │ ├── toolstrip-control-architecture.md │ │ │ ├── toolstrip-control-overview-windows-forms.md │ │ │ ├── toolstrip-control-windows-forms.md │ │ │ ├── toolstrip-technology-summary.md │ │ │ ├── toolstripcontainer-control-overview.md │ │ │ ├── toolstripcontainer-control.md │ │ │ ├── toolstrippanel-control-overview.md │ │ │ ├── toolstrippanel-control.md │ │ │ ├── toolstripprogressbar-control-overview.md │ │ │ ├── toolstripprogressbar-control.md │ │ │ ├── toolstripstatuslabel-control-overview.md │ │ │ ├── toolstripstatuslabel-control.md │ │ │ ├── tooltip-component-overview-windows-forms.md │ │ │ ├── tooltip-component-windows-forms.md │ │ │ ├── trackbar-control-overview-windows-forms.md │ │ │ ├── trackbar-control-windows-forms.md │ │ │ ├── treeview-control-overview-windows-forms.md │ │ │ ├── treeview-control-windows-forms.md │ │ │ ├── troubleshooting-control-and-component-authoring.md │ │ │ ├── unbound-column-to-a-data-bound-datagridview.md │ │ │ ├── use-the-row-template-to-customize-rows-in-the-datagrid.md │ │ │ ├── user-drawn-controls.md │ │ │ ├── using-the-designer-with-the-windows-forms-datagridview-control.md │ │ │ ├── using-the-managed-html-document-object-model.md │ │ │ ├── using-the-row-for-new-records-in-the-windows-forms-datagridview-control.md │ │ │ ├── varieties-of-custom-controls.md │ │ │ ├── view-errors-within-a-dataset-with-wf-errorprovider-component.md │ │ │ ├── virtual-mode-in-the-windows-forms-datagridview-control.md │ │ │ ├── virtual-mode-with-just-in-time-data-loading-in-the-datagrid.md │ │ │ ├── walkthrough-arranging-controls-on-windows-forms-using-a-flowlayoutpanel.md │ │ │ ├── walkthrough-arranging-controls-on-windows-forms-using-a-tablelayoutpanel.md │ │ │ ├── walkthrough-arranging-controls-on-windows-forms-using-snaplines.md │ │ │ ├── walkthrough-authoring-a-composite-control-with-visual-csharp.md │ │ │ ├── walkthrough-automatically-populating-the-toolbox-with-custom-components.md │ │ │ ├── walkthrough-creating-a-professionally-styled-toolstrip-control.md │ │ │ ├── walkthrough-creating-an-mdi-form-with-menu-merging-and-toolstrip-controls.md │ │ │ ├── walkthrough-creating-an-unbound-windows-forms-datagridview-control.md │ │ │ ├── walkthrough-debugging-custom-windows-forms-controls-at-design-time.md │ │ │ ├── walkthrough-implementing-a-form-that-uses-a-background-operation.md │ │ │ ├── walkthrough-inheriting-from-a-windows-forms-control-with-visual-csharp.md │ │ │ ├── walkthrough-providing-standard-menu-items-to-a-form.md │ │ │ ├── walkthrough-running-an-operation-in-the-background.md │ │ │ ├── walkthrough-updating-status-bar-information-at-run-time.md │ │ │ ├── walkthrough-validating-data-in-the-windows-forms-datagridview-control.md │ │ │ ├── walkthrough-working-with-the-maskedtextbox-control.md │ │ │ ├── ways-to-select-a-windows-forms-button-control.md │ │ │ ├── webbrowser-control-overview.md │ │ │ ├── webbrowser-control-windows-forms.md │ │ │ ├── webbrowser-security.md │ │ │ ├── when-to-use-a-windows-forms-combobox-instead-of-a-listbox.md │ │ │ ├── windows-forms-control-development-basics.md │ │ │ ├── windows-forms-controls-by-function.md │ │ │ ├── windows-forms-controls-padding-autosize.md │ │ │ └── windows-forms-controls-used-to-list-options.md │ │ ├── creating-a-new-windows-form.md │ │ ├── creating-event-handlers-in-windows-forms.md │ │ ├── data-binding-and-windows-forms.md │ │ ├── data-sources-supported-by-windows-forms.md │ │ ├── dialog-boxes-in-windows-forms.md │ │ ├── drag-and-drop-functionality-in-windows-forms.md │ │ ├── ensure-the-selected-row-in-a-child-table-correct.md │ │ ├── event-handlers-overview-windows-forms.md │ │ ├── events-overview-windows-forms.md │ │ ├── getting-started-with-windows-forms.md │ │ ├── high-dpi-support-in-windows-forms.md │ │ ├── how-keyboard-input-works.md │ │ ├── how-mouse-input-works-in-windows-forms.md │ │ ├── how-to-access-keyed-collections-in-windows-forms.md │ │ ├── how-to-apply-the-propertynamechanged-pattern.md │ │ ├── how-to-change-the-borders-of-windows-forms.md │ │ ├── how-to-connect-multiple-events-to-a-single-event-handler-in-windows-forms.md │ │ ├── how-to-create-a-bound-control-and-format-the-displayed-data.md │ │ ├── how-to-create-a-simple-bound-control-on-a-windows-form.md │ │ ├── how-to-create-a-windows-forms-application-from-the-command-line.md │ │ ├── how-to-create-event-handlers-at-run-time-for-windows-forms.md │ │ ├── how-to-determine-which-modifier-key-was-pressed.md │ │ ├── how-to-display-dialog-boxes-for-windows-forms.md │ │ ├── how-to-distinguish-between-clicks-and-double-clicks.md │ │ ├── how-to-handle-keyboard-input-at-the-form-level.md │ │ ├── how-to-handle-user-input-events-in-windows-forms-controls.md │ │ ├── how-to-implement-the-ilistsource-interface.md │ │ ├── how-to-implement-the-inotifypropertychanged-interface.md │ │ ├── how-to-implement-the-itypedlist-interface.md │ │ ├── how-to-modify-keyboard-input-to-a-standard-control.md │ │ ├── how-to-navigate-data-in-windows-forms.md │ │ ├── how-to-resize-windows-forms.md │ │ ├── how-to-respond-to-font-scheme-changes-in-a-windows-forms-application.md │ │ ├── how-to-simulate-mouse-and-keyboard-events-in-code.md │ │ ├── index.md │ │ ├── interfaces-related-to-data-binding.md │ │ ├── keyboard-input-in-a-windows-forms-application.md │ │ ├── media │ │ │ ├── how-to-create-a-bound-control-and-format-the-displayed-data │ │ │ │ └── visual-studio-ellipsis-button.png │ │ │ ├── how-to-create-a-simple-bound-control-on-a-windows-form │ │ │ │ └── visual-studio-ellipsis-button.png │ │ │ └── vxeventsbutton-propertieswindow.png │ │ ├── more-secure-file-and-data-access-in-windows-forms.md │ │ ├── more-secure-printing-in-windows-forms.md │ │ ├── mouse-capture-in-windows-forms.md │ │ ├── mouse-events-in-windows-forms.md │ │ ├── mouse-input-in-a-windows-forms-application.md │ │ ├── mouse-pointers-in-windows-forms.md │ │ ├── multiple-controls-bound-to-data-source-synchronized.md │ │ ├── order-of-events-in-windows-forms.md │ │ ├── security-in-windows-forms-overview.md │ │ ├── toc.yml │ │ ├── user-input-in-a-windows-forms-application.md │ │ ├── user-input-in-windows-forms.md │ │ ├── user-input-validation-in-windows-forms.md │ │ ├── using-keyboard-events.md │ │ ├── windows-forms-coordinates.md │ │ ├── windows-forms-data-binding.md │ │ ├── windows-forms-overview.md │ │ └── windows-forms-security.md │ ├── wpf │ │ ├── advanced │ │ │ ├── activate-function-wpf-unmanaged-api-reference.md │ │ │ ├── advanced-ink-handling.md │ │ │ ├── advanced-text-formatting.md │ │ │ ├── alignment-margins-and-padding-overview.md │ │ │ ├── annotations-overview.md │ │ │ ├── annotations-schema.md │ │ │ ├── annotations.md │ │ │ ├── application-startup-time.md │ │ │ ├── attached-events-overview.md │ │ │ ├── attached-properties-overview.md │ │ │ ├── base-elements-how-to-topics.md │ │ │ ├── base-elements-overview.md │ │ │ ├── base-elements.md │ │ │ ├── bidirectional-features-in-wpf-overview.md │ │ │ ├── binding-markup-extension.md │ │ │ ├── cleartype-overview.md │ │ │ ├── cleartype-registry-settings.md │ │ │ ├── code-behind-and-xaml-in-wpf.md │ │ │ ├── collecting-ink.md │ │ │ ├── collection-type-dependency-properties.md │ │ │ ├── colorconvertedbitmap-markup-extension.md │ │ │ ├── commanding-overview.md │ │ │ ├── componentresourcekey-markup-extension.md │ │ │ ├── createidispatchstaforwarder-function-wpf-unmanaged-api-reference.md │ │ │ ├── creating-an-ink-input-control.md │ │ │ ├── custom-dependency-properties.md │ │ │ ├── custom-rendering-ink.md │ │ │ ├── data-and-data-objects.md │ │ │ ├── datetime-xaml-syntax.md │ │ │ ├── deactivate-function-wpf-unmanaged-api-reference.md │ │ │ ├── dependency-properties-overview.md │ │ │ ├── dependency-property-callbacks-and-validation.md │ │ │ ├── dependency-property-metadata.md │ │ │ ├── dependency-property-security.md │ │ │ ├── dependency-property-value-precedence.md │ │ │ ├── digital-ink-how-to-topics.md │ │ │ ├── digital-ink-overviews.md │ │ │ ├── digital-ink.md │ │ │ ├── disable-the-realtimestylus-for-wpf-applications.md │ │ │ ├── document-serialization-and-storage.md │ │ │ ├── documents-in-wpf.md │ │ │ ├── documents.md │ │ │ ├── drag-and-drop-how-to-topics.md │ │ │ ├── drag-and-drop-overview.md │ │ │ ├── drag-and-drop.md │ │ │ ├── draw-text-using-glyphs.md │ │ │ ├── drawing-formatted-text.md │ │ │ ├── dynamicresource-markup-extension.md │ │ │ ├── element-tree-and-serialization-how-to-topics.md │ │ │ ├── element-tree-and-serialization.md │ │ │ ├── events-how-to-topics.md │ │ │ ├── events-wpf.md │ │ │ ├── flow-content-elements-how-to-topics.md │ │ │ ├── flow-content.md │ │ │ ├── flow-document-overview.md │ │ │ ├── focus-overview.md │ │ │ ├── fonts-how-to-topics.md │ │ │ ├── fonts-wpf.md │ │ │ ├── forwardtranslateaccelerator-function-wpf-unmanaged-api-reference.md │ │ │ ├── framework-property-metadata.md │ │ │ ├── freezable-objects-overview.md │ │ │ ├── getting-started-with-ink.md │ │ │ ├── globalization-and-localization-how-to-topics.md │ │ │ ├── globalization-and-localization.md │ │ │ ├── globalization-for-wpf.md │ │ │ ├── glyphs.md │ │ │ ├── graphics-rendering-tiers.md │ │ │ ├── handwriting-recognition.md │ │ │ ├── hosting-win32-content-in-wpf.md │ │ │ ├── how-to-add-an-event-handler-using-code.md │ │ │ ├── how-to-add-an-owner-type-for-a-dependency-property.md │ │ │ ├── how-to-add-class-handling-for-a-routed-event.md │ │ │ ├── how-to-add-custom-data-to-ink-data.md │ │ │ ├── how-to-adjust-spacing-between-paragraphs.md │ │ │ ├── how-to-alter-the-typography-of-text.md │ │ │ ├── how-to-analyze-ink-with-analysis-hints.md │ │ │ ├── how-to-animate-the-size-of-a-frameworkelement.md │ │ │ ├── how-to-apply-a-focusvisualstyle-to-a-control.md │ │ │ ├── how-to-apply-animations-to-text.md │ │ │ ├── how-to-apply-transforms-to-text.md │ │ │ ├── how-to-build-a-table-programmatically.md │ │ │ ├── how-to-change-the-color-of-an-element-using-focus-events.md │ │ │ ├── how-to-change-the-cursor-type.md │ │ │ ├── how-to-change-the-flowdirection-of-content-programmatically.md │ │ │ ├── how-to-change-the-textwrapping-property-programmatically.md │ │ │ ├── how-to-clone-a-printer.md │ │ │ ├── how-to-create-a-custom-routed-event.md │ │ │ ├── how-to-create-a-data-object.md │ │ │ ├── how-to-create-a-rollover-effect-using-events.md │ │ │ ├── how-to-create-a-routedcommand.md │ │ │ ├── how-to-create-a-text-decoration.md │ │ │ ├── how-to-create-outlined-text.md │ │ │ ├── how-to-create-text-with-a-shadow.md │ │ │ ├── how-to-data-bind-to-an-inkcanvas.md │ │ │ ├── how-to-define-a-table-with-xaml.md │ │ │ ├── how-to-define-and-reference-a-resource.md │ │ │ ├── how-to-detect-when-the-enter-key-pressed.md │ │ │ ├── how-to-determine-if-a-data-format-is-present-in-a-data-object.md │ │ │ ├── how-to-determine-whether-a-freezable-is-frozen.md │ │ │ ├── how-to-diagnose-problematic-print-job.md │ │ │ ├── how-to-discover-whether-a-print-job-can-be-printed-at-this-time-of-day.md │ │ │ ├── how-to-drag-and-drop-ink.md │ │ │ ├── how-to-draw-text-to-a-control-background.md │ │ │ ├── how-to-draw-text-to-a-visual.md │ │ │ ├── how-to-enable-a-command.md │ │ │ ├── how-to-enable-text-trimming.md │ │ │ ├── how-to-enable-visual-styles-in-a-hybrid-application.md │ │ │ ├── how-to-enumerate-a-subset-of-print-queues.md │ │ │ ├── how-to-enumerate-system-fonts.md │ │ │ ├── how-to-erase-ink-on-a-custom-control.md │ │ │ ├── how-to-find-an-element-by-its-name.md │ │ │ ├── how-to-find-the-source-element-in-an-event-handler.md │ │ │ ├── how-to-flip-a-uielement-horizontally-or-vertically.md │ │ │ ├── how-to-get-print-system-object-properties-without-reflection.md │ │ │ ├── how-to-handle-a-loaded-event.md │ │ │ ├── how-to-handle-a-routed-event.md │ │ │ ├── how-to-handle-the-contextmenuopening-event.md │ │ │ ├── how-to-hook-up-a-command-to-a-control-with-command-support.md │ │ │ ├── how-to-hook-up-a-command-to-a-control-with-no-command-support.md │ │ │ ├── how-to-implement-a-dependency-property.md │ │ │ ├── how-to-implement-icommandsource.md │ │ │ ├── how-to-insert-an-element-into-text-programmatically.md │ │ │ ├── how-to-invoke-a-print-dialog.md │ │ │ ├── how-to-list-the-data-formats-in-a-data-object.md │ │ │ ├── how-to-localize-an-application.md │ │ │ ├── how-to-make-a-freezable-read-only.md │ │ │ ├── how-to-make-a-uielement-transparent-or-semi-transparent.md │ │ │ ├── how-to-make-an-object-follow-the-mouse-pointer.md │ │ │ ├── how-to-manipulate-a-flowdocument-through-the-blocks-property.md │ │ │ ├── how-to-manipulate-flow-content-elements-through-the-blocks-property.md │ │ │ ├── how-to-manipulate-flow-content-elements-through-the-inlines-property.md │ │ │ ├── how-to-manipulate-table-columns-through-the-columns-property.md │ │ │ ├── how-to-manipulate-table-row-groups-through-the-rowgroups-property.md │ │ │ ├── how-to-obtain-a-writable-copy-of-a-read-only-freezable.md │ │ │ ├── how-to-open-a-file-that-is-dropped-on-a-richtextbox-control.md │ │ │ ├── how-to-override-metadata-for-a-dependency-property.md │ │ │ ├── how-to-override-the-logical-tree.md │ │ │ ├── how-to-programmatically-print-xps-files.md │ │ │ ├── how-to-recognize-application-gestures.md │ │ │ ├── how-to-register-an-attached-property.md │ │ │ ├── how-to-remotely-survey-the-status-of-printers.md │ │ │ ├── how-to-retrieve-data-in-a-particular-data-format.md │ │ │ ├── how-to-rotate-ink.md │ │ │ ├── how-to-select-ink-from-a-custom-control.md │ │ │ ├── how-to-set-margins-of-elements-and-controls.md │ │ │ ├── how-to-specify-whether-a-hyperlink-is-underlined.md │ │ │ ├── how-to-store-multiple-data-formats-in-a-data-object.md │ │ │ ├── how-to-use-a-grid-for-automatic-layout.md │ │ │ ├── how-to-use-a-resourcedictionary-to-manage-localizable-string-resources.md │ │ │ ├── how-to-use-a-thicknessconverter-object.md │ │ │ ├── how-to-use-application-resources.md │ │ │ ├── how-to-use-automatic-layout-to-create-a-button.md │ │ │ ├── how-to-use-flow-content-elements.md │ │ │ ├── how-to-use-flowdocument-column-separating-attributes.md │ │ │ ├── how-to-use-resources-in-localizable-applications.md │ │ │ ├── how-to-use-special-characters-in-xaml.md │ │ │ ├── how-to-use-system-fonts-keys.md │ │ │ ├── how-to-use-system-parameters-keys.md │ │ │ ├── how-to-use-systemfonts.md │ │ │ ├── how-to-use-systemparameters.md │ │ │ ├── how-to-use-the-fontsizeconverter-class.md │ │ │ ├── how-to-validate-and-merge-printtickets.md │ │ │ ├── index.md │ │ │ ├── initialization-for-object-elements-not-in-an-object-tree.md │ │ │ ├── inline-styles-and-templates.md │ │ │ ├── input-and-commands-how-to-topics.md │ │ │ ├── input-overview.md │ │ │ ├── input-wpf.md │ │ │ ├── intercepting-input-from-the-stylus.md │ │ │ ├── introduction-to-the-glyphrun-object-and-glyphs-element.md │ │ │ ├── layout-considerations-for-the-windowsformshost-element.md │ │ │ ├── layout.md │ │ │ ├── loadfromhistory-function-wpf-unmanaged-api-reference.md │ │ │ ├── localization-attributes-and-comments.md │ │ │ ├── marking-routed-events-as-handled-and-class-handling.md │ │ │ ├── markup-compatibility-mc-language-features.md │ │ │ ├── markup-extensions-and-wpf-xaml.md │ │ │ ├── mc-ignorable-attribute.md │ │ │ ├── mc-processcontent-attribute.md │ │ │ ├── media │ │ │ │ ├── advanced-text-formatting │ │ │ │ │ └── text-layout-textformatter-interaction.png │ │ │ │ ├── bidirectional-features-in-wpf-overview │ │ │ │ │ ├── arabic-english-numbers.png │ │ │ │ │ ├── arabic-numbers-flow-right-left.png │ │ │ │ │ ├── arrows-drawn-path-element.png │ │ │ │ │ ├── displays-arabic-numbers.png │ │ │ │ │ ├── embedded-span-element.png │ │ │ │ │ ├── explicit-direction-change.png │ │ │ │ │ ├── flipped-image-example.png │ │ │ │ │ ├── flow-direction-span-element.png │ │ │ │ │ ├── flow-direction-text-blocks.png │ │ │ │ │ ├── left-right-right-left.png │ │ │ │ │ ├── numbers-flow-right-left.png │ │ │ │ │ ├── toolbar-left-right-gradient.png │ │ │ │ │ └── toolbar-right-left-gradient.png │ │ │ │ ├── caf-callouts.png │ │ │ │ ├── caf-dataanchoring.png │ │ │ │ ├── caf-stickynote.jpg │ │ │ │ ├── cleartype-registry-settings │ │ │ │ │ ├── cleartype-gamma-level-settings-registry-editor.png │ │ │ │ │ └── cleartype-settings-registry-editor.png │ │ │ │ ├── d3dimage-buffers.png │ │ │ │ ├── directxdiagnostictool-01.png │ │ │ │ ├── dragdrop-colorstring.png │ │ │ │ ├── dragdrop-customcursor.png │ │ │ │ ├── dragdrop-dropgreentext.png │ │ │ │ ├── dragdrop-paneldrop.png │ │ │ │ ├── dragdrop-previeweffects.png │ │ │ │ ├── drawing-formatted-text │ │ │ │ │ ├── formatted-text-wordwrap-ellipsis.png │ │ │ │ │ ├── sphere-following-geometry-path.gif │ │ │ │ │ └── video-displaying-text-path-geometry.png │ │ │ │ ├── edocs-flowdocument.png │ │ │ │ ├── flow-class-hierarchy.png │ │ │ │ ├── flow-content-schema.png │ │ │ │ ├── flow-document-overview │ │ │ │ │ └── embedded-blockuicontainer.png │ │ │ │ ├── flow-insertelementintotextprogrammatically.png │ │ │ │ ├── flow-ovw-figure-example.png │ │ │ │ ├── flow-ovw-first-example.png │ │ │ │ ├── flow-ovw-linebreakexample.png │ │ │ │ ├── flow-ovw-schemawalkthrough1.png │ │ │ │ ├── flow-ovw-schemawalkthrough2.png │ │ │ │ ├── flow-ovw-schemawalkthrough3.png │ │ │ │ ├── flow-ovw-schemawalkthrough4.png │ │ │ │ ├── flow-spanexample.gif │ │ │ │ ├── getting-started-with-ink │ │ │ │ │ ├── gradient-colors.png │ │ │ │ │ ├── inkcanvas-xaml.png │ │ │ │ │ └── reference-manager-presentationcore-presentationframework.png │ │ │ │ ├── glob-grid.png │ │ │ │ ├── glyph-example.png │ │ │ │ ├── graphicsmm-buttonflipbeforeflip.gif │ │ │ │ ├── graphicsmm-buttonfliphorizontalflip-displaced.gif │ │ │ │ ├── graphicsmm-buttonfliphorizontalflip-inplace.gif │ │ │ │ ├── graphicsmm-buttonflipverticalflip-inplace.gif │ │ │ │ ├── hosting-win32-content-in-wpf │ │ │ │ │ └── windows-presentation-foundation-application.PNG │ │ │ │ ├── how-to-apply-animations-to-text │ │ │ │ │ └── faded-text-opacity-change.png │ │ │ │ ├── how-to-apply-transforms-to-text │ │ │ │ │ ├── scaled-text-scaletransform.jpg │ │ │ │ │ ├── skewed-transformed-text.jpg │ │ │ │ │ ├── text-rotated-ninety-degrees.jpg │ │ │ │ │ └── transformed-text-x-y-axis.jpg │ │ │ │ ├── how-to-create-a-text-decoration │ │ │ │ │ ├── text-decoration-gradient.png │ │ │ │ │ ├── text-decoration-types.gif │ │ │ │ │ └── text-decorations-hyperlinks.png │ │ │ │ ├── how-to-create-outlined-text │ │ │ │ │ ├── fill-stroke-text-effect.jpg │ │ │ │ │ ├── image-brush-application.jpg │ │ │ │ │ ├── image-brush-text-application.jpg │ │ │ │ │ ├── text-linear-gradient.jpg │ │ │ │ │ └── text-outline-linear-gradient.jpg │ │ │ │ ├── how-to-create-text-with-a-shadow │ │ │ │ │ ├── drop-shadow-degree-setting.png │ │ │ │ │ ├── drop-shadow-text-effect.jpg │ │ │ │ │ ├── text-shadow-blur-effect.jpg │ │ │ │ │ ├── text-shadow-softness.jpg │ │ │ │ │ └── text-transform-shadow-effect.jpg │ │ │ │ ├── how-to-define-a-table-with-xaml │ │ │ │ │ └── planetary-information-xaml-table.png │ │ │ │ ├── how-to-draw-text-to-a-control-background │ │ │ │ │ └── draw-text-background.png │ │ │ │ ├── how-to-specify-whether-a-hyperlink-is-underlined │ │ │ │ │ └── text-decorations-hyperlinks.png │ │ │ │ ├── how-to-use-flowdocument-column-separating-attributes │ │ │ │ │ └── flowdocument-intra-column.png │ │ │ │ ├── ink-inkownsstrokes.png │ │ │ │ ├── ink-stylusevents.png │ │ │ │ ├── ink-stylusplugins.png │ │ │ │ ├── ink-wpfinkobjectmodel.png │ │ │ │ ├── inkthreading-drawingink.png │ │ │ │ ├── inkthreading-plugincallbacks.png │ │ │ │ ├── inkthreading-pluginorder.png │ │ │ │ ├── inkthreading-visualtree.png │ │ │ │ ├── inline-textdec-base.png │ │ │ │ ├── inline-textdec-over.png │ │ │ │ ├── inline-textdec-strike.png │ │ │ │ ├── inline-textdec-under.png │ │ │ │ ├── layout-horizontal-alignment-graphic.PNG │ │ │ │ ├── layout-margins-padding-aligment-graphic3.PNG │ │ │ │ ├── layout-margins-padding-alignment-graphic1.PNG │ │ │ │ ├── layout-margins-padding-alignment-graphic2.PNG │ │ │ │ ├── layout-vertical-alignment-graphic.PNG │ │ │ │ ├── layout │ │ │ │ │ ├── grid-no-bounding-box-superimpose.png │ │ │ │ │ └── visible-textblock-bounding-box.png │ │ │ │ ├── ndp-manipulationevents.png │ │ │ │ ├── ndp-touchevents.png │ │ │ │ ├── ndp-touchmanipulateevents.png │ │ │ │ ├── opentype-font-features │ │ │ │ │ ├── disabled-opentype-standard-ligatures.gif │ │ │ │ │ ├── opentype-capital-spacing.gif │ │ │ │ │ ├── opentype-capitals.gif │ │ │ │ │ ├── opentype-contextual-swashes.gif │ │ │ │ │ ├── opentype-discretionary-ligatures.gif │ │ │ │ │ ├── opentype-historical-forms.gif │ │ │ │ │ ├── opentype-old-style-numeral-sets.gif │ │ │ │ │ ├── opentype-old-style-numerals.gif │ │ │ │ │ ├── opentype-proportional-tabular-figures.gif │ │ │ │ │ ├── opentype-random-contextual-alternates.gif │ │ │ │ │ ├── opentype-slashed-stacked-fractions.gif │ │ │ │ │ ├── opentype-slashed-zero-numerals.gif │ │ │ │ │ ├── opentype-standard-glyphs.gif │ │ │ │ │ ├── opentype-standard-ligatures-palatino.gif │ │ │ │ │ ├── opentype-standard-ligatures.gif │ │ │ │ │ ├── opentype-standard-swash-glyphs.gif │ │ │ │ │ ├── opentype-stylistic-alternate-glyphs-pericles.gif │ │ │ │ │ ├── opentype-stylistic-alternate-glyphs.gif │ │ │ │ │ ├── opentype-subscripts.gif │ │ │ │ │ ├── opentype-superscripts-subscripts.gif │ │ │ │ │ ├── opentype-superscripts.gif │ │ │ │ │ ├── opentype-swashes.gif │ │ │ │ │ └── opentype-titling-capitals.gif │ │ │ │ ├── printing-overview │ │ │ │ │ └── xml-paper-specification-print-system.png │ │ │ │ ├── routed-events-overview │ │ │ │ │ └── input-event-routing.png │ │ │ │ ├── routedevent-ovw-1.gif │ │ │ │ ├── sample-opentype-font-pack │ │ │ │ │ └── font-names-sample-pack.gif │ │ │ │ ├── table-columnspan.png │ │ │ │ ├── table-overview │ │ │ │ │ └── basic-table-render-example.png │ │ │ │ ├── table-rowgroups.png │ │ │ │ ├── table-zorder.png │ │ │ │ ├── technology-regions-overview │ │ │ │ │ ├── nonrectangular-win32-region.png │ │ │ │ │ ├── render-windows-presentation-foundation-circle-over-win32-region.png │ │ │ │ │ ├── win32-directx-windows-presentation-foundation-application.png │ │ │ │ │ ├── win32-region-rectangular-hole.png │ │ │ │ │ └── windows-foundation-presentation-box-violate-win32-directx-region.png │ │ │ │ ├── textelement-typog-default.png │ │ │ │ ├── textelement-typog.png │ │ │ │ ├── texttrimming-character.png │ │ │ │ ├── texttrimming-none.png │ │ │ │ ├── texttrimming-word.png │ │ │ │ ├── threading-model │ │ │ │ │ ├── threading-dispatcher-queue.png │ │ │ │ │ ├── threading-message-loop.png │ │ │ │ │ ├── threading-prime-numbers.png │ │ │ │ │ ├── threading-reentrancy.png │ │ │ │ │ └── threading-weather-ui.png │ │ │ │ ├── typography-in-wpf │ │ │ │ │ ├── drop-shadow-noise-text.jpg │ │ │ │ │ ├── drop-shadow-text-effect.jpg │ │ │ │ │ ├── fill-stroke-text-effect.jpg │ │ │ │ │ ├── image-brush-application.jpg │ │ │ │ │ ├── image-brush-text-application.jpg │ │ │ │ │ ├── opentype-standard-swash-glyphs.gif │ │ │ │ │ ├── opentype-stylistic-alternate-glyphs.gif │ │ │ │ │ ├── rotating-text-effect.jpg │ │ │ │ │ ├── scaled-text-scaletransform.jpg │ │ │ │ │ ├── skewed-transformed-text.jpg │ │ │ │ │ ├── text-formatted-linear-gradient.jpg │ │ │ │ │ ├── text-layout-text-formatter-interaction.png │ │ │ │ │ ├── text-outline-linear-gradient.jpg │ │ │ │ │ ├── text-rendering-pipeline.png │ │ │ │ │ ├── text-shadow-blur-effect.jpg │ │ │ │ │ ├── text-shadow-glow-effect.jpg │ │ │ │ │ ├── text-y-direction-antialiasing.gif │ │ │ │ │ └── typography-text-flowdocumentreader.png │ │ │ │ ├── typographyinwpf-04.png │ │ │ │ ├── use-automatic-layout-overview │ │ │ │ │ └── auto-resizable-button.png │ │ │ │ ├── walkthrough-hosting-a-windows-forms-composite-control-in-wpf │ │ │ │ │ ├── windows-forms-control.gif │ │ │ │ │ └── windows-presentation-foundation-page-control.gif │ │ │ │ ├── walkthrough-hosting-a-wpf-clock-in-win32 │ │ │ │ │ ├── date-time-properties-dialog.png │ │ │ │ │ ├── final-result-date-time-properties-dialog.png │ │ │ │ │ └── recreated-date-time-properties-dialog.png │ │ │ │ ├── walkthrough-hosting-a-wpf-composite-control-in-windows-forms │ │ │ │ │ ├── windows-form-hosting-avalon-control.png │ │ │ │ │ └── windows-presentation-foundation-composite-control.png │ │ │ │ ├── wcpsdk-mmgraphics-text-cleartype-overview-01.png │ │ │ │ ├── wcpsdk-mmgraphics-text-cleartype-overview-02.png │ │ │ │ ├── wcpsdk-mmgraphics-text-cleartype-overview-03.png │ │ │ │ ├── wcpsdk-mmgraphics-text-cleartype-overview-04.png │ │ │ │ ├── wpf-architect1.PNG │ │ │ │ ├── wpf-architecture2.PNG │ │ │ │ └── wpf-globalization-and-localization-overview │ │ │ │ │ ├── arabic-home-page-sample.jpg │ │ │ │ │ ├── english-home-page-sample.jpg │ │ │ │ │ ├── gradient-flow-left-right.png │ │ │ │ │ ├── gradient-flow-right-left.png │ │ │ │ │ ├── localization-workflow.png │ │ │ │ │ ├── run-dialog-box-english.png │ │ │ │ │ ├── run-dialog-box-german.png │ │ │ │ │ └── unlocalized-workflow.png │ │ │ ├── merged-resource-dictionaries.md │ │ │ ├── migration-and-interoperability.md │ │ │ ├── object-lifetime-events.md │ │ │ ├── opentype-font-features.md │ │ │ ├── optimizing-performance-2d-graphics-and-imaging.md │ │ │ ├── optimizing-performance-application-resources.md │ │ │ ├── optimizing-performance-controls.md │ │ │ ├── optimizing-performance-data-binding.md │ │ │ ├── optimizing-performance-layout-and-design.md │ │ │ ├── optimizing-performance-object-behavior.md │ │ │ ├── optimizing-performance-other-recommendations.md │ │ │ ├── optimizing-performance-taking-advantage-of-hardware.md │ │ │ ├── optimizing-performance-text.md │ │ │ ├── optimizing-wpf-application-performance.md │ │ │ ├── packaging-fonts-with-applications.md │ │ │ ├── performance-considerations-for-direct3d9-and-wpf-interoperability.md │ │ │ ├── performance.md │ │ │ ├── planning-for-application-performance.md │ │ │ ├── presentationoptions-freeze-attribute.md │ │ │ ├── preview-events.md │ │ │ ├── printing-and-print-system-management.md │ │ │ ├── printing-how-to-topics.md │ │ │ ├── printing-overview.md │ │ │ ├── processunhandledexception-function-wpf-unmanaged-api-reference.md │ │ │ ├── properties-how-to-topics.md │ │ │ ├── properties-wpf.md │ │ │ ├── property-change-events.md │ │ │ ├── property-value-inheritance.md │ │ │ ├── propertypath-xaml-syntax.md │ │ │ ├── read-only-dependency-properties.md │ │ │ ├── relativesource-markupextension.md │ │ │ ├── resources-and-code.md │ │ │ ├── resources-how-to-topics.md │ │ │ ├── resources-wpf.md │ │ │ ├── routed-events-overview.md │ │ │ ├── safe-constructor-patterns-for-dependencyobjects.md │ │ │ ├── sample-opentype-font-pack.md │ │ │ ├── savetohistory-function-wpf-unmanaged-api-reference.md │ │ │ ├── serialization-limitations-of-xamlwriter-save.md │ │ │ ├── setfakeactivewindow-function-wpf-unmanaged-api-reference.md │ │ │ ├── sharing-message-loops-between-win32-and-wpf.md │ │ │ ├── staticresource-markup-extension.md │ │ │ ├── storing-ink.md │ │ │ ├── styling-for-focus-in-controls-and-focusvisualstyle.md │ │ │ ├── table-overview.md │ │ │ ├── technology-regions-overview.md │ │ │ ├── templatebinding-markup-extension.md │ │ │ ├── textelement-content-model-overview.md │ │ │ ├── the-ink-object-model-windows-forms-and-com-versus-wpf.md │ │ │ ├── the-ink-threading-model.md │ │ │ ├── themedictionary-markup-extension.md │ │ │ ├── threading-model.md │ │ │ ├── toc.yml │ │ │ ├── trees-in-wpf.md │ │ │ ├── troubleshooting-hybrid-applications.md │ │ │ ├── typeconverters-and-xaml.md │ │ │ ├── typography-how-to-topics.md │ │ │ ├── typography-in-wpf.md │ │ │ ├── typography.md │ │ │ ├── use-automatic-layout-overview.md │ │ │ ├── visual-basic-and-wpf-event-handling.md │ │ │ ├── walkthrough-arranging-windows-forms-controls-in-wpf.md │ │ │ ├── walkthrough-binding-to-data-in-hybrid-applications.md │ │ │ ├── walkthrough-caching-application-data-in-a-wpf-application.md │ │ │ ├── walkthrough-creating-direct3d9-content-for-hosting-in-wpf.md │ │ │ ├── walkthrough-creating-your-first-touch-application.md │ │ │ ├── walkthrough-enabling-drag-and-drop-on-a-user-control.md │ │ │ ├── walkthrough-hosting-a-3-d-wpf-composite-control-in-windows-forms.md │ │ │ ├── walkthrough-hosting-a-win32-control-in-wpf.md │ │ │ ├── walkthrough-hosting-a-windows-forms-composite-control-in-wpf.md │ │ │ ├── walkthrough-hosting-a-windows-forms-control-in-wpf-by-using-xaml.md │ │ │ ├── walkthrough-hosting-a-windows-forms-control-in-wpf.md │ │ │ ├── walkthrough-hosting-a-wpf-clock-in-win32.md │ │ │ ├── walkthrough-hosting-a-wpf-composite-control-in-windows-forms.md │ │ │ ├── walkthrough-hosting-an-activex-control-in-wpf.md │ │ │ ├── walkthrough-hosting-direct3d9-content-in-wpf.md │ │ │ ├── walkthrough-hosting-wpf-content-in-win32.md │ │ │ ├── walkthrough-localizing-a-hybrid-application.md │ │ │ ├── walkthrough-mapping-properties-using-the-elementhost-control.md │ │ │ ├── walkthrough-mapping-properties-using-the-windowsformshost-element.md │ │ │ ├── weak-event-patterns.md │ │ │ ├── windows-forms-and-wpf-interoperability-input-architecture.md │ │ │ ├── windows-forms-and-wpf-property-mapping.md │ │ │ ├── windows-forms-controls-and-equivalent-wpf-controls.md │ │ │ ├── wpf-and-direct3d9-interoperation.md │ │ │ ├── wpf-and-win32-interoperation.md │ │ │ ├── wpf-and-windows-forms-interoperation.md │ │ │ ├── wpf-architecture.md │ │ │ ├── wpf-globalization-and-localization-overview.md │ │ │ ├── wpf-unmanaged-api-reference.md │ │ │ ├── wpf-xaml-extensions.md │ │ │ ├── wpf-xaml-namescopes.md │ │ │ ├── xaml-and-custom-classes-for-wpf.md │ │ │ ├── xaml-in-wpf.md │ │ │ ├── xaml-loading-and-dependency-properties.md │ │ │ ├── xaml-namespaces-and-namespace-mapping-for-wpf-xaml.md │ │ │ └── xaml-syntax-in-detail.md │ │ ├── app-development │ │ │ ├── application-management-overview.md │ │ │ ├── build-and-deploy-how-to-topics.md │ │ │ ├── building-a-wpf-application-wpf.md │ │ │ ├── building-and-deploying-wpf-applications.md │ │ │ ├── configure-vs-to-debug-a-xaml-browser-to-call-a-web-service.md │ │ │ ├── deploying-a-wpf-application-wpf.md │ │ │ ├── dialog-boxes-overview.md │ │ │ ├── filterinputmessage.md │ │ │ ├── firefox-add-ons-to-support-net-application-deployment.md │ │ │ ├── getcustomui.md │ │ │ ├── getrawinputdevices.md │ │ │ ├── hosting-wpf-applications.md │ │ │ ├── how-to-add-a-splash-screen-to-a-wpf-application.md │ │ │ ├── how-to-automatically-size-a-window-to-fit-its-content.md │ │ │ ├── how-to-call-a-page-function.md │ │ │ ├── how-to-configure-iis-5-0-and-iis-6-0-to-deploy-wpf-applications.md │ │ │ ├── how-to-create-an-add-in-that-is-a-ui.md │ │ │ ├── how-to-create-an-add-in-that-returns-a-ui.md │ │ │ ├── how-to-detect-whether-the-net-framework-3-0-is-installed.md │ │ │ ├── how-to-detect-whether-the-net-framework-3-5-is-installed.md │ │ │ ├── how-to-detect-whether-the-wpf-plug-in-for-firefox-is-installed.md │ │ │ ├── how-to-determine-if-a-page-is-browser-hosted.md │ │ │ ├── how-to-determine-the-installed-version-of-wpf.md │ │ │ ├── how-to-get-all-windows-in-an-application.md │ │ │ ├── how-to-get-and-set-the-main-application-window.md │ │ │ ├── how-to-get-the-return-value-of-a-page-function.md │ │ │ ├── how-to-navigate-back-through-navigation-history.md │ │ │ ├── how-to-navigate-forward-or-back-through-navigation-history.md │ │ │ ├── how-to-navigate-to-a-page.md │ │ │ ├── how-to-open-a-dialog-box.md │ │ │ ├── how-to-open-a-message-box.md │ │ │ ├── how-to-open-a-window.md │ │ │ ├── how-to-refresh-a-page.md │ │ │ ├── how-to-return-a-dialog-box-result.md │ │ │ ├── how-to-return-from-a-page-function.md │ │ │ ├── how-to-set-the-height-of-a-window-from-a-page.md │ │ │ ├── how-to-set-the-title-of-a-window-from-a-page.md │ │ │ ├── how-to-set-the-width-of-a-window-from-a-page.md │ │ │ ├── how-to-stop-a-page-from-loading.md │ │ │ ├── how-to-topics.md │ │ │ ├── how-to-use-an-application-scope-resource-dictionary.md │ │ │ ├── how-to-use-mailto-to-send-mail-from-a-page.md │ │ │ ├── ienumrawinputdevic-clone.md │ │ │ ├── ienumrawinputdevic-next.md │ │ │ ├── ienumrawinputdevic-reset.md │ │ │ ├── ienumrawinputdevic-skip.md │ │ │ ├── ienumrawinputdevice.md │ │ │ ├── index.md │ │ │ ├── iwpfhostsupport.md │ │ │ ├── media │ │ │ │ ├── application-management-overview │ │ │ │ │ └── unhandled-exception-notification.png │ │ │ │ ├── applicationmodeloverview-applicationobjectevents-xbap.png │ │ │ │ ├── applicationmodeloverview-applicationobjectevents.png │ │ │ │ ├── dialog-boxes-overview │ │ │ │ │ ├── find-modeless-dialog-box.png │ │ │ │ │ ├── invalid-left-margin-dialog.png │ │ │ │ │ ├── margin-size-dialog-box.png │ │ │ │ │ ├── open-file-dialog-box.png │ │ │ │ │ ├── print-data-dialog-box.png │ │ │ │ │ ├── save-file-dialog-box.png │ │ │ │ │ └── word-processor-dialog.png │ │ │ │ ├── navigation-overview │ │ │ │ │ ├── back-and-forward-buttons-in-navigation-window.png │ │ │ │ │ ├── back-and-forward-navigation.png │ │ │ │ │ ├── contents-of-person-xaml-file.png │ │ │ │ │ ├── data-remembered-across-page-navigations.png │ │ │ │ │ ├── frame-navigation-between-multiple-pages.png │ │ │ │ │ ├── frame-uses-its-own-journal.png │ │ │ │ │ ├── journal-navigation-within-pages-hosted-by-a-frame.png │ │ │ │ │ ├── loaded-and-unloaded-events.png │ │ │ │ │ ├── multiple-journals-in-one-application.png │ │ │ │ │ ├── navigated-page-lifetime.png │ │ │ │ │ ├── navigating-to-a-class.png │ │ │ │ │ ├── navigation-host-construction.png │ │ │ │ │ ├── navigation-window-and-frame.png │ │ │ │ │ ├── navigation-window-as-dialog-box.png │ │ │ │ │ ├── navigation-window-as-main-window.png │ │ │ │ │ ├── order-of-navigation-events.png │ │ │ │ │ ├── page-navigates-to-an-object.png │ │ │ │ │ ├── window-title-width-height.png │ │ │ │ │ ├── xbap-launched-from-a-web-server.png │ │ │ │ │ └── xbap-with-a-page-with-a-hyperlink.png │ │ │ │ ├── navigation-topologies-overview │ │ │ │ │ ├── navigation-topology-data-items.png │ │ │ │ │ ├── navigation-topology-dynamically-generated.png │ │ │ │ │ ├── navigation-topology-fixed-hierarchical.png │ │ │ │ │ ├── navigation-topology-fixed-linear.png │ │ │ │ │ ├── navigation-topology-multiple-pages.png │ │ │ │ │ └── navigation-topology-sequence-chosen-run-time.png │ │ │ │ ├── pack-uris-in-wpf │ │ │ │ │ ├── wpf-pack-uri-scheme.png │ │ │ │ │ ├── wpf-package-parts-diagram.png │ │ │ │ │ └── wpf-relationship-diagram.png │ │ │ │ ├── structured-navigation-overview │ │ │ │ │ └── flow-between-calling-page-called-page.png │ │ │ │ ├── wpf-windows-overview │ │ │ │ │ ├── non-rectangular-window-figure.png │ │ │ │ │ ├── window-border-styles.png │ │ │ │ │ ├── window-constituent-elements.png │ │ │ │ │ ├── window-lifetime-events.png │ │ │ │ │ ├── window-lifetime-no-activation.png │ │ │ │ │ ├── window-opened-show-method.png │ │ │ │ │ └── window-taskbar-button.png │ │ │ │ └── wpfbuildsystem-figure1.png │ │ │ ├── native-wpf-browser-hosting-support-apis.md │ │ │ ├── navigation-how-to-topics.md │ │ │ ├── navigation-overview.md │ │ │ ├── navigation-topologies-overview.md │ │ │ ├── pack-uris-in-wpf.md │ │ │ ├── persist-and-restore-application-scope-properties.md │ │ │ ├── structured-navigation-overview.md │ │ │ ├── toc.yml │ │ │ ├── window-management-how-to-topics.md │ │ │ ├── windows-in-wpf-applications.md │ │ │ ├── wpf-add-ins-overview.md │ │ │ ├── wpf-application-resource-content-and-data-files.md │ │ │ ├── wpf-host-presentationhost-exe.md │ │ │ ├── wpf-windows-overview.md │ │ │ └── wpf-xaml-browser-applications-overview.md │ │ ├── class-library-wpf.md │ │ ├── controls │ │ │ ├── adorners-how-to-topics.md │ │ │ ├── adorners-overview.md │ │ │ ├── adorners.md │ │ │ ├── border.md │ │ │ ├── bulletdecorator.md │ │ │ ├── button-styles-and-templates.md │ │ │ ├── button.md │ │ │ ├── calendar-styles-and-templates.md │ │ │ ├── calendar.md │ │ │ ├── canvas-how-to-topics.md │ │ │ ├── canvas.md │ │ │ ├── change-selection-in-a-richtextbox-programmatically.md │ │ │ ├── checkbox-styles-and-templates.md │ │ │ ├── checkbox.md │ │ │ ├── combobox-styles-and-templates.md │ │ │ ├── combobox.md │ │ │ ├── contextmenu-overview.md │ │ │ ├── contextmenu-styles-and-templates.md │ │ │ ├── contextmenu.md │ │ │ ├── control-authoring-overview.md │ │ │ ├── control-customization.md │ │ │ ├── control-library.md │ │ │ ├── control-styles-and-templates.md │ │ │ ├── controls-by-category.md │ │ │ ├── creating-a-control-that-has-a-customizable-appearance.md │ │ │ ├── customizing-the-appearance-of-an-existing-control.md │ │ │ ├── datagrid-styles-and-templates.md │ │ │ ├── datagrid.md │ │ │ ├── datepicker-styles-and-templates.md │ │ │ ├── datepicker.md │ │ │ ├── default-keyboard-and-mouse-behavior-in-the-datagrid-control.md │ │ │ ├── dockpanel-how-to-topics.md │ │ │ ├── dockpanel.md │ │ │ ├── documentviewer-styles-and-templates.md │ │ │ ├── documentviewer.md │ │ │ ├── expander-how-to-topics.md │ │ │ ├── expander-overview.md │ │ │ ├── expander-styles-and-templates.md │ │ │ ├── expander.md │ │ │ ├── flowdocumentpageviewer.md │ │ │ ├── flowdocumentreader.md │ │ │ ├── flowdocumentscrollviewer.md │ │ │ ├── frame-styles-and-templates.md │ │ │ ├── frame.md │ │ │ ├── grid-how-to-topics.md │ │ │ ├── grid.md │ │ │ ├── gridsplitter-how-to-topics.md │ │ │ ├── gridsplitter.md │ │ │ ├── gridview-column-header-styles-and-templates-overview.md │ │ │ ├── gridview-overview.md │ │ │ ├── groupbox-styles-and-templates.md │ │ │ ├── groupbox.md │ │ │ ├── guidelines-for-designing-stylable-controls.md │ │ │ ├── how-to-add-a-watermark-to-a-textbox.md │ │ │ ├── how-to-add-row-details-to-a-datagrid-control.md │ │ │ ├── how-to-adorn-the-children-of-a-panel.md │ │ │ ├── how-to-animate-a-borderthickness-value.md │ │ │ ├── how-to-animate-a-popup.md │ │ │ ├── how-to-apply-stretch-properties-to-the-contents-of-a-viewbox.md │ │ │ ├── how-to-bind-a-listbox-to-data.md │ │ │ ├── how-to-bind-a-treeview-to-data-that-has-an-indeterminable-depth.md │ │ │ ├── how-to-bind-an-adorner-to-an-element.md │ │ │ ├── how-to-build-a-standard-ui-dialog-box-by-using-grid.md │ │ │ ├── how-to-change-the-horizontal-alignment-of-a-column-in-a-listview.md │ │ │ ├── how-to-choose-between-stackpanel-and-dockpanel.md │ │ │ ├── how-to-convert-an-image-to-greyscale.md │ │ │ ├── how-to-create-a-button-that-has-an-image.md │ │ │ ├── how-to-create-a-complex-grid.md │ │ │ ├── how-to-create-a-control-that-has-an-access-key-and-text-wrapping.md │ │ │ ├── how-to-create-a-custom-panel-element.md │ │ │ ├── how-to-create-a-custom-view-mode-for-a-listview.md │ │ │ ├── how-to-create-a-dockpanel.md │ │ │ ├── how-to-create-a-grid-element.md │ │ │ ├── how-to-create-a-multiline-textbox-control.md │ │ │ ├── how-to-create-a-stackpanel.md │ │ │ ├── how-to-create-a-style-for-a-dragged-gridview-column-header.md │ │ │ ├── how-to-create-an-expander-with-a-scrollviewer.md │ │ │ ├── how-to-create-and-use-a-canvas.md │ │ │ ├── how-to-create-and-use-a-gridlengthconverter-object.md │ │ │ ├── how-to-create-listviewitems-with-a-checkbox.md │ │ │ ├── how-to-create-simple-or-complex-treeviews.md │ │ │ ├── how-to-crop-an-image.md │ │ │ ├── how-to-customize-the-thumb-size-on-a-scrollbar.md │ │ │ ├── how-to-customize-the-ticks-on-a-slider.md │ │ │ ├── how-to-define-a-groupbox-template.md │ │ │ ├── how-to-detect-when-text-in-a-textbox-has-changed.md │ │ │ ├── how-to-display-data-by-using-gridviewrowpresenter.md │ │ │ ├── how-to-display-listview-contents-by-using-a-gridview.md │ │ │ ├── how-to-enable-spell-checking-in-a-text-editing-control.md │ │ │ ├── how-to-enable-tab-characters-in-a-textbox-control.md │ │ │ ├── how-to-extract-the-text-content-from-a-richtextbox.md │ │ │ ├── how-to-find-a-treeviewitem-in-a-treeview.md │ │ │ ├── how-to-find-controltemplate-generated-elements.md │ │ │ ├── how-to-get-a-collection-of-lines-from-a-textbox.md │ │ │ ├── how-to-get-a-listboxitem.md │ │ │ ├── how-to-get-or-set-a-dock-value.md │ │ │ ├── how-to-get-or-set-canvas-positioning-properties.md │ │ │ ├── how-to-group-items-in-a-listview-that-implements-a-gridview.md │ │ │ ├── how-to-group-sort-and-filter-data-in-the-datagrid-control.md │ │ │ ├── how-to-handle-the-mousedoubleclick-event-for-each-item-in-a-listview.md │ │ │ ├── how-to-handle-the-scrollchanged-event.md │ │ │ ├── how-to-horizontally-or-vertically-align-content-in-a-stackpanel.md │ │ │ ├── how-to-implement-an-adorner.md │ │ │ ├── how-to-implement-validation-with-the-datagrid-control.md │ │ │ ├── how-to-improve-the-performance-of-a-treeview.md │ │ │ ├── how-to-improve-the-scrolling-performance-of-a-listbox.md │ │ │ ├── how-to-make-a-textbox-control-read-only.md │ │ │ ├── how-to-make-sure-that-a-gridsplitter-is-visible.md │ │ │ ├── how-to-override-the-panel-onrender-method.md │ │ │ ├── how-to-partition-space-by-using-the-dockpanel-element.md │ │ │ ├── how-to-position-a-custom-context-menu-in-a-richtextbox.md │ │ │ ├── how-to-position-a-tooltip.md │ │ │ ├── how-to-position-the-child-elements-of-a-grid.md │ │ │ ├── how-to-remove-all-adorners-from-an-element.md │ │ │ ├── how-to-remove-an-adorner-from-an-element.md │ │ │ ├── how-to-resize-a-canvas-by-using-a-thumb.md │ │ │ ├── how-to-resize-columns-with-a-gridsplitter.md │ │ │ ├── how-to-resize-rows-with-a-gridsplitter.md │ │ │ ├── how-to-retrieve-a-text-selection.md │ │ │ ├── how-to-rotate-an-image.md │ │ │ ├── how-to-save-load-and-print-richtextbox-content.md │ │ │ ├── how-to-scroll-content-by-using-the-iscrollinfo-interface.md │ │ │ ├── how-to-set-focus-in-a-textbox-control.md │ │ │ ├── how-to-set-the-height-properties-of-an-element.md │ │ │ ├── how-to-set-the-text-content-of-a-textbox-control.md │ │ │ ├── how-to-set-the-width-properties-of-an-element.md │ │ │ ├── how-to-share-sizing-properties-between-grids.md │ │ │ ├── how-to-sort-a-gridview-column-when-a-header-is-clicked.md │ │ │ ├── how-to-specify-a-custom-popup-position.md │ │ │ ├── how-to-style-a-row-in-a-listview-that-implements-a-gridview.md │ │ │ ├── how-to-style-controls-on-a-toolbar.md │ │ │ ├── how-to-use-a-custom-context-menu-with-a-textbox.md │ │ │ ├── how-to-use-selectedvalue-selectedvaluepath-and-selecteditem.md │ │ │ ├── how-to-use-spell-checking-with-a-context-menu.md │ │ │ ├── how-to-use-templates-to-style-a-listview-that-uses-gridview.md │ │ │ ├── how-to-use-the-attached-properties-of-canvas-to-position-child-elements.md │ │ │ ├── how-to-use-the-betweenshowdelay-property.md │ │ │ ├── how-to-use-the-content-scrolling-methods-of-scrollviewer.md │ │ │ ├── how-to-use-the-image-element.md │ │ │ ├── how-to-use-triggers-to-style-selected-items-in-a-listview.md │ │ │ ├── how-to-wrap-a-border-around-the-content-of-a-canvas.md │ │ │ ├── image-how-to-topics.md │ │ │ ├── image.md │ │ │ ├── index.md │ │ │ ├── label-styles-and-templates.md │ │ │ ├── label.md │ │ │ ├── listbox-how-to-topics.md │ │ │ ├── listbox-styles-and-templates.md │ │ │ ├── listbox.md │ │ │ ├── listview-how-to-topics.md │ │ │ ├── listview-overview.md │ │ │ ├── listview-overviews.md │ │ │ ├── listview-styles-and-templates.md │ │ │ ├── listview.md │ │ │ ├── manipulate-columns-and-rows-by-using-columndefinitionscollections.md │ │ │ ├── media │ │ │ │ ├── adorners-overview │ │ │ │ │ └── simplecircleadorner-textbox.png │ │ │ │ ├── avalon-run-dialog.PNG │ │ │ │ ├── bulletdecorator │ │ │ │ │ └── three-bullet-decorators.png │ │ │ │ ├── custom-button-animatedbutton-1.gif │ │ │ │ ├── custom-button-animatedbutton-2.gif │ │ │ │ ├── custom-button-animatedbutton-3.gif │ │ │ │ ├── custom-button-animatedbutton-4.gif │ │ │ │ ├── custom-button-animatedbutton-5.gif │ │ │ │ ├── custom-button-blend-blendconclusion.jpg │ │ │ │ ├── custom-button-blend-changebackground.png │ │ │ │ ├── custom-button-blend-changerectproperties.png │ │ │ │ ├── custom-button-blend-clickeventtrigger1.png │ │ │ │ ├── custom-button-blend-createmultiplebuttons.png │ │ │ │ ├── custom-button-blend-drawrect.png │ │ │ │ ├── custom-button-blend-edittemplate.jpg │ │ │ │ ├── custom-button-blend-glasscubeappearance.gif │ │ │ │ ├── custom-button-blend-glassrectangleproperties1.png │ │ │ │ ├── custom-button-blend-glassrectangleproperties2.png │ │ │ │ ├── custom-button-blend-innerrectangle2.png │ │ │ │ ├── custom-button-blend-innerrectangleproperties.png │ │ │ │ ├── custom-button-blend-intro.jpg │ │ │ │ ├── custom-button-blend-ismousedoverpropertytrigger.png │ │ │ │ ├── custom-button-blend-ismousedoverpropertytrigger2.gif │ │ │ │ ├── custom-button-blend-ismousedoverpropertytrigger3.png │ │ │ │ ├── custom-button-blend-makebutton.png │ │ │ │ ├── custom-button-blend-makebutton2.gif │ │ │ │ ├── custom-button-blend-mouseovereventtrigger.png │ │ │ │ ├── custom-button-blend-mouseovereventtrigger2.png │ │ │ │ ├── custom-button-blend-mouseovereventtrigger3.png │ │ │ │ ├── custom-button-blend-mouseovereventtrigger4.png │ │ │ │ ├── custom-button-blend-propertytriggerinfo.png │ │ │ │ ├── custom-button-blend-propertytriggerwithbitmapeffect.png │ │ │ │ ├── custom-button-blend-renamecomponents.png │ │ │ │ ├── custom-button-blend-rotatetransform.gif │ │ │ │ ├── custom-button-blend-roundcorners.png │ │ │ │ ├── custom-button-blend-scopeup.gif │ │ │ │ ├── custom-button-blend-sizetransform.png │ │ │ │ ├── custom-button-blend-templatepanel.png │ │ │ │ ├── custom-button-blend-templatestroke.png │ │ │ │ ├── custom-button-glassrectangleproperties3.gif │ │ │ │ ├── datagrid-sql-ef-step4.png │ │ │ │ ├── datagrid-sql-ef-step5.png │ │ │ │ ├── datagrid-sql-ef-step6.png │ │ │ │ ├── datagrid-sql-ef-step7.png │ │ │ │ ├── editing-richtextbox-with-content.png │ │ │ │ ├── editing-richtextbox-with-toobar.gif │ │ │ │ ├── editing-textbox-using-background-image.png │ │ │ │ ├── editing-textbox-with-context-menu.png │ │ │ │ ├── editing-textbox-with-spellchecking.png │ │ │ │ ├── expander-overview │ │ │ │ │ └── expander-scrollbar-control.jpg │ │ │ │ ├── expander │ │ │ │ │ └── expander-control-example.jpg │ │ │ │ ├── grid-methods-sample.png │ │ │ │ ├── gridview-overview │ │ │ │ │ ├── listview-gridview-output.jpg │ │ │ │ │ └── styled-listview-content.png │ │ │ │ ├── groupbox │ │ │ │ │ └── groupbox-tab-button-stackpanel.jpg │ │ │ │ ├── how-to-create-a-complex-grid │ │ │ │ │ └── wpf-manual-calendar.png │ │ │ │ ├── how-to-create-a-grid-element │ │ │ │ │ └── how-to-create-a-grid-element.png │ │ │ │ ├── how-to-position-a-tooltip │ │ │ │ │ ├── tooltip-placement-offset-property.png │ │ │ │ │ ├── tooltip-placement-property.png │ │ │ │ │ └── tooltip-placement-rectangle-property.png │ │ │ │ ├── label │ │ │ │ │ └── display-properties-labeled-by.png │ │ │ │ ├── layout-border-around-textbox.png │ │ │ │ ├── layout-smiley-stackpanel.PNG │ │ │ │ ├── ndp-buttonmouseover.png │ │ │ │ ├── ndp-buttonnormal.png │ │ │ │ ├── ndp-buttonpressed.png │ │ │ │ ├── ndp-buttontwo.png │ │ │ │ ├── ndp-calendarcontrols.png │ │ │ │ ├── ndp-checkboxcustom.png │ │ │ │ ├── ndp-checkboxdefault.png │ │ │ │ ├── ndp-datepicker.png │ │ │ │ ├── ndp-numericupdown.png │ │ │ │ ├── ndp-rowdetails.png │ │ │ │ ├── nested-panels.PNG │ │ │ │ ├── panel-intro-canvas.PNG │ │ │ │ ├── panel-intro-dockpanel.PNG │ │ │ │ ├── panel-intro-stackpanel.PNG │ │ │ │ ├── popup-placement-behavior │ │ │ │ │ ├── popup-placement-absolute.png │ │ │ │ │ ├── popup-placement-bottom-screen-edge.png │ │ │ │ │ ├── popup-placement-bottom.png │ │ │ │ │ ├── popup-placement-center.png │ │ │ │ │ ├── popup-placement-intro.png │ │ │ │ │ ├── popup-placement-left-screen-edge.png │ │ │ │ │ ├── popup-placement-left.png │ │ │ │ │ ├── popup-placement-mouse-screen-edge.png │ │ │ │ │ ├── popup-placement-mouse.png │ │ │ │ │ ├── popup-placement-mousepoint.png │ │ │ │ │ ├── popup-placement-no-placement-target.png │ │ │ │ │ ├── popup-placement-placement-rectangle.png │ │ │ │ │ ├── popup-placement-relative-point-right-screen-edge.png │ │ │ │ │ ├── popup-placement-relative-point-screen-edge.png │ │ │ │ │ ├── popup-placement-relative-screen-edge.png │ │ │ │ │ ├── popup-placement-relative.png │ │ │ │ │ ├── popup-placement-right-screen-edge.png │ │ │ │ │ ├── popup-placement-right.png │ │ │ │ │ ├── popup-placement-target-origin-alignment-point.png │ │ │ │ │ ├── popup-placement-top-screen-edge.png │ │ │ │ │ ├── popup-placement-top.png │ │ │ │ │ └── popup-placement-with-placement-target.png │ │ │ │ ├── popup │ │ │ │ │ └── popup-picture-button.jpg │ │ │ │ ├── ss-ctl-buttons.bmp │ │ │ │ ├── ss-ctl-checkbox.png │ │ │ │ ├── ss-ctl-combobox.gif │ │ │ │ ├── ss-ctl-contextmenu.png │ │ │ │ ├── ss-ctl-horztoolbar.GIF │ │ │ │ ├── ss-ctl-hslider-ticks.png │ │ │ │ ├── ss-ctl-listbox.gif │ │ │ │ ├── ss-ctl-menu.gif │ │ │ │ ├── ss-ctl-progressbar.GIF │ │ │ │ ├── ss-ctl-radiobuttons.gif │ │ │ │ ├── ss-ctl-repeatbutton.png │ │ │ │ ├── ss-ctl-statusbar.GIF │ │ │ │ ├── ss-ctl-tabcontrol.gif │ │ │ │ ├── ss-ctl-tooltip.png │ │ │ │ ├── ss-ctl-verttoolbar.GIF │ │ │ │ ├── stylingintro-eventtriggers.png │ │ │ │ ├── toolbar-overview │ │ │ │ │ └── toolbar-overflow-items.png │ │ │ │ ├── treeview │ │ │ │ │ └── nested-treeviewitem-controls.jpg │ │ │ │ ├── wpf-content-model │ │ │ │ │ ├── control-content-model-buttons.png │ │ │ │ │ ├── control-content-model-image-text.png │ │ │ │ │ ├── control-content-model-listbox.png │ │ │ │ │ └── control-content-model-tab.png │ │ │ │ ├── wpf-datagridgroups.png │ │ │ │ └── wrappanel-element.PNG │ │ │ ├── menu-overview.md │ │ │ ├── menu-styles-and-templates.md │ │ │ ├── menu.md │ │ │ ├── navigationwindow-styles-and-templates.md │ │ │ ├── panel-how-to-topics.md │ │ │ ├── panel.md │ │ │ ├── panels-overview.md │ │ │ ├── passwordbox-styles-and-templates.md │ │ │ ├── passwordbox.md │ │ │ ├── popup-how-to-topics.md │ │ │ ├── popup-overview.md │ │ │ ├── popup-placement-behavior.md │ │ │ ├── popup.md │ │ │ ├── position-the-cursor-at-the-beginning-or-end-of-text.md │ │ │ ├── printdialog.md │ │ │ ├── progressbar-styles-and-templates.md │ │ │ ├── progressbar.md │ │ │ ├── radiobutton-styles-and-templates.md │ │ │ ├── radiobutton.md │ │ │ ├── repeatbutton-styles-and-templates.md │ │ │ ├── repeatbutton.md │ │ │ ├── richtextbox-how-to-topics.md │ │ │ ├── richtextbox-overview.md │ │ │ ├── richtextbox.md │ │ │ ├── scrollbar-styles-and-templates.md │ │ │ ├── scrollbar.md │ │ │ ├── scrollviewer-how-to-topics.md │ │ │ ├── scrollviewer-overview.md │ │ │ ├── scrollviewer-styles-and-templates.md │ │ │ ├── scrollviewer.md │ │ │ ├── separator.md │ │ │ ├── sizing-options-in-the-datagrid-control.md │ │ │ ├── slider-styles-and-templates.md │ │ │ ├── slider.md │ │ │ ├── stackpanel-how-to-topics.md │ │ │ ├── stackpanel.md │ │ │ ├── statusbar-styles-and-templates.md │ │ │ ├── statusbar.md │ │ │ ├── styles-and-templates.md │ │ │ ├── tabcontrol-styles-and-templates.md │ │ │ ├── tabcontrol.md │ │ │ ├── textblock-overview.md │ │ │ ├── textblock.md │ │ │ ├── textbox-how-to-topics.md │ │ │ ├── textbox-overview.md │ │ │ ├── textbox-styles-and-templates.md │ │ │ ├── textbox.md │ │ │ ├── thumb-styles-and-templates.md │ │ │ ├── toc.yml │ │ │ ├── togglebutton-styles-and-templates.md │ │ │ ├── toolbar-overview.md │ │ │ ├── toolbar-styles-and-templates.md │ │ │ ├── toolbar.md │ │ │ ├── tooltip-how-to-topics.md │ │ │ ├── tooltip-overview.md │ │ │ ├── tooltip-styles-and-templates.md │ │ │ ├── tooltip.md │ │ │ ├── treeview-how-to-topics.md │ │ │ ├── treeview-overview.md │ │ │ ├── treeview-styles-and-templates.md │ │ │ ├── treeview.md │ │ │ ├── ui-automation-of-a-wpf-custom-control.md │ │ │ ├── viewbox.md │ │ │ ├── walkthrough-create-a-button-by-using-microsoft-expression-blend.md │ │ │ ├── walkthrough-create-a-button-by-using-xaml.md │ │ │ ├── walkthrough-display-data-from-a-sql-server-database-in-a-datagrid-control.md │ │ │ ├── walkthroughs-create-a-custom-animated-button.md │ │ │ ├── window-styles-and-templates.md │ │ │ ├── wpf-content-model.md │ │ │ └── wrappanel.md │ │ ├── data │ │ │ ├── attribute-xelement-dynamic-property.md │ │ │ ├── binding-declarations-overview.md │ │ │ ├── binding-sources-overview.md │ │ │ ├── breadcrumb │ │ │ │ └── toc.yml │ │ │ ├── data-binding-how-to-topics.md │ │ │ ├── data-templating-overview.md │ │ │ ├── descendants-xelement-dynamic-property.md │ │ │ ├── element-xelement-dynamic-property.md │ │ │ ├── elements-xelement-dynamic-property.md │ │ │ ├── how-to-bind-the-properties-of-two-controls.md │ │ │ ├── how-to-bind-to-a-collection-and-display-information-based-on-selection.md │ │ │ ├── how-to-bind-to-a-method.md │ │ │ ├── how-to-bind-to-a-web-service.md │ │ │ ├── how-to-bind-to-an-ado-net-data-source.md │ │ │ ├── how-to-bind-to-an-enumeration.md │ │ │ ├── how-to-bind-to-the-results-of-a-linq-query.md │ │ │ ├── how-to-bind-to-xdocument-xelement-or-linq-for-xml-query-results.md │ │ │ ├── how-to-bind-to-xml-data-using-an-xmldataprovider-and-xpath-queries.md │ │ │ ├── how-to-clear-bindings.md │ │ │ ├── how-to-control-when-the-textbox-text-updates-the-source.md │ │ │ ├── how-to-convert-bound-data.md │ │ │ ├── how-to-create-a-binding-in-code.md │ │ │ ├── how-to-create-a-simple-binding.md │ │ │ ├── how-to-create-and-bind-to-an-observablecollection.md │ │ │ ├── how-to-filter-data-in-a-view.md │ │ │ ├── how-to-find-datatemplate-generated-elements.md │ │ │ ├── how-to-get-the-binding-object-from-a-bound-target-property.md │ │ │ ├── how-to-get-the-default-view-of-a-data-collection.md │ │ │ ├── how-to-implement-a-compositecollection.md │ │ │ ├── how-to-implement-binding-validation.md │ │ │ ├── how-to-implement-prioritybinding.md │ │ │ ├── how-to-implement-property-change-notification.md │ │ │ ├── how-to-implement-validation-logic-on-custom-objects.md │ │ │ ├── how-to-make-data-available-for-binding-in-xaml.md │ │ │ ├── how-to-navigate-through-the-objects-in-a-data-collectionview.md │ │ │ ├── how-to-produce-a-value-based-on-a-list-of-bound-items.md │ │ │ ├── how-to-set-up-notification-of-binding-updates.md │ │ │ ├── how-to-sort-and-group-data-using-a-view-in-xaml.md │ │ │ ├── how-to-sort-data-in-a-view.md │ │ │ ├── how-to-specify-the-binding-source.md │ │ │ ├── how-to-specify-the-direction-of-the-binding.md │ │ │ ├── how-to-use-the-master-detail-pattern-with-hierarchical-data.md │ │ │ ├── how-to-use-the-master-detail-pattern-with-hierarchical-xml-data.md │ │ │ ├── how-to-use-xml-namespaces-in-data-binding.md │ │ │ ├── index.md │ │ │ ├── l2dbform-xaml-cs-source-code.md │ │ │ ├── l2dbform-xaml-source-code.md │ │ │ ├── linq-to-xml-data-binding-sample.md │ │ │ ├── linq-to-xml-dynamic-properties.md │ │ │ ├── media │ │ │ │ ├── databinding-collectionbindingsample.png │ │ │ │ ├── databinding-hierarchicaldatatemplate.png │ │ │ │ ├── databinding-itemscontrolproperties.png │ │ │ │ ├── datatemplatingintro-fig1.png │ │ │ │ ├── datatemplatingintro-fig2.png │ │ │ │ ├── datatemplatingintro-fig3.png │ │ │ │ ├── datatemplatingintro-fig4.png │ │ │ │ ├── datatemplatingintro-fig5.png │ │ │ │ ├── datatemplatingintro-fig6.png │ │ │ │ ├── datatemplatingintro-fig7.png │ │ │ │ ├── how-to-bind-the-properties-of-two-controls │ │ │ │ │ └── data-binding-bind-background-canvas.png │ │ │ │ ├── how-to-bind-to-xml-data-using-an-xmldataprovider-and-xpath-queries │ │ │ │ │ └── xpath-example-listbox-details.png │ │ │ │ ├── how-to-control-when-the-textbox-text-updates-the-source │ │ │ │ │ └── data-binding-simple-binding-sample.png │ │ │ │ └── how-to-use-the-master-detail-pattern-with-hierarchical-data │ │ │ │ │ └── databinding-master-detail-scenario.png │ │ │ ├── toc.yml │ │ │ ├── value-xattribute-dynamic-property.md │ │ │ ├── value-xelement-dynamic-property.md │ │ │ ├── wpf-data-binding-with-linq-to-xml-overview.md │ │ │ └── xml-xelement-dynamic-property.md │ │ ├── getting-started │ │ │ ├── community-feedback.md │ │ │ ├── index.md │ │ │ ├── introduction-to-wpf-in-vs.md │ │ │ ├── media │ │ │ │ ├── properties-margin.png │ │ │ │ ├── properties-source.png │ │ │ │ └── walkthrough-my-first-wpf-desktop-application │ │ │ │ │ ├── add-application-controls.png │ │ │ │ │ ├── add-application-image-title.png │ │ │ │ │ ├── application-data-templates.png │ │ │ │ │ ├── build-run-application.png │ │ │ │ │ ├── configure-new-project-dialog.png │ │ │ │ │ ├── create-application-ui.png │ │ │ │ │ └── create-new-project-dialog.png │ │ │ ├── toc.yml │ │ │ ├── walkthrough-my-first-wpf-desktop-application.md │ │ │ ├── whats-new.md │ │ │ └── wpf-walkthroughs.md │ │ ├── graphics-multimedia │ │ │ ├── 3-d-graphics-how-to-topics.md │ │ │ ├── 3-d-graphics-overview.md │ │ │ ├── 3-d-transformations-overview.md │ │ │ ├── animate-a-3-d-rotation-quaternionanimationusingkeyframes.md │ │ │ ├── animate-an-object-along-a-path-matrix-animation-with-offset.md │ │ │ ├── animation-and-timing-how-to-topics.md │ │ │ ├── animation-and-timing-system-overview.md │ │ │ ├── animation-overview.md │ │ │ ├── animation-tips-and-tricks.md │ │ │ ├── audio-and-video-how-to-topics.md │ │ │ ├── bitmap-effects-overview.md │ │ │ ├── bitmap-effects.md │ │ │ ├── brush-transformation-overview.md │ │ │ ├── brushes-how-to-topics.md │ │ │ ├── brushes.md │ │ │ ├── change-the-speed-of-a-clock.md │ │ │ ├── clocks-how-to-topics.md │ │ │ ├── custom-animations-overview.md │ │ │ ├── drawing-objects-overview.md │ │ │ ├── drawings-how-to-topics.md │ │ │ ├── drawings.md │ │ │ ├── easing-functions.md │ │ │ ├── extend-glass-frame-into-a-wpf-application.md │ │ │ ├── from-to-by-animations-overview.md │ │ │ ├── geometries-how-to-topics.md │ │ │ ├── geometries.md │ │ │ ├── geometry-overview.md │ │ │ ├── graphics-how-to-topics.md │ │ │ ├── graphics-rendering-registry-settings.md │ │ │ ├── graphics.md │ │ │ ├── hit-testing-in-the-visual-layer.md │ │ │ ├── how-to-accelerate-or-decelerate-an-animation.md │ │ │ ├── how-to-accumulate-animation-values-during-repeat-cycles.md │ │ │ ├── how-to-add-an-animation-output-value-to-an-animation-starting-value.md │ │ │ ├── how-to-animate-3-d-translations.md │ │ │ ├── how-to-animate-a-3-d-rotation-using-key-frames.md │ │ │ ├── how-to-animate-a-3-d-rotation-using-quaternions.md │ │ │ ├── how-to-animate-a-3-d-rotation-using-rotation3danimation.md │ │ │ ├── how-to-animate-a-3-d-rotation-using-storyboards.md │ │ │ ├── how-to-animate-a-boolean-by-using-key-frames.md │ │ │ ├── how-to-animate-a-double-by-using-key-frames.md │ │ │ ├── how-to-animate-a-matrix-by-using-key-frames.md │ │ │ ├── how-to-animate-a-point-by-using-key-frames.md │ │ │ ├── how-to-animate-a-property-by-using-a-storyboard.md │ │ │ ├── how-to-animate-a-property-by-using-an-animationclock.md │ │ │ ├── how-to-animate-a-property-without-using-a-storyboard.md │ │ │ ├── how-to-animate-a-rectangle-geometry-by-using-key-frames.md │ │ │ ├── how-to-animate-a-rectangle.md │ │ │ ├── how-to-animate-a-string-by-using-key-frames.md │ │ │ ├── how-to-animate-an-ellipsegeometry.md │ │ │ ├── how-to-animate-an-object-along-a-path-double-animation.md │ │ │ ├── how-to-animate-an-object-along-a-path-matrix-animation.md │ │ │ ├── how-to-animate-an-object-along-a-path-point-animation.md │ │ │ ├── how-to-animate-an-object-by-using-key-frames.md │ │ │ ├── how-to-animate-camera-position-and-direction-in-a-3d-scene.md │ │ │ ├── how-to-animate-camera-position-and-direction-using-key-frames.md │ │ │ ├── how-to-animate-color-by-using-key-frames.md │ │ │ ├── how-to-animate-in-a-controltemplate.md │ │ │ ├── how-to-animate-in-a-style.md │ │ │ ├── how-to-animate-material-properties-in-a-3-d-scene.md │ │ │ ├── how-to-animate-size-changes-by-using-key-frames.md │ │ │ ├── how-to-animate-the-color-or-opacity-of-a-solidcolorbrush.md │ │ │ ├── how-to-animate-the-opacity-of-an-element-or-brush.md │ │ │ ├── how-to-animate-the-position-of-an-object-by-using-pointanimation.md │ │ │ ├── how-to-animate-the-position-or-color-of-a-gradient-stop.md │ │ │ ├── how-to-animate-the-size-of-an-arcsegment.md │ │ │ ├── how-to-animate-the-thickness-of-a-border-by-using-key-frames.md │ │ │ ├── how-to-apply-a-drawing-to-a-3-d-model.md │ │ │ ├── how-to-apply-a-guidelineset-to-a-drawing.md │ │ │ ├── how-to-apply-a-transform-to-a-bitmapimage.md │ │ │ ├── how-to-apply-a-transform-to-an-element-when-an-event-occurs.md │ │ │ ├── how-to-apply-emissive-material-to-a-3-d-object.md │ │ │ ├── how-to-apply-material-to-the-front-and-back-of-a-3-d-object.md │ │ │ ├── how-to-apply-multiple-transformations-to-a-3-d-model.md │ │ │ ├── how-to-apply-multiple-transforms-to-an-object.md │ │ │ ├── how-to-chain-bitmapsource-objects-together.md │ │ │ ├── how-to-control-a-mediaelement-by-using-a-storyboard.md │ │ │ ├── how-to-control-a-mediaelement-play-pause-stop-volume-and-speed.md │ │ │ ├── how-to-control-a-storyboard-after-it-starts.md │ │ │ ├── how-to-control-an-animation-using-from-to-and-by.md │ │ │ ├── how-to-control-key-frame-animation-timing.md │ │ │ ├── how-to-control-the-fill-of-a-composite-shape.md │ │ │ ├── how-to-convert-a-bitmapsource-to-a-different-pixelformat.md │ │ │ ├── how-to-convert-a-bitmapsource-to-an-indexed-pixel-format.md │ │ │ ├── how-to-create-a-3-d-scene.md │ │ │ ├── how-to-create-a-bitmap-from-a-visual.md │ │ │ ├── how-to-create-a-combined-geometry.md │ │ │ ├── how-to-create-a-composite-drawing.md │ │ │ ├── how-to-create-a-composite-shape.md │ │ │ ├── how-to-create-a-cubic-bezier-curve.md │ │ │ ├── how-to-create-a-geometrydrawing.md │ │ │ ├── how-to-create-a-line-using-a-linegeometry.md │ │ │ ├── how-to-create-a-linesegment-in-a-pathgeometry.md │ │ │ ├── how-to-create-a-new-bitmapsource.md │ │ │ ├── how-to-create-a-quadratic-bezier-curve.md │ │ │ ├── how-to-create-a-reflection.md │ │ │ ├── how-to-create-a-shape-by-using-a-pathgeometry.md │ │ │ ├── how-to-create-a-shape-using-a-streamgeometry.md │ │ │ ├── how-to-create-an-elliptical-arc.md │ │ │ ├── how-to-create-different-tile-patterns-with-a-tilebrush.md │ │ │ ├── how-to-create-multiple-subpaths-within-a-pathgeometry.md │ │ │ ├── how-to-define-a-name-scope.md │ │ │ ├── how-to-define-a-pen.md │ │ │ ├── how-to-define-a-rectangle-using-a-rectanglegeometry.md │ │ │ ├── how-to-draw-a-closed-shape-by-using-the-polygon-element.md │ │ │ ├── how-to-draw-a-line.md │ │ │ ├── how-to-draw-a-polyline-by-using-the-polyline-element.md │ │ │ ├── how-to-draw-a-rectangle.md │ │ │ ├── how-to-draw-an-ellipse-or-a-circle.md │ │ │ ├── how-to-draw-an-image-using-imagedrawing.md │ │ │ ├── how-to-encode-a-visual-to-an-image-file.md │ │ │ ├── how-to-encode-and-decode-a-bmp-image.md │ │ │ ├── how-to-encode-and-decode-a-gif-image.md │ │ │ ├── how-to-encode-and-decode-a-jpeg-image.md │ │ │ ├── how-to-encode-and-decode-a-png-image.md │ │ │ ├── how-to-encode-and-decode-a-tiff-image.md │ │ │ ├── how-to-encode-and-decode-a-wdp-image.md │ │ │ ├── how-to-enumerate-drawing-content-of-a-visual.md │ │ │ ├── how-to-get-the-offset-of-a-visual.md │ │ │ ├── how-to-hit-test-geometry-in-a-visual.md │ │ │ ├── how-to-hit-test-in-a-viewport3d.md │ │ │ ├── how-to-hit-test-using-a-win32-host-container.md │ │ │ ├── how-to-hit-test-using-geometry-as-a-parameter.md │ │ │ ├── how-to-improve-rendering-performance-by-caching-an-element.md │ │ │ ├── how-to-interactively-control-a-clock.md │ │ │ ├── how-to-load-an-image-as-a-thumbnail.md │ │ │ ├── how-to-make-an-element-spin-in-place.md │ │ │ ├── how-to-modify-the-cap-at-the-end-of-a-line-or-segment.md │ │ │ ├── how-to-paint-an-area-with-a-drawing.md │ │ │ ├── how-to-paint-an-area-with-a-linear-gradient.md │ │ │ ├── how-to-paint-an-area-with-a-radial-gradient.md │ │ │ ├── how-to-paint-an-area-with-a-solid-color.md │ │ │ ├── how-to-paint-an-area-with-a-system-brush.md │ │ │ ├── how-to-paint-an-area-with-a-video.md │ │ │ ├── how-to-paint-an-area-with-a-visual.md │ │ │ ├── how-to-paint-an-area-with-an-image.md │ │ │ ├── how-to-play-media-using-a-videodrawing.md │ │ │ ├── how-to-play-media-with-animations.md │ │ │ ├── how-to-preserve-the-aspect-ratio-of-an-image-used-as-a-background.md │ │ │ ├── how-to-read-metadata-from-a-bitmap.md │ │ │ ├── how-to-receive-notification-when-clock-state-changes.md │ │ │ ├── how-to-render-on-a-per-frame-interval-using-compositiontarget.md │ │ │ ├── how-to-repeat-an-animation.md │ │ │ ├── how-to-repeat-media-playback.md │ │ │ ├── how-to-rotate-an-object-by-using-a-geometric-path-matrix-animation.md │ │ │ ├── how-to-rotate-an-object-by-using-a-geometric-path.md │ │ │ ├── how-to-rotate-an-object.md │ │ │ ├── how-to-round-the-corners-of-a-rectanglegeometry.md │ │ │ ├── how-to-scale-an-element.md │ │ │ ├── how-to-seek-a-clock-synchronously.md │ │ │ ├── how-to-seek-a-storyboard-synchronously.md │ │ │ ├── how-to-seek-a-storyboard.md │ │ │ ├── how-to-set-a-duration-for-an-animation.md │ │ │ ├── how-to-set-a-property-after-animating-it-with-a-storyboard.md │ │ │ ├── how-to-set-the-horizontal-and-vertical-alignment-of-a-tilebrush.md │ │ │ ├── how-to-set-the-tile-size-for-a-tilebrush.md │ │ │ ├── how-to-simplify-animations-by-using-child-timelines.md │ │ │ ├── how-to-skew-an-element.md │ │ │ ├── how-to-specify-handoffbehavior-between-storyboard-animations.md │ │ │ ├── how-to-specify-the-origin-of-a-transform-by-using-relative-values.md │ │ │ ├── how-to-specify-whether-a-timeline-automatically-reverses.md │ │ │ ├── how-to-test-point4d-structures-for-equality-and-inequality.md │ │ │ ├── how-to-transform-a-brush.md │ │ │ ├── how-to-transform-points-and-vectors.md │ │ │ ├── how-to-transform-the-scale-of-a-3-d-model.md │ │ │ ├── how-to-translate-an-element.md │ │ │ ├── how-to-trigger-an-animation-when-a-property-value-changes.md │ │ │ ├── how-to-trigger-media-playback-with-a-user-event.md │ │ │ ├── how-to-use-a-bitmapimage.md │ │ │ ├── how-to-use-a-cached-element-as-a-brush.md │ │ │ ├── how-to-use-a-drawing-as-an-image-source.md │ │ │ ├── how-to-use-a-matrixtransform-to-create-custom-transforms.md │ │ │ ├── how-to-use-event-triggers-to-control-a-storyboard-after-it-starts.md │ │ │ ├── how-to-use-system-colors-in-a-gradient.md │ │ │ ├── how-to-use-transforms-on-a-mediaelement.md │ │ │ ├── how-to-write-metadata-to-a-bitmap.md │ │ │ ├── images.md │ │ │ ├── imaging-how-to-topics.md │ │ │ ├── imaging-overview.md │ │ │ ├── index.md │ │ │ ├── key-frame-animation-how-to-topics.md │ │ │ ├── key-frame-animations-overview.md │ │ │ ├── maximize-wpf-3d-performance.md │ │ │ ├── media │ │ │ │ ├── absolute-and-relative-viewports.png │ │ │ │ ├── backease-graph.png │ │ │ │ ├── bounceease-graph.png │ │ │ │ ├── camera-projections4.png │ │ │ │ ├── circleease-graph.png │ │ │ │ ├── coordsystem-1.png │ │ │ │ ├── coordsystem-6.png │ │ │ │ ├── cubicease-graph.png │ │ │ │ ├── elasticease-graph.png │ │ │ │ ├── exponentialease-graph.png │ │ │ │ ├── extend-glass-frame-into-a-wpf-application │ │ │ │ │ ├── glass-frame-extended-wpf-application.png │ │ │ │ │ └── internet-explorer-glass-frame-extended-address-bar.png │ │ │ │ ├── filteredvisualtree-01.png │ │ │ │ ├── graphcismm-drawinggroup-order.png │ │ │ │ ├── graphicsmm-3timelines.png │ │ │ │ ├── graphicsmm-bitmap.png │ │ │ │ ├── graphicsmm-brush-ovw-drawingbrush.jpg │ │ │ │ ├── graphicsmm-brush-ovw-imagebrush.jpg │ │ │ │ ├── graphicsmm-brush-ovw-lineargradientbrush.jpg │ │ │ │ ├── graphicsmm-brush-ovw-radialgradientbrush.jpg │ │ │ │ ├── graphicsmm-brush-ovw-solidcolorbrush.png │ │ │ │ ├── graphicsmm-brush-ovw-visualbrush.jpg │ │ │ │ ├── graphicsmm-brushrelativetransform-transform-small.png │ │ │ │ ├── graphicsmm-brushtypes.jpg │ │ │ │ ├── graphicsmm-clipexample.png │ │ │ │ ├── graphicsmm-clipgeom.png │ │ │ │ ├── graphicsmm-clocks-1clock1prop.png │ │ │ │ ├── graphicsmm-clocks-2clock1clockgroup2prop.png │ │ │ │ ├── graphicsmm-clocks-2clock1prop.png │ │ │ │ ├── graphicsmm-diagonallgb.jpg │ │ │ │ ├── graphicsmm-dpi-setting-examples.png │ │ │ │ ├── graphicsmm-drawingbrush-geometrydrawing.png │ │ │ │ ├── graphicsmm-drawingbrush-simple.png │ │ │ │ ├── graphicsmm-drawingbrush-tiled.png │ │ │ │ ├── graphicsmm-drawingbrushtilemodeexample.png │ │ │ │ ├── graphicsmm-drawinggroup-guidelineset.png │ │ │ │ ├── graphicsmm-ellipse.gif │ │ │ │ ├── graphicsmm-fe-rotated-about-center.png │ │ │ │ ├── graphicsmm-fe-rotated-about-upperleft-corner.png │ │ │ │ ├── graphicsmm-geodraw.jpg │ │ │ │ ├── graphicsmm-horizontallgb.jpg │ │ │ │ ├── graphicsmm-imagebrushuniformstretch.jpg │ │ │ │ ├── graphicsmm-imagebrushuniformtofillstretch.jpg │ │ │ │ ├── graphicsmm-imagedrawingexample.jpg │ │ │ │ ├── graphicsmm-keyframe-keytime1-timespan.png │ │ │ │ ├── graphicsmm-keyframe-keytime2-percentage.png │ │ │ │ ├── graphicsmm-keyframe-keytime3-uniform.png │ │ │ │ ├── graphicsmm-keyframe-keytime4-paced.png │ │ │ │ ├── graphicsmm-keyspline-0-1-1-0.png │ │ │ │ ├── graphicsmm-keyspline-025-050-075-10.png │ │ │ │ ├── graphicsmm-layouttransform.png │ │ │ │ ├── graphicsmm-line.gif │ │ │ │ ├── graphicsmm-multiple.jpg │ │ │ │ ├── graphicsmm-opacity.png │ │ │ │ ├── graphicsmm-opmask.png │ │ │ │ ├── graphicsmm-path.gif │ │ │ │ ├── graphicsmm-path2.gif │ │ │ │ ├── graphicsmm-pathgeometrylinesegment.png │ │ │ │ ├── graphicsmm-rectangle.gif │ │ │ │ ├── graphicsmm-reltransform-1-original-image.jpg │ │ │ │ ├── graphicsmm-reltransform-2-viewbox-to-viewport.png │ │ │ │ ├── graphicsmm-reltransform-3-output-to-transform.png │ │ │ │ ├── graphicsmm-reltransform-4-transform-rotate.png │ │ │ │ ├── graphicsmm-reltransform-5-transform-to-output.png │ │ │ │ ├── graphicsmm-reltransform-6-output.png │ │ │ │ ├── graphicsmm-rendertransformrelativecenter.png │ │ │ │ ├── graphicsmm-rendertransformwithdefaultcenter.png │ │ │ │ ├── graphicsmm-rotate.png │ │ │ │ ├── graphicsmm-rounded.png │ │ │ │ ├── graphicsmm-simple-imagedrawing-offset.png │ │ │ │ ├── graphicsmm-simple-pen.jpg │ │ │ │ ├── graphicsmm-simple.jpg │ │ │ │ ├── graphicsmm-thumbnails-rotate.png │ │ │ │ ├── graphicsmm-thumbnails-scale.png │ │ │ │ ├── graphicsmm-thumbnails-skew.png │ │ │ │ ├── graphicsmm-thumbnails-translate.png │ │ │ │ ├── graphicsmm-tilebrushalignmentexamplebottomright.png │ │ │ │ ├── graphicsmm-tilebrushalignmentexamplebottomrighttiled.png │ │ │ │ ├── graphicsmm-tilebrushalignmentexampletopleft.png │ │ │ │ ├── graphicsmm-tilebrushalignmentexampletoplefttiled.png │ │ │ │ ├── graphicsmm-tiledprojection.png │ │ │ │ ├── graphicsmm-verticallgb.jpg │ │ │ │ ├── graphicsmm-visualbrush-reflection-small.jpg │ │ │ │ ├── how-to-control-the-fill-of-a-composite-shape │ │ │ │ │ ├── arbitrary-ray-cross-segment.png │ │ │ │ │ ├── fillrule-closed-segments.png │ │ │ │ │ ├── fillrule-evenodd-property.png │ │ │ │ │ ├── fillrule-evenodd-rays.png │ │ │ │ │ ├── fillrule-value-equal-nonzero.png │ │ │ │ │ ├── fillrule-value-nonzero.png │ │ │ │ │ └── pathgeometry-concentric-arcs.png │ │ │ │ ├── how-to-hit-test-using-geometry-as-a-parameter │ │ │ │ │ └── intersectiondetail-hit-test.png │ │ │ │ ├── how-to-set-the-tile-size-for-a-tilebrush │ │ │ │ │ ├── 25-x-25-viewport-tilebrush.png │ │ │ │ │ └── rectangle-tile-image-brush.png │ │ │ │ ├── img-mmgraphics-stretchenum.jpg │ │ │ │ ├── img-mmgraphics-tilemodes.gif │ │ │ │ ├── img-wcpsdk-graphicsmm-skewtransformexample.gif │ │ │ │ ├── index │ │ │ │ │ ├── animate-custom-objects.png │ │ │ │ │ ├── brushes-paint-elements.png │ │ │ │ │ ├── messagebox-text-output.png │ │ │ │ │ ├── two-deminsional-shapes-ellipses-rectangles.png │ │ │ │ │ ├── use-geometries-create-shapes.png │ │ │ │ │ └── visual-three-dimensional-shape.png │ │ │ │ ├── mil-task-combined-geometry-exclude.PNG │ │ │ │ ├── mil-task-combined-geometry-intersect.PNG │ │ │ │ ├── mil-task-combined-geometry-union.PNG │ │ │ │ ├── mil-task-combined-geometry-xor.PNG │ │ │ │ ├── quadraticease-graph.png │ │ │ │ ├── quarticease-graph.png │ │ │ │ ├── quinticease-graph.png │ │ │ │ ├── shape-ovw-ellipse2.png │ │ │ │ ├── shape-ovw-ellipsefill.PNG │ │ │ │ ├── shape-ovw-line2.gif │ │ │ │ ├── shape-ovw-path.PNG │ │ │ │ ├── shape-ovw-path2.gif │ │ │ │ ├── shape-ovw-solidcolorbrush.PNG │ │ │ │ ├── sineease-graph.png │ │ │ │ ├── threecubes-rotationwithcenter-1.png │ │ │ │ ├── threecubes-scaledwithcenter-1.png │ │ │ │ ├── threecubes-uniformscale-1.png │ │ │ │ ├── transforms-translate.png │ │ │ │ ├── tree1-wcp.gif │ │ │ │ ├── twocubes-rotation2axes-1.png │ │ │ │ ├── visualoffset-01.png │ │ │ │ ├── wcpsdk-drawingbrushasopacitymask-single.jpg │ │ │ │ ├── wcpsdk-drawingbrushasopacitymask.png │ │ │ │ ├── wcpsdk-graphicsmm-4gradientstops-rg.png │ │ │ │ ├── wcpsdk-graphicsmm-4gradientstops.png │ │ │ │ ├── wcpsdk-graphicsmm-brushes-imageasopacitymasksingle.jpg │ │ │ │ ├── wcpsdk-graphicsmm-brushes-lineagradientopacitymasksingle.jpg │ │ │ │ ├── wcpsdk-graphicsmm-compositegeometryexample1.jpg │ │ │ │ ├── wcpsdk-graphicsmm-diaglgradient-nolabel.jpg │ │ │ │ ├── wcpsdk-graphicsmm-diagonalgradientaxis.png │ │ │ │ ├── wcpsdk-graphicsmm-horizontalgradient.jpg │ │ │ │ ├── wcpsdk-graphicsmm-imageasopacitymask.png │ │ │ │ ├── wcpsdk-graphicsmm-opacitymask-imageexample.png │ │ │ │ ├── wcpsdk-graphicsmm-originscirclesandradii.gif │ │ │ │ ├── wcpsdk-graphicsmm-pathgeometry-triangle.gif │ │ │ │ ├── wcpsdk-graphicsmm-rotatetransform45degrees.gif │ │ │ │ ├── wcpsdk-graphicsmm-scalecenter.gif │ │ │ │ ├── wcpsdk-graphicsmm-transformandrelativetransform.png │ │ │ │ ├── wcpsdk-graphicsmm-verticalgradient.jpg │ │ │ │ ├── wcpsdk-mmgraphics-defaultcontentprojection2.png │ │ │ │ ├── wcpsdk-mmgraphics-drawingbrushexamples.png │ │ │ │ ├── wcpsdk-mmgraphics-imagebrushexamples.gif │ │ │ │ ├── wcpsdk-mmgraphics-visuals-hittest-1.png │ │ │ │ ├── wcpsdk-mmgraphics-visuals-hittest-2.png │ │ │ │ ├── wcpsdk-mmgraphics-visuals-overview-01.gif │ │ │ │ ├── wpf-graphics-rendering-overview │ │ │ │ │ ├── classes-derived-visual-object.png │ │ │ │ │ ├── raster-vector-differences.png │ │ │ │ │ ├── visual-object-diagram.gif │ │ │ │ │ ├── visual-tree-explorer.png │ │ │ │ │ ├── visual-tree-hierarchy.gif │ │ │ │ │ ├── visual-tree-rendering-data.png │ │ │ │ │ ├── visual-tree-rendering-order.gif │ │ │ │ │ ├── win32-rendering-squence.png │ │ │ │ │ └── wpf-rendering-sequence.png │ │ │ │ └── wpfperf-visualprofiler-04.png │ │ │ ├── multimedia-overview.md │ │ │ ├── opacity-masks-overview.md │ │ │ ├── painting-with-images-drawings-and-visuals.md │ │ │ ├── painting-with-solid-colors-and-gradients-overview.md │ │ │ ├── path-animation-how-to-topics.md │ │ │ ├── path-animations-overview.md │ │ │ ├── path-markup-syntax.md │ │ │ ├── property-animation-techniques-overview.md │ │ │ ├── shapes-and-basic-drawing-in-wpf-overview.md │ │ │ ├── shapes-how-to-topics.md │ │ │ ├── shapes.md │ │ │ ├── specify-the-fillbehavior-for-a-timeline.md │ │ │ ├── storyboards-overview.md │ │ │ ├── tilebrush-overview.md │ │ │ ├── timing-behaviors-overview.md │ │ │ ├── timing-events-overview.md │ │ │ ├── toc.yml │ │ │ ├── transformations-how-to-topics.md │ │ │ ├── transformations.md │ │ │ ├── transforms-overview.md │ │ │ ├── tutorial-hosting-visual-objects-in-a-win32-application.md │ │ │ ├── using-drawingvisual-objects.md │ │ │ ├── visual-layer-programming-how-to-topics.md │ │ │ ├── visual-layer-programming.md │ │ │ ├── wpf-brushes-overview.md │ │ │ └── wpf-graphics-rendering-overview.md │ │ ├── index.md │ │ ├── introduction-to-wpf.md │ │ ├── media │ │ │ ├── introduction-to-wpf │ │ │ │ ├── databindingmostbasic.png │ │ │ │ ├── wpfintrofigure1.png │ │ │ │ ├── wpfintrofigure10.png │ │ │ │ ├── wpfintrofigure11.png │ │ │ │ ├── wpfintrofigure12.png │ │ │ │ ├── wpfintrofigure13.png │ │ │ │ ├── wpfintrofigure18.png │ │ │ │ ├── wpfintrofigure19.png │ │ │ │ ├── wpfintrofigure2.png │ │ │ │ ├── wpfintrofigure20.png │ │ │ │ ├── wpfintrofigure21.png │ │ │ │ ├── wpfintrofigure22.png │ │ │ │ ├── wpfintrofigure23.png │ │ │ │ ├── wpfintrofigure24.png │ │ │ │ ├── wpfintrofigure25.png │ │ │ │ ├── wpfintrofigure3.png │ │ │ │ ├── wpfintrofigure4.PNG │ │ │ │ ├── wpfintrofigure5.PNG │ │ │ │ ├── wpfintrofigure6.PNG │ │ │ │ ├── wpfintrofigure7.png │ │ │ │ └── wpfintrofigure8.PNG │ │ │ ├── security-wpf │ │ │ │ ├── application-browser-navigation-relationship.png │ │ │ │ └── windows-presentation-foundation-security-settings.png │ │ │ └── wpf-security-strategy-platform-security │ │ │ │ ├── code-access-security-permissions-relationship.png │ │ │ │ └── windows-presentation-foundation-security.png │ │ ├── security-wpf.md │ │ ├── toc.yml │ │ ├── wpf-partial-trust-security.md │ │ ├── wpf-samples.md │ │ ├── wpf-security-strategy-platform-security.md │ │ └── wpf-security-strategy-security-engineering.md │ └── xaml-services │ │ ├── built-in-types-for-common-xaml-language-primitives.md │ │ ├── collections-and-collection-types-for-xaml.md │ │ ├── default-xaml-schema-context-and-wpf-xaml-schema-context.md │ │ ├── defining-custom-types-for-use-with-net-framework-xaml-services.md │ │ ├── escape-sequence-markup-extension.md │ │ ├── generics-in-xaml.md │ │ ├── index.md │ │ ├── markup-extensions-for-xaml-overview.md │ │ ├── service-contexts-available-to-type-converters-and-markup-extensions.md │ │ ├── toc.yml │ │ ├── type-converters-and-markup-extensions-for-xaml.md │ │ ├── type-converters-for-xaml-overview.md │ │ ├── types-migrated-from-wpf-to-system-xaml.md │ │ ├── understanding-xaml-node-stream-structures-and-concepts.md │ │ ├── whitespace-processing-in-xaml.md │ │ ├── x-arguments-directive.md │ │ ├── x-array-markup-extension.md │ │ ├── x-class-directive.md │ │ ├── x-classmodifier-directive.md │ │ ├── x-code-intrinsic-xaml-type.md │ │ ├── x-factorymethod-directive.md │ │ ├── x-fieldmodifier-directive.md │ │ ├── x-key-directive.md │ │ ├── x-member-directive.md │ │ ├── x-members-directive.md │ │ ├── x-name-directive.md │ │ ├── x-null-markup-extension.md │ │ ├── x-property-directive.md │ │ ├── x-reference-markup-extension.md │ │ ├── x-shared-attribute.md │ │ ├── x-static-markup-extension.md │ │ ├── x-subclass-directive.md │ │ ├── x-type-markup-extension.md │ │ ├── x-typearguments-directive.md │ │ ├── x-uid-directive.md │ │ ├── x-xdata-intrinsic-xaml-type.md │ │ ├── xaml-2009-language-features.md │ │ ├── xaml-namespace-x-language-features.md │ │ ├── xaml-namespaces-for-net-framework-xaml-services.md │ │ ├── xaml-related-clr-attributes-for-custom-types-and-libraries.md │ │ ├── xaml-security-considerations.md │ │ ├── xamlname-grammar.md │ │ ├── xamlservices-class-and-basic-xaml-reading-or-writing.md │ │ ├── xml-character-entities-and-xaml.md │ │ ├── xml-lang-handling-in-xaml.md │ │ └── xml-space-handling-in-xaml.md ├── fsharp │ ├── get-started │ │ ├── get-started-command-line.md │ │ ├── get-started-visual-studio.md │ │ ├── get-started-vscode.md │ │ ├── get-started-with-visual-studio-for-mac.md │ │ ├── index.md │ │ ├── install-fsharp.md │ │ └── media │ │ │ └── getting-started-vscode │ │ │ └── vscode-fsi.png │ ├── index.md │ ├── introduction-to-functional-programming │ │ ├── first-class-functions.md │ │ └── index.md │ ├── language-reference │ │ ├── abstract-classes.md │ │ ├── access-control.md │ │ ├── active-patterns.md │ │ ├── anonymous-records.md │ │ ├── arrays.md │ │ ├── assertions.md │ │ ├── asynchronous-workflows.md │ │ ├── attributes.md │ │ ├── basic-types.md │ │ ├── byrefs.md │ │ ├── caller-information.md │ │ ├── casting-and-conversions.md │ │ ├── classes.md │ │ ├── code-quotations.md │ │ ├── compiler-directives.md │ │ ├── compiler-options.md │ │ ├── computation-expressions.md │ │ ├── conditional-expressions-if-then-else.md │ │ ├── copy-and-update-record-expressions.md │ │ ├── delegates.md │ │ ├── discriminated-unions.md │ │ ├── enumerations.md │ │ ├── exception-handling │ │ │ ├── exception-types.md │ │ │ ├── index.md │ │ │ ├── the-failwith-function.md │ │ │ ├── the-invalidArg-function.md │ │ │ ├── the-raise-function.md │ │ │ ├── the-try-finally-expression.md │ │ │ └── the-try-with-expression.md │ │ ├── fixed.md │ │ ├── flexible-types.md │ │ ├── fsharp-collection-types.md │ │ ├── fsharp-interactive-options.md │ │ ├── fsharp-types.md │ │ ├── functions │ │ │ ├── do-bindings.md │ │ │ ├── entry-point.md │ │ │ ├── external-functions.md │ │ │ ├── index.md │ │ │ ├── inline-functions.md │ │ │ ├── lambda-expressions-the-fun-keyword.md │ │ │ ├── let-bindings.md │ │ │ └── recursive-functions-the-rec-keyword.md │ │ ├── generics │ │ │ ├── automatic-generalization.md │ │ │ ├── constraints.md │ │ │ ├── index.md │ │ │ └── statically-resolved-type-parameters.md │ │ ├── import-declarations-the-open-keyword.md │ │ ├── index.md │ │ ├── inheritance.md │ │ ├── interfaces.md │ │ ├── keyword-reference.md │ │ ├── lazy-expressions.md │ │ ├── lists.md │ │ ├── literals.md │ │ ├── loops-for-in-expression.md │ │ ├── loops-for-to-expression.md │ │ ├── loops-while-do-expression.md │ │ ├── match-expressions.md │ │ ├── media │ │ │ └── query-expressions │ │ │ │ └── student-course-database.png │ │ ├── members │ │ │ ├── constructors.md │ │ │ ├── do-bindings-in-classes.md │ │ │ ├── events.md │ │ │ ├── explicit-fields-the-val-keyword.md │ │ │ ├── index.md │ │ │ ├── indexed-properties.md │ │ │ ├── let-bindings-in-classes.md │ │ │ ├── methods.md │ │ │ └── properties.md │ │ ├── modules.md │ │ ├── namespaces.md │ │ ├── object-expressions.md │ │ ├── operator-overloading.md │ │ ├── options.md │ │ ├── parameters-and-arguments.md │ │ ├── pattern-matching.md │ │ ├── query-expressions.md │ │ ├── records.md │ │ ├── reference-cells.md │ │ ├── resource-management-the-use-keyword.md │ │ ├── results.md │ │ ├── sequences.md │ │ ├── signature-files.md │ │ ├── slices.md │ │ ├── source-line-file-path-identifiers.md │ │ ├── strings.md │ │ ├── structures.md │ │ ├── symbol-and-operator-reference │ │ │ ├── arithmetic-operators.md │ │ │ ├── bitwise-operators.md │ │ │ ├── boolean-operators.md │ │ │ ├── index.md │ │ │ └── nullable-operators.md │ │ ├── tuples.md │ │ ├── type-abbreviations.md │ │ ├── type-extensions.md │ │ ├── type-inference.md │ │ ├── unit-type.md │ │ ├── units-of-measure.md │ │ ├── value-options.md │ │ ├── values │ │ │ ├── index.md │ │ │ └── null-values.md │ │ ├── verbose-syntax.md │ │ └── xml-documentation.md │ ├── media │ │ └── discriminated-unions │ │ │ └── tree-structure-mytree.png │ ├── style-guide │ │ ├── component-design-guidelines.md │ │ ├── conventions.md │ │ ├── formatting.md │ │ └── index.md │ ├── toc.yml │ ├── tour.md │ ├── tutorials │ │ ├── asynchronous-and-concurrent-programming │ │ │ └── async.md │ │ ├── fsharp-interactive │ │ │ └── index.md │ │ └── type-providers │ │ │ ├── creating-a-type-provider.md │ │ │ ├── index.md │ │ │ ├── troubleshooting-type-providers.md │ │ │ └── type-provider-security.md │ ├── using-fsharp-on-azure │ │ ├── blob-storage.md │ │ ├── file-storage.md │ │ ├── index.md │ │ ├── package-management.md │ │ ├── queue-storage.md │ │ └── table-storage.md │ └── what-is-fsharp.md ├── images │ ├── core-changes │ │ ├── corefx │ │ │ └── version-information-changes │ │ │ │ └── file-details.png │ │ └── windowsforms │ │ │ ├── control-defaultfont-changed │ │ │ ├── defaultfont-core.png │ │ │ └── defaultfont-framework.png │ │ │ └── modernized-folderbrowserdialog │ │ │ ├── folderdlg-core.png │ │ │ └── folderdlg-framework.png │ ├── corefx-platforms-loc.png │ └── hub │ │ ├── azure-containers.svg │ │ ├── blazor.svg │ │ ├── cloud-native.svg │ │ ├── csharp-icon.svg │ │ ├── devops.svg │ │ ├── dotnet-core.svg │ │ ├── dotnet-framework.svg │ │ ├── dotnet-logo-image.svg │ │ ├── featured-1.svg │ │ ├── featured-2.svg │ │ ├── featured-3.svg │ │ ├── fsharp-icon.svg │ │ ├── grpc.svg │ │ ├── machine-learning-dotnet.svg │ │ ├── microservices.svg │ │ ├── net-docs-cloud-1.svg │ │ ├── net-docs-cloud-2.svg │ │ ├── net-docs-cloud-3.svg │ │ ├── net-docs-cloud-4.svg │ │ ├── net-docs-csharp.svg │ │ ├── net-docs-desktop-1.svg │ │ ├── net-docs-desktop-2-core.svg │ │ ├── net-docs-desktop-2-framework.svg │ │ ├── net-docs-desktop-2.svg │ │ ├── net-docs-desktop-3.svg │ │ ├── net-docs-desktop-4.svg │ │ ├── net-docs-dotnet-core.svg │ │ ├── net-docs-gaming-1.svg │ │ ├── net-docs-gaming-2.svg │ │ ├── net-docs-gaming-3.svg │ │ ├── net-docs-gaming-4.svg │ │ ├── net-docs-mobile-1.svg │ │ ├── net-docs-mobile-2.svg │ │ ├── net-docs-mobile-3.svg │ │ ├── net-docs-web-1.svg │ │ ├── net-docs-web-2.svg │ │ ├── net-docs-web-3.svg │ │ ├── net-docs-web-4.svg │ │ ├── net-docs-web-5.svg │ │ ├── net-docs-web-6.svg │ │ ├── net-gs-1.svg │ │ ├── net-gs-2.svg │ │ ├── net-gs-3.svg │ │ ├── net-gs-4.svg │ │ ├── net-gs-5.svg │ │ ├── net-gs-6.svg │ │ ├── net-gs-7.svg │ │ ├── netspark-logo-image.svg │ │ ├── serverless.svg │ │ ├── swimlane-azure-machine-learning.svg │ │ ├── swimlane-cognitive-services.svg │ │ ├── swimlane-machine-learning-brain-lightbulb.svg │ │ ├── swimlane-net-spark.svg │ │ ├── tools.svg │ │ ├── visual-basic.svg │ │ └── xamarin-icon.svg ├── machine-learning │ ├── automate-training-with-cli.md │ ├── automate-training-with-model-builder.md │ ├── automl-overview.md │ ├── how-does-mldotnet-work.md │ ├── how-to-choose-an-ml-net-algorithm.md │ ├── how-to-guides │ │ ├── explain-machine-learning-model-permutation-feature-importance-ml-net.md │ │ ├── how-to-use-the-automl-api.md │ │ ├── index.md │ │ ├── inspect-intermediate-data-ml-net.md │ │ ├── install-ml-net-cli.md │ │ ├── install-model-builder.md │ │ ├── load-data-ml-net.md │ │ ├── load-data-model-builder.md │ │ ├── machine-learning-model-predictions-ml-net.md │ │ ├── matchup-app-infer-net.md │ │ ├── media │ │ │ ├── cli-tab-completion.gif │ │ │ ├── inspect-intermediate-data-ml-net │ │ │ │ ├── data-debugger-preview-01.png │ │ │ │ └── data-debugger-preview-02.png │ │ │ ├── install-model-builder │ │ │ │ ├── vs2017-install-model-builder.png │ │ │ │ ├── vs2017-open-extensions-manager.png │ │ │ │ ├── vs2017-uninstall-model-builder.png │ │ │ │ ├── vs2019-install-model-builder.png │ │ │ │ ├── vs2019-open-extensions-manager.png │ │ │ │ └── vs2019-uninstall-model-builder.png │ │ │ └── use-gams-for-model-explainability │ │ │ │ └── gam-shape-function-graph.png │ │ ├── prepare-data-ml-net.md │ │ ├── retrain-model-ml-net.md │ │ ├── save-load-machine-learning-models-ml-net.md │ │ ├── serve-model-serverless-azure-functions-ml-net.md │ │ ├── serve-model-web-api-ml-net.md │ │ ├── train-machine-learning-model-cross-validation-ml-net.md │ │ ├── train-machine-learning-model-ml-net.md │ │ ├── use-gams-for-model-explainability.md │ │ └── verify-model-quality-ml-net.md │ ├── index.yml │ ├── media │ │ ├── automate-training-with-cli │ │ │ ├── cli-binary-classification-metrics.png │ │ │ ├── cli-high-level-process.png │ │ │ ├── cli-model-generation.gif │ │ │ ├── cli-multiclass-classification-metrics.png │ │ │ └── cli-regression-metrics.png │ │ ├── binary-classification-examples.png │ │ ├── binary-classification-icon.svg │ │ ├── catalog-intellisense.png │ │ ├── linear-regression-model.svg │ │ ├── ml-dotnet-model-builder.gif │ │ ├── ml-net-annotated-workflow.svg │ │ ├── ml-net-dataview.png │ │ ├── mldotnet-annotated-workflow.png │ │ ├── model-builder-data.png │ │ ├── model-builder-steps.png │ │ ├── multiclass-classification-examples.png │ │ ├── multiclass-classification-icon.svg │ │ ├── regression-examples.png │ │ ├── regression-icon.svg │ │ └── text-classification-model.svg │ ├── reference │ │ ├── media │ │ │ └── ml-net-automl-working-diagram.png │ │ └── ml-net-cli-reference.md │ ├── resources │ │ ├── glossary.md │ │ ├── improve-machine-learning-model-ml-net.md │ │ ├── index.md │ │ ├── metrics.md │ │ ├── ml-net-cli-telemetry.md │ │ ├── tasks.md │ │ └── transforms.md │ ├── toc.yml │ └── tutorials │ │ ├── github-issue-classification.md │ │ ├── health-violation-classification-model-builder.md │ │ ├── image-classification-api-transfer-learning.md │ │ ├── image-classification.md │ │ ├── index.md │ │ ├── iris-clustering.md │ │ ├── media │ │ ├── image-classification-api-transfer-learning │ │ │ ├── predictedimage.jpg │ │ │ ├── sdnet2018decksamples.png │ │ │ └── training.png │ │ ├── image-classification │ │ │ ├── 119px-Nalle_-_a_small_brown_teddy_bear.jpg │ │ │ ├── 193px-Broodrooster.jpg │ │ │ ├── 220px-Pepperoni_pizza.jpg │ │ │ ├── inception-files.png │ │ │ └── tensorflow-mlnet.png │ │ ├── mlnet-cli │ │ │ ├── generated-csharp-solution-detailed.png │ │ │ ├── mlnet-auto-train-binary-classification-bash.gif │ │ │ ├── mlnet-auto-train-binary-classification-powershell.gif │ │ │ ├── sample-cli-prediction-execution-bash.png │ │ │ └── sample-cli-prediction-execution.png │ │ ├── movie-recommendation │ │ │ ├── copy-to-output-if-newer.gif │ │ │ ├── csv-file-dataset-preview.png │ │ │ ├── data-estimator-transformer.png │ │ │ └── data-transformer-transformed.png │ │ ├── object-detection-onnx │ │ │ ├── dinning-room-table-chairs.png │ │ │ ├── img-classification-obj-detection.PNG │ │ │ ├── model-output-description.PNG │ │ │ ├── netron-model-map-layers.png │ │ │ ├── onnx-ml-net-integration.png │ │ │ └── onyx-supported-formats.png │ │ ├── sales-anomaly-detection │ │ │ ├── change-point-detection.png │ │ │ ├── time-series-anomaly-detection.png │ │ │ └── two-spike-detections.png │ │ ├── sentiment-analysis-model-builder │ │ │ ├── model-builder-screen.png │ │ │ └── web-app.png │ │ ├── text-classification-tf │ │ │ └── sentiment-model-files.png │ │ └── time-series-demand-forecasting │ │ │ └── forecast.png │ │ ├── mlnet-cli.md │ │ ├── movie-recommendation.md │ │ ├── object-detection-onnx.md │ │ ├── predict-prices-with-model-builder.md │ │ ├── predict-prices.md │ │ ├── sales-anomaly-detection.md │ │ ├── sentiment-analysis-model-builder.md │ │ ├── sentiment-analysis.md │ │ ├── text-classification-tf.md │ │ └── time-series-demand-forecasting.md ├── project-json.md ├── samples-and-tutorials │ └── index.md ├── spark │ ├── how-to-guides │ │ └── debug.md │ ├── index.yml │ ├── media │ │ ├── dotnet-spark-architecture.png │ │ └── spark-architecture.png │ ├── resources │ │ └── index.md │ ├── toc.yml │ ├── tutorials │ │ ├── amazon-emr-spark-deployment.md │ │ ├── databricks-deployment.md │ │ ├── get-started.md │ │ ├── hdinsight-deployment.md │ │ ├── index.md │ │ └── media │ │ │ ├── databricks-deployment │ │ │ ├── cluster-config.png │ │ │ ├── configure-spark-submit.png │ │ │ ├── create-databricks-resource.png │ │ │ ├── create-job.png │ │ │ ├── databricks-user-settings.png │ │ │ ├── generate-token.png │ │ │ ├── launch-databricks-workspace.png │ │ │ └── table-output.png │ │ │ └── hdinsight-deployment │ │ │ ├── create-hdinsight-resource.png │ │ │ ├── signin-azure-storage-explorer.png │ │ │ └── upload-files-to-storage.png │ ├── what-is-apache-spark-dotnet.md │ └── what-is-spark.md ├── standard │ ├── analyzers │ │ ├── api-analyzer.md │ │ ├── framework-analyzer.md │ │ ├── index.md │ │ ├── media │ │ │ ├── api-analyzer │ │ │ │ ├── disable-notifications.jpg │ │ │ │ ├── green-squiggle.jpg │ │ │ │ ├── suppress-in-source.jpg │ │ │ │ ├── suppress-in-sup-file.jpg │ │ │ │ ├── suppression-file.jpg │ │ │ │ └── warnings-id-and-descriptions.jpg │ │ │ ├── framework-analyzers-1.png │ │ │ ├── framework-analyzers-2.png │ │ │ └── portability-analyzer │ │ │ │ ├── api-catalog-missing-assemblies.png │ │ │ │ ├── api-catalog-portablility-details.png │ │ │ │ ├── api-catalog-portablility-summary.png │ │ │ │ ├── portability-screenshot.png │ │ │ │ └── portability-solution-explorer.png │ │ └── portability-analyzer.md │ ├── application-essentials.md │ ├── assembly │ │ ├── contents.md │ │ ├── create-public-private-key-pair.md │ │ ├── create-signed-friend.md │ │ ├── create-unsigned-friend.md │ │ ├── create-use-strong-named.md │ │ ├── create.md │ │ ├── delay-sign.md │ │ ├── disable-strong-name-bypass-feature.md │ │ ├── embed-types-visual-studio.md │ │ ├── enhanced-strong-naming.md │ │ ├── file-format.md │ │ ├── find-fully-qualified-name.md │ │ ├── friend.md │ │ ├── identify.md │ │ ├── index.md │ │ ├── load-unload.md │ │ ├── location.md │ │ ├── manifest.md │ │ ├── media │ │ │ ├── contents │ │ │ │ └── single-file-assembly.gif │ │ │ ├── manifest │ │ │ │ └── assembly-types-diagram.gif │ │ │ └── versioning │ │ │ │ └── resolve-assembly-binding-request.gif │ │ ├── names.md │ │ ├── reference-assemblies.md │ │ ├── reference-strong-named.md │ │ ├── resolve-loads.md │ │ ├── security-considerations.md │ │ ├── set-attributes.md │ │ ├── side-by-side-execution.md │ │ ├── sign-strong-name.md │ │ ├── strong-named.md │ │ ├── toc.yml │ │ ├── type-forwarding.md │ │ ├── unloadability.md │ │ ├── versioning.md │ │ └── view-contents.md │ ├── async-in-depth.md │ ├── async.md │ ├── asynchronous-programming-patterns │ │ ├── asynchronous-programming-model-apm.md │ │ ├── asynchronous-programming-using-delegates.md │ │ ├── best-practices-for-implementing-the-event-based-asynchronous-pattern.md │ │ ├── blocking-application-execution-by-ending-an-async-operation.md │ │ ├── blocking-application-execution-using-an-asyncwaithandle.md │ │ ├── calling-asynchronous-methods-using-iasyncresult.md │ │ ├── calling-synchronous-methods-asynchronously.md │ │ ├── component-that-supports-the-event-based-asynchronous-pattern.md │ │ ├── consuming-the-task-based-asynchronous-pattern.md │ │ ├── deciding-when-to-implement-the-event-based-asynchronous-pattern.md │ │ ├── event-based-asynchronous-pattern-eap.md │ │ ├── event-based-asynchronous-pattern-overview.md │ │ ├── how-to-implement-a-client-of-the-event-based-asynchronous-pattern.md │ │ ├── how-to-use-components-that-support-the-event-based-asynchronous-pattern.md │ │ ├── implementing-the-event-based-asynchronous-pattern.md │ │ ├── implementing-the-task-based-asynchronous-pattern.md │ │ ├── index.md │ │ ├── interop-with-other-asynchronous-patterns-and-types.md │ │ ├── polling-for-the-status-of-an-asynchronous-operation.md │ │ ├── task-based-asynchronous-pattern-tap.md │ │ ├── toc.yml │ │ ├── using-an-asynccallback-delegate-and-state-object.md │ │ └── using-an-asynccallback-delegate-to-end-an-asynchronous-operation.md │ ├── attributes │ │ ├── applying-attributes.md │ │ ├── index.md │ │ ├── retrieving-information-stored-in-attributes.md │ │ ├── toc.yml │ │ └── writing-custom-attributes.md │ ├── automatic-memory-management.md │ ├── base-types │ │ ├── alternation-constructs-in-regular-expressions.md │ │ ├── anchors-in-regular-expressions.md │ │ ├── backreference-constructs-in-regular-expressions.md │ │ ├── backtracking-in-regular-expressions.md │ │ ├── basic-manipulations.md │ │ ├── basic-string-operations.md │ │ ├── best-practices-strings.md │ │ ├── best-practices.md │ │ ├── changing-case.md │ │ ├── character-classes-in-regular-expressions.md │ │ ├── character-encoding.md │ │ ├── character-escapes-in-regular-expressions.md │ │ ├── common-type-system.md │ │ ├── comparing.md │ │ ├── compilation-and-reuse-in-regular-expressions.md │ │ ├── composite-formatting.md │ │ ├── conversion-tables.md │ │ ├── creating-new.md │ │ ├── custom-date-and-time-format-strings.md │ │ ├── custom-numeric-format-strings.md │ │ ├── custom-timespan-format-strings.md │ │ ├── details-of-regular-expression-behavior.md │ │ ├── enumeration-format-strings.md │ │ ├── formatting-types.md │ │ ├── grouping-constructs-in-regular-expressions.md │ │ ├── how-to-convert-numeric-user-input-in-web-controls-to-numbers.md │ │ ├── how-to-define-and-use-custom-numeric-format-providers.md │ │ ├── how-to-display-dates-in-non-gregorian-calendars.md │ │ ├── how-to-display-localized-date-and-time-information-to-web-users.md │ │ ├── how-to-display-milliseconds-in-date-and-time-values.md │ │ ├── how-to-extract-a-protocol-and-port-number-from-a-url.md │ │ ├── how-to-extract-the-day-of-the-week-from-a-specific-date.md │ │ ├── how-to-pad-a-number-with-leading-zeros.md │ │ ├── how-to-round-trip-date-and-time-values.md │ │ ├── how-to-strip-invalid-characters-from-a-string.md │ │ ├── how-to-verify-that-strings-are-in-valid-email-format.md │ │ ├── index.md │ │ ├── manipulating-strings.md │ │ ├── miscellaneous-constructs-in-regular-expressions.md │ │ ├── padding.md │ │ ├── parsing-datetime.md │ │ ├── parsing-numeric.md │ │ ├── parsing-other.md │ │ ├── parsing-strings.md │ │ ├── performing-formatting-operations.md │ │ ├── quantifiers-in-regular-expressions.md │ │ ├── regular-expression-example-changing-date-formats.md │ │ ├── regular-expression-example-scanning-for-hrefs.md │ │ ├── regular-expression-examples.md │ │ ├── regular-expression-language-quick-reference.md │ │ ├── regular-expression-options.md │ │ ├── regular-expressions.md │ │ ├── standard-date-and-time-format-strings.md │ │ ├── standard-numeric-format-strings.md │ │ ├── standard-timespan-format-strings.md │ │ ├── stringbuilder.md │ │ ├── substitutions-in-regular-expressions.md │ │ ├── the-regular-expression-object-model.md │ │ ├── thread-safety-in-regular-expressions.md │ │ ├── toc.yml │ │ ├── trimming.md │ │ └── type-conversion.md │ ├── building-console-apps.md │ ├── choosing-core-framework-server.md │ ├── class-libraries.md │ ├── class-library-overview.md │ ├── clr.md │ ├── collections │ │ ├── commonly-used-collection-types.md │ │ ├── comparisons-and-sorts-within-collections.md │ │ ├── hashtable-and-dictionary-collection-types.md │ │ ├── index.md │ │ ├── selecting-a-collection-class.md │ │ ├── sorted-collection-types.md │ │ ├── thread-safe │ │ │ ├── blockingcollection-overview.md │ │ │ ├── how-to-add-and-remove-items.md │ │ │ ├── how-to-add-and-take-items.md │ │ │ ├── how-to-add-bounding-and-blocking.md │ │ │ ├── how-to-create-an-object-pool.md │ │ │ ├── how-to-use-arrays-of-blockingcollections.md │ │ │ ├── how-to-use-foreach-to-remove.md │ │ │ ├── index.md │ │ │ ├── toc.yml │ │ │ └── when-to-use-a-thread-safe-collection.md │ │ ├── toc.yml │ │ └── when-to-use-generic-collections.md │ ├── common-type-system.md │ ├── components.md │ ├── cross-platform │ │ ├── app-resources-for-libraries-that-target-multiple-platforms.md │ │ ├── cross-platform-development-with-the-portable-class-library.md │ │ ├── index.md │ │ ├── media │ │ │ ├── add-portable-class-library.png │ │ │ ├── pcl-project-properties.png │ │ │ └── using-portable-class-library-with-model-view-view-model │ │ │ │ └── mvvm-share-assemblies-across-platforms.png │ │ ├── passing-a-uri-to-the-windows-runtime.md │ │ ├── support-for-windows-store-apps-and-windows-runtime.md │ │ ├── toc.yml │ │ └── using-portable-class-library-with-model-view-view-model.md │ ├── data │ │ └── xml │ │ │ ├── accessing-attributes-in-the-dom.md │ │ │ ├── accessing-strongly-typed-xml-data-using-xpathnavigator.md │ │ │ ├── accessing-xml-data-using-xpathnavigator.md │ │ │ ├── attribute-and-namespace-node-navigation-using-xpathnavigator.md │ │ │ ├── building-xml-schemas.md │ │ │ ├── changing-namespace-declarations-in-an-xml-document.md │ │ │ ├── changing-namespace-prefix-properties.md │ │ │ ├── compiled-xpath-expressions.md │ │ │ ├── conversion-of-xml-data-types.md │ │ │ ├── converting-dotnet-types-to-strings.md │ │ │ ├── converting-strings-to-dotnet-data-types.md │ │ │ ├── copy-existing-nodes.md │ │ │ ├── copying-document-fragments.md │ │ │ ├── copying-existing-nodes-from-one-document-to-another.md │ │ │ ├── create-new-nodes-in-the-dom.md │ │ │ ├── creating-new-attributes-for-elements-in-the-dom.md │ │ │ ├── creating-new-entity-references.md │ │ │ ├── dynamic-updates-to-nodelists-and-namednodemaps.md │ │ │ ├── editing-xml-data-using-xpathnavigator.md │ │ │ ├── editing-xml-schemas.md │ │ │ ├── entity-references-are-expanded-and-not-preserved.md │ │ │ ├── entity-references-are-preserved.md │ │ │ ├── evaluate-xpath-expressions-using-xpathnavigator.md │ │ │ ├── event-handling-in-an-xml-document-using-the-xmlnodechangedeventargs.md │ │ │ ├── extending-the-dom.md │ │ │ ├── extending-xslt-style-sheets.md │ │ │ ├── extract-xml-data-using-xpathnavigator.md │ │ │ ├── how-to-migrate-your-xsltransform-code.md │ │ │ ├── how-to-perform-an-xslt-transformation-by-using-an-assembly.md │ │ │ ├── how-to-transform-a-node-fragment.md │ │ │ ├── implementation-of-discretionary-behaviors-in-the-xsltransform-class.md │ │ │ ├── including-or-importing-xml-schemas.md │ │ │ ├── index.md │ │ │ ├── inferring-an-xml-schema.md │ │ │ ├── inferring-schemas-from-xml-documents.md │ │ │ ├── inputs-to-the-xslcompiledtransform-class.md │ │ │ ├── insert-xml-data-using-xpathnavigator.md │ │ │ ├── inserting-nodes-into-an-xml-document.md │ │ │ ├── load-data-from-a-reader.md │ │ │ ├── managing-namespaces-in-an-xml-document.md │ │ │ ├── mapping-the-object-hierarchy-to-xml-data.md │ │ │ ├── mapping-xml-data-types-to-clr-types.md │ │ │ ├── matching-nodes-using-xpathnavigator.md │ │ │ ├── media │ │ │ ├── dom-class-hierarchy.gif │ │ │ ├── entity-hierarchy.gif │ │ │ ├── simple-xml.gif │ │ │ ├── xml-entitydeclaration-node2.png │ │ │ ├── xml-integration-with-relational-data-and-adonet │ │ │ │ └── xml-integration-relational-data-adodotnet.gif │ │ │ ├── xml-schema-object-model-overview │ │ │ │ └── xml-schema-object-model.gif │ │ │ ├── xml-to-domtree.gif │ │ │ ├── xmlentityref-expanded-nodes.gif │ │ │ ├── xmlentityref-notexpanded-nodes.gif │ │ │ └── xslt-transformations-with-the-xsltransform-class │ │ │ │ └── xslt-transformation-architecture.gif │ │ │ ├── migrating-from-the-xsltransform-class.md │ │ │ ├── modify-xml-data-using-xpathnavigator.md │ │ │ ├── modifying-nodes-content-and-values-in-an-xml-document.md │ │ │ ├── namespace-affect-on-entity-ref-expansion-for-new-nodes.md │ │ │ ├── namespace-support-in-the-dom.md │ │ │ ├── namespaces-and-dtds-in-the-dom.md │ │ │ ├── node-collections-in-namednodemaps-and-nodelists.md │ │ │ ├── node-set-navigation-using-xpathnavigator.md │ │ │ ├── node-sets-in-transformations.md │ │ │ ├── node-types-recognized-with-xpath-queries.md │ │ │ ├── object-comparison-using-xmlnametable.md │ │ │ ├── ordered-node-retrieval-by-index.md │ │ │ ├── output-options-on-the-xslcompiledtransform-class.md │ │ │ ├── outputs-from-an-xsltransform.md │ │ │ ├── post-schema-compilation-infoset.md │ │ │ ├── process-xml-data-using-linq-to-xml.md │ │ │ ├── process-xml-data-using-the-dom-model.md │ │ │ ├── process-xml-data-using-the-xpath-data-model.md │ │ │ ├── processing-xml-data-in-memory.md │ │ │ ├── reading-an-xml-document-into-the-dom.md │ │ │ ├── reading-and-writing-xml-schemas.md │ │ │ ├── reading-entity-declarations-and-entity-references-into-the-dom.md │ │ │ ├── reading-xml-data-using-xpathdocument-and-xmldocument.md │ │ │ ├── recoverable-xslt-errors.md │ │ │ ├── remove-xml-data-using-xpathnavigator.md │ │ │ ├── removing-attributes-from-an-element-node-in-the-dom.md │ │ │ ├── removing-node-content-in-the-dom.md │ │ │ ├── removing-nodes-content-and-values-from-an-xml-document.md │ │ │ ├── removing-nodes-from-the-dom.md │ │ │ ├── resolving-external-resources-during-xslt-processing.md │ │ │ ├── resolving-external-resources.md │ │ │ ├── resolving-external-xslt-style-sheets-and-documents.md │ │ │ ├── result-tree-fragment-in-transformations.md │ │ │ ├── rules-for-inferring-schema-node-types-and-structure.md │ │ │ ├── rules-for-inferring-simple-types.md │ │ │ ├── saving-and-writing-a-document.md │ │ │ ├── schema-validation-using-xpathnavigator.md │ │ │ ├── script-blocks-using-msxsl-script.md │ │ │ ├── select-nodes-using-xpath-navigation.md │ │ │ ├── select-xml-data-using-xpathnavigator.md │ │ │ ├── selecting-evaluating-and-matching-xml-data-using-xpathnavigator.md │ │ │ ├── style-sheet-directives-embedded-in-a-document.md │ │ │ ├── support-for-the-msxsl-node-set-function.md │ │ │ ├── toc.yml │ │ │ ├── traversing-xml-schemas.md │ │ │ ├── type-support-in-the-system-xml-classes.md │ │ │ ├── types-of-xml-nodes.md │ │ │ ├── unordered-node-retrieval-by-name-or-index.md │ │ │ ├── user-defined-functions-and-variables.md │ │ │ ├── using-the-xslcompiledtransform-class.md │ │ │ ├── validating-an-xml-document-in-the-dom.md │ │ │ ├── white-space-and-significant-white-space-handling-when-loading-the-dom.md │ │ │ ├── working-with-xml-schemas.md │ │ │ ├── xdr-validation-with-xmlschemacollection.md │ │ │ ├── xml-document-creation.md │ │ │ ├── xml-document-object-model-dom-hierarchy.md │ │ │ ├── xml-document-object-model-dom.md │ │ │ ├── xml-element-and-attribute-name-verification-when-creating-new-nodes.md │ │ │ ├── xml-integration-with-relational-data-and-adonet.md │ │ │ ├── xml-processing-options.md │ │ │ ├── xml-schema-object-model-overview.md │ │ │ ├── xml-schema-object-model-som.md │ │ │ ├── xml-schema-xsd-validation-with-xmlschemacollection.md │ │ │ ├── xml-schema-xsd-validation-with-xmlschemaset.md │ │ │ ├── xml-type-support-implementation-notes.md │ │ │ ├── xmldatadocument-input-to-xsltransform.md │ │ │ ├── xmldocument-input-to-xsltransform.md │ │ │ ├── xmlschemacollection-schema-compilation.md │ │ │ ├── xmlschemaset-for-schema-compilation.md │ │ │ ├── xmlschemavalidator-push-based-validation.md │ │ │ ├── xpath-namespace-navigation.md │ │ │ ├── xpath-queries-and-namespaces.md │ │ │ ├── xpathdocument-input-to-xsltransform.md │ │ │ ├── xpathnavigator-in-transformations.md │ │ │ ├── xpathnodeiterator-in-transformations.md │ │ │ ├── xslt-compiler-xsltc-exe.md │ │ │ ├── xslt-extension-objects.md │ │ │ ├── xslt-parameters.md │ │ │ ├── xslt-security-considerations.md │ │ │ ├── xslt-stylesheet-scripting-using-msxsl-script.md │ │ │ ├── xslt-transformations-over-different-stores.md │ │ │ ├── xslt-transformations-with-the-xsltransform-class.md │ │ │ ├── xslt-transformations.md │ │ │ ├── xsltargumentlist-for-style-sheet-parameters-and-extension-objects.md │ │ │ └── xsltransform-class-implements-the-xslt-processor.md │ ├── datetime │ │ ├── access-utc-and-local.md │ │ ├── choosing-between-datetime.md │ │ ├── converting-between-datetime-and-offset.md │ │ ├── converting-between-time-zones.md │ │ ├── create-time-zones-with-adjustment-rules.md │ │ ├── create-time-zones-without-adjustment-rules.md │ │ ├── enumerate-time-zones.md │ │ ├── finding-the-time-zones-on-local-system.md │ │ ├── index.md │ │ ├── instantiate-time-zone-info.md │ │ ├── instantiating-a-datetimeoffset-object.md │ │ ├── let-users-resolve-ambiguous-times.md │ │ ├── performing-arithmetic-operations.md │ │ ├── resolve-ambiguous-times.md │ │ ├── restore-time-zones-from-an-embedded-resource.md │ │ ├── save-time-zones-to-an-embedded-resource.md │ │ ├── saving-and-restoring-time-zones.md │ │ ├── system-text-json-support.md │ │ ├── time-zone-overview.md │ │ ├── toc.yml │ │ ├── use-time-zones-in-arithmetic.md │ │ └── working-with-calendars.md │ ├── delegates-lambdas.md │ ├── design-guidelines │ │ ├── abstract-class.md │ │ ├── abstractions-abstract-types-and-interfaces.md │ │ ├── arrays.md │ │ ├── attributes.md │ │ ├── base-classes-for-implementing-abstractions.md │ │ ├── capitalization-conventions.md │ │ ├── choosing-between-class-and-struct.md │ │ ├── common-design-patterns.md │ │ ├── constructor.md │ │ ├── dependency-properties.md │ │ ├── designing-for-extensibility.md │ │ ├── enum.md │ │ ├── equality-operators.md │ │ ├── event.md │ │ ├── events-and-callbacks.md │ │ ├── exception-throwing.md │ │ ├── exceptions-and-performance.md │ │ ├── exceptions.md │ │ ├── extension-methods.md │ │ ├── field.md │ │ ├── general-naming-conventions.md │ │ ├── guidelines-for-collections.md │ │ ├── index.md │ │ ├── interface.md │ │ ├── member-overloading.md │ │ ├── member.md │ │ ├── names-of-assemblies-and-dlls.md │ │ ├── names-of-classes-structs-and-interfaces.md │ │ ├── names-of-namespaces.md │ │ ├── names-of-type-members.md │ │ ├── naming-guidelines.md │ │ ├── naming-parameters.md │ │ ├── naming-resources.md │ │ ├── nested-types.md │ │ ├── operator-overloads.md │ │ ├── parameter-design.md │ │ ├── property.md │ │ ├── protected-members.md │ │ ├── sealing.md │ │ ├── serialization.md │ │ ├── static-class.md │ │ ├── struct.md │ │ ├── system-xml-usage.md │ │ ├── toc.yml │ │ ├── type.md │ │ ├── unsealed-classes.md │ │ ├── usage-guidelines.md │ │ ├── using-standard-exception-types.md │ │ └── virtual-members.md │ ├── events │ │ ├── how-to-consume-events-in-a-web-forms-application.md │ │ ├── how-to-handle-multiple-events-using-event-properties.md │ │ ├── how-to-implement-a-provider.md │ │ ├── how-to-implement-an-observer.md │ │ ├── how-to-raise-and-consume-events.md │ │ ├── index.md │ │ ├── observer-design-pattern-best-practices.md │ │ ├── observer-design-pattern.md │ │ └── toc.yml │ ├── exceptions │ │ ├── best-practices-for-exceptions.md │ │ ├── exception-class-and-properties.md │ │ ├── handling-com-interop-exceptions.md │ │ ├── how-to-create-localized-exception-messages.md │ │ ├── how-to-create-user-defined-exceptions.md │ │ ├── how-to-explicitly-throw-exceptions.md │ │ ├── how-to-use-finally-blocks.md │ │ ├── how-to-use-specific-exceptions-in-a-catch-block.md │ │ ├── how-to-use-the-try-catch-block-to-catch-exceptions.md │ │ ├── index.md │ │ ├── media │ │ │ ├── add-resources-to-default-culture.jpg │ │ │ └── add-resources-to-fr-culture.jpg │ │ ├── toc.yml │ │ └── using-user-filtered-exception-handlers.md │ ├── framework-libraries.md │ ├── frameworks.md │ ├── garbage-collection │ │ ├── app-domain-resource-monitoring.md │ │ ├── fundamentals.md │ │ ├── gc.md │ │ ├── implementing-dispose.md │ │ ├── index.md │ │ ├── induced.md │ │ ├── large-object-heap.md │ │ ├── latency.md │ │ ├── media │ │ │ ├── fundamentals │ │ │ │ ├── background-server-garbage-collection.png │ │ │ │ └── background-workstation-garbage-collection.png │ │ │ ├── gc-concurrent.png │ │ │ ├── gc-server.png │ │ │ ├── gc-triggered.png │ │ │ ├── large-object-heap │ │ │ │ ├── add-performance-counter.png │ │ │ │ ├── event-tracing-windows-perfview.png │ │ │ │ └── garbage-collector-heap.png │ │ │ └── loh │ │ │ │ ├── loh-figure-1.jpg │ │ │ │ ├── loh-figure-2.jpg │ │ │ │ └── loh-figure-3.jpg │ │ ├── memory-management-and-gc.md │ │ ├── notifications.md │ │ ├── optimization-for-shared-web-hosting.md │ │ ├── performance.md │ │ ├── toc.yml │ │ ├── unmanaged.md │ │ ├── using-objects.md │ │ └── weak-references.md │ ├── generics.md │ ├── generics │ │ ├── collections.md │ │ ├── covariance-and-contravariance.md │ │ ├── delegates-for-manipulating-arrays-and-lists.md │ │ ├── index.md │ │ ├── interfaces.md │ │ └── toc.yml │ ├── get-started.md │ ├── globalization-localization │ │ ├── best-practices-for-developing-world-ready-apps.md │ │ ├── culture-insensitive-string-operations.md │ │ ├── globalization.md │ │ ├── index.md │ │ ├── localizability-review.md │ │ ├── localization.md │ │ ├── performing-culture-insensitive-case-changes.md │ │ ├── performing-culture-insensitive-string-comparisons.md │ │ ├── performing-culture-insensitive-string-operations-in-arrays.md │ │ ├── performing-culture-insensitive-string-operations-in-collections.md │ │ ├── performing-culture-insensitive-string-operations.md │ │ └── toc.yml │ ├── glossary.md │ ├── index.md │ ├── io │ │ ├── asynchronous-file-i-o.md │ │ ├── common-i-o-tasks.md │ │ ├── composing-streams.md │ │ ├── file-path-formats.md │ │ ├── handling-io-errors.md │ │ ├── how-to-add-or-remove-access-control-list-entries.md │ │ ├── how-to-anticipate-out-of-space-conditions-with-isolated-storage.md │ │ ├── how-to-compress-and-extract-files.md │ │ ├── how-to-convert-between-dotnet-streams-and-winrt-streams.md │ │ ├── how-to-copy-directories.md │ │ ├── how-to-create-files-and-directories-in-isolated-storage.md │ │ ├── how-to-delete-files-and-directories-in-isolated-storage.md │ │ ├── how-to-delete-stores-in-isolated-storage.md │ │ ├── how-to-enumerate-directories-and-files.md │ │ ├── how-to-enumerate-stores-for-isolated-storage.md │ │ ├── how-to-find-existing-files-and-directories-in-isolated-storage.md │ │ ├── how-to-obtain-stores-for-isolated-storage.md │ │ ├── how-to-open-and-append-to-a-log-file.md │ │ ├── how-to-read-and-write-to-a-newly-created-data-file.md │ │ ├── how-to-read-and-write-to-files-in-isolated-storage.md │ │ ├── how-to-read-characters-from-a-string.md │ │ ├── how-to-read-text-from-a-file.md │ │ ├── how-to-use-anonymous-pipes-for-local-interprocess-communication.md │ │ ├── how-to-use-named-pipes-for-network-interprocess-communication.md │ │ ├── how-to-write-characters-to-a-string.md │ │ ├── how-to-write-text-to-a-file.md │ │ ├── index.md │ │ ├── isolated-storage.md │ │ ├── media │ │ │ ├── memory-mapped-files │ │ │ │ └── memory-map-persist-file.png │ │ │ ├── pipelines │ │ │ │ └── resume-pause.png │ │ │ └── types-of-isolation │ │ │ │ └── isolated-storage-types.gif │ │ ├── memory-mapped-files.md │ │ ├── pipe-operations.md │ │ ├── pipelines.md │ │ ├── toc.yml │ │ └── types-of-isolation.md │ ├── language-independence-and-language-independent-components.md │ ├── language-independence.md │ ├── library-guidance │ │ ├── breaking-changes.md │ │ ├── cross-platform-targeting.md │ │ ├── dependencies.md │ │ ├── get-started.md │ │ ├── index.md │ │ ├── media │ │ │ ├── cross-platform-targeting │ │ │ │ ├── nuget-package-multiple-assemblies.png │ │ │ │ └── platforms-netstandard.png │ │ │ ├── dependencies │ │ │ │ ├── diamond-dependency-conflict.png │ │ │ │ ├── diamond-dependency.png │ │ │ │ ├── shared-source-package.png │ │ │ │ └── shared-source-project.png │ │ │ ├── nuget │ │ │ │ ├── nuget-logo.png │ │ │ │ └── nuget-prerelease-package.png │ │ │ ├── publish-nuget-package │ │ │ │ └── nuget-2fa.png │ │ │ ├── sourcelink │ │ │ │ └── nuget-package-explorer-sourcelink.png │ │ │ └── versioning │ │ │ │ └── win-properties.png │ │ ├── nuget.md │ │ ├── publish-nuget-package.md │ │ ├── sourcelink.md │ │ ├── strong-naming.md │ │ ├── toc.yml │ │ └── versioning.md │ ├── managed-code.md │ ├── managed-execution-process.md │ ├── media │ │ ├── assembly-format │ │ │ └── assembly-headers.png │ │ └── using-linq │ │ │ └── plinq-diagram.png │ ├── memory-and-spans │ │ ├── index.md │ │ └── memory-t-usage-guidelines.md │ ├── metadata-and-self-describing-components.md │ ├── native-interop │ │ ├── apply-interop-attributes.md │ │ ├── best-practices.md │ │ ├── charset.md │ │ ├── com-callable-wrapper.md │ │ ├── com-wrappers.md │ │ ├── cominterop.md │ │ ├── customize-parameter-marshaling.md │ │ ├── customize-struct-marshaling.md │ │ ├── index.md │ │ ├── media │ │ │ ├── com-callable-wrapper │ │ │ │ ├── com-callable-wrapper-clients.gif │ │ │ │ └── com-callable-wrapper-interfaces.gif │ │ │ ├── com-wrappers │ │ │ │ └── bidirectional-com-overview.gif │ │ │ └── runtime-callable-wrapper │ │ │ │ ├── runtime-callable-wrapper-interfaces.gif │ │ │ │ └── runtime-callable-wrapper.gif │ │ ├── pinvoke.md │ │ ├── qualify-net-types-for-interoperation.md │ │ ├── runtime-callable-wrapper.md │ │ └── type-marshaling.md │ ├── net-standard.md │ ├── numerics.md │ ├── parallel-processing-and-concurrency.md │ ├── parallel-programming │ │ ├── attached-and-detached-child-tasks.md │ │ ├── chaining-tasks-by-using-continuation-tasks.md │ │ ├── custom-partitioners-for-plinq-and-tpl.md │ │ ├── data-parallelism-task-parallel-library.md │ │ ├── data-structures-for-parallel-programming.md │ │ ├── dataflow-task-parallel-library.md │ │ ├── exception-handling-task-parallel-library.md │ │ ├── for-further-reading-parallel-programming.md │ │ ├── how-to-cancel-a-dataflow-block.md │ │ ├── how-to-cancel-a-parallel-for-or-foreach-loop.md │ │ ├── how-to-cancel-a-plinq-query.md │ │ ├── how-to-cancel-a-task-and-its-children.md │ │ ├── how-to-combine-parallel-and-sequential-linq-queries.md │ │ ├── how-to-control-ordering-in-a-plinq-query.md │ │ ├── how-to-create-and-execute-a-simple-plinq-query.md │ │ ├── how-to-create-pre-computed-tasks.md │ │ ├── how-to-handle-exceptions-in-a-plinq-query.md │ │ ├── how-to-handle-exceptions-in-parallel-loops.md │ │ ├── how-to-implement-a-partitioner-for-static-partitioning.md │ │ ├── how-to-implement-a-producer-consumer-dataflow-pattern.md │ │ ├── how-to-implement-dynamic-partitions.md │ │ ├── how-to-iterate-file-directories-with-plinq.md │ │ ├── how-to-iterate-file-directories-with-the-parallel-class.md │ │ ├── how-to-measure-plinq-query-performance.md │ │ ├── how-to-perform-action-when-a-dataflow-block-receives-data.md │ │ ├── how-to-prevent-a-child-task-from-attaching-to-its-parent.md │ │ ├── how-to-return-a-value-from-a-task.md │ │ ├── how-to-specify-a-task-scheduler-in-a-dataflow-block.md │ │ ├── how-to-specify-merge-options-in-plinq.md │ │ ├── how-to-specify-the-degree-of-parallelism-in-a-dataflow-block.md │ │ ├── how-to-specify-the-execution-mode-in-plinq.md │ │ ├── how-to-speed-up-small-loop-bodies.md │ │ ├── how-to-traverse-a-binary-tree-with-parallel-tasks.md │ │ ├── how-to-unlink-dataflow-blocks.md │ │ ├── how-to-unwrap-a-nested-task.md │ │ ├── how-to-use-joinblock-to-read-data-from-multiple-sources.md │ │ ├── how-to-use-parallel-invoke-to-execute-parallel-operations.md │ │ ├── how-to-wrap-eap-patterns-in-a-task.md │ │ ├── how-to-write-a-custom-plinq-aggregate-function.md │ │ ├── how-to-write-a-parallel-for-loop-with-thread-local-variables.md │ │ ├── how-to-write-a-parallel-foreach-loop-with-partition-local-variables.md │ │ ├── how-to-write-a-simple-parallel-for-loop.md │ │ ├── how-to-write-a-simple-parallel-foreach-loop.md │ │ ├── how-to-write-messages-to-and-read-messages-from-a-dataflow-block.md │ │ ├── index.md │ │ ├── introduction-to-plinq.md │ │ ├── lambda-expressions-in-plinq-and-tpl.md │ │ ├── media │ │ │ ├── tpl-architecture.png │ │ │ ├── tpldataflow-cancellation.png │ │ │ ├── tpldataflow-compositeimages.gif │ │ │ ├── vs-isvnt-allvseach.png │ │ │ └── walkthrough-using-dataflow-in-a-windows-forms-application │ │ │ │ └── dataflow-winforms-image-processing.png │ │ ├── merge-options-in-plinq.md │ │ ├── order-preservation-in-plinq.md │ │ ├── parallel-diagnostic-tools.md │ │ ├── parallel-linq-plinq.md │ │ ├── plinq-data-sample.md │ │ ├── potential-pitfalls-in-data-and-task-parallelism.md │ │ ├── potential-pitfalls-with-plinq.md │ │ ├── task-based-asynchronous-programming.md │ │ ├── task-cancellation.md │ │ ├── task-parallel-library-tpl.md │ │ ├── toc.yml │ │ ├── tpl-and-traditional-async-programming.md │ │ ├── understanding-speedup-in-plinq.md │ │ ├── using-tpl-with-other-asynchronous-patterns.md │ │ ├── walkthrough-creating-a-custom-dataflow-block-type.md │ │ ├── walkthrough-creating-a-dataflow-pipeline.md │ │ ├── walkthrough-using-batchblock-and-batchedjoinblock-to-improve-efficiency.md │ │ └── walkthrough-using-dataflow-in-a-windows-forms-application.md │ ├── security │ │ ├── creating-a-cryptographic-scheme.md │ │ ├── cryptographic-services.md │ │ ├── cryptographic-signatures.md │ │ ├── cryptography-model.md │ │ ├── decrypting-data.md │ │ ├── encrypting-data.md │ │ ├── ensuring-data-integrity-with-hash-codes.md │ │ ├── generating-keys-for-encryption-and-decryption.md │ │ ├── how-to-access-hardware-encryption-devices.md │ │ ├── how-to-create-a-windowsprincipal-object.md │ │ ├── how-to-create-genericprincipal-and-genericidentity-objects.md │ │ ├── how-to-decrypt-xml-elements-with-asymmetric-keys.md │ │ ├── how-to-decrypt-xml-elements-with-symmetric-keys.md │ │ ├── how-to-decrypt-xml-elements-with-x-509-certificates.md │ │ ├── how-to-encrypt-xml-elements-with-asymmetric-keys.md │ │ ├── how-to-encrypt-xml-elements-with-symmetric-keys.md │ │ ├── how-to-encrypt-xml-elements-with-x-509-certificates.md │ │ ├── how-to-sign-xml-documents-with-digital-signatures.md │ │ ├── how-to-store-asymmetric-keys-in-a-key-container.md │ │ ├── how-to-use-data-protection.md │ │ ├── how-to-verify-the-digital-signatures-of-xml-documents.md │ │ ├── impersonating-and-reverting.md │ │ ├── index.md │ │ ├── key-security-concepts.md │ │ ├── principal-and-identity-objects.md │ │ ├── replacing-a-principal-object.md │ │ ├── role-based-security.md │ │ ├── secure-coding-guidelines.md │ │ ├── securing-state-data.md │ │ ├── security-and-on-the-fly-code-generation.md │ │ ├── security-and-race-conditions.md │ │ ├── security-and-user-input.md │ │ ├── toc.yml │ │ ├── vulnerabilities-cbc-mode.md │ │ └── walkthrough-creating-a-cryptographic-application.md │ ├── serialization │ │ ├── add-element-for-schemaimporterextensions.md │ │ ├── attributes-that-control-encoded-soap-serialization.md │ │ ├── attributes-that-control-xml-serialization.md │ │ ├── basic-serialization-technology-sample.md │ │ ├── basic-serialization.md │ │ ├── binary-serialization.md │ │ ├── controlling-xml-serialization-using-attributes.md │ │ ├── custom-serialization-order-with-xmlserializer.md │ │ ├── custom-serialization.md │ │ ├── datetimeserialization-element.md │ │ ├── examples-of-xml-serialization.md │ │ ├── how-to-chunk-serialized-data.md │ │ ├── how-to-control-serialization-of-derived-classes.md │ │ ├── how-to-deserialize-an-object.md │ │ ├── how-to-determine-if-netstandard-object-is-serializable.md │ │ ├── how-to-override-encoded-soap-xml-serialization.md │ │ ├── how-to-qualify-xml-element-and-xml-attribute-names.md │ │ ├── how-to-serialize-an-object-as-a-soap-encoded-xml-stream.md │ │ ├── how-to-serialize-an-object.md │ │ ├── how-to-specify-an-alternate-element-name-for-an-xml-stream.md │ │ ├── index.md │ │ ├── introducing-xml-serialization.md │ │ ├── samples-binary.md │ │ ├── samples-xml.md │ │ ├── schemaimporterextension-technology-sample.md │ │ ├── schemaimporterextensions-element.md │ │ ├── selective-serialization.md │ │ ├── serialization-concepts.md │ │ ├── serialization-guidelines.md │ │ ├── serialization-how-to-topics.md │ │ ├── serialization-tools.md │ │ ├── steps-in-the-serialization-process.md │ │ ├── system-text-json-converters-how-to.md │ │ ├── system-text-json-how-to.md │ │ ├── system-text-json-overview.md │ │ ├── system-xml-serialization-element.md │ │ ├── the-xml-schema-definition-tool-and-xml-serialization.md │ │ ├── toc.yml │ │ ├── version-tolerant-serialization-technology-sample.md │ │ ├── version-tolerant-serialization.md │ │ ├── web-services-generics-serialization-technology-sample.md │ │ ├── xml-and-soap-serialization.md │ │ ├── xml-schema-def-tool-gen.md │ │ ├── xml-schema-definition-tool-xsd-exe.md │ │ ├── xml-serialization-with-xml-web-services.md │ │ ├── xml-serializer-generator-tool-sgen-exe.md │ │ └── xmlserializer-element.md │ ├── threading │ │ ├── barrier.md │ │ ├── canceling-threads-cooperatively.md │ │ ├── cancellation-in-managed-threads.md │ │ ├── countdownevent.md │ │ ├── creating-threads-and-passing-data-at-start-time.md │ │ ├── destroying-threads.md │ │ ├── eventwaithandle.md │ │ ├── exceptions-in-managed-threads.md │ │ ├── foreground-and-background-threads.md │ │ ├── how-to-enable-thread-tracking-mode-in-spinlock.md │ │ ├── how-to-listen-for-cancellation-requests-by-polling.md │ │ ├── how-to-listen-for-cancellation-requests-that-have-wait-handles.md │ │ ├── how-to-listen-for-multiple-cancellation-requests.md │ │ ├── how-to-register-callbacks-for-cancellation-requests.md │ │ ├── how-to-synchronize-concurrent-operations-with-a-barrier.md │ │ ├── how-to-use-spinlock-for-low-level-synchronization.md │ │ ├── how-to-use-spinwait-to-implement-a-two-phase-wait-operation.md │ │ ├── index.md │ │ ├── managed-and-unmanaged-threading-in-windows.md │ │ ├── managed-threading-basics.md │ │ ├── managed-threading-best-practices.md │ │ ├── media │ │ │ └── vs-cancellationtoken.png │ │ ├── mutexes.md │ │ ├── overview-of-synchronization-primitives.md │ │ ├── pausing-and-resuming-threads.md │ │ ├── scheduling-threads.md │ │ ├── semaphore-and-semaphoreslim.md │ │ ├── spinlock.md │ │ ├── spinwait.md │ │ ├── synchronizing-data-for-multithreading.md │ │ ├── the-managed-thread-pool.md │ │ ├── thread-local-storage-thread-relative-static-fields-and-data-slots.md │ │ ├── threading-objects-and-features.md │ │ ├── threads-and-threading.md │ │ ├── timers.md │ │ ├── toc.yml │ │ └── using-threads-and-threading.md │ ├── toc.yml │ ├── tour.md │ ├── using-linq.md │ └── whats-new │ │ ├── media │ │ ├── std-project-cs.png │ │ └── std-project-vb.png │ │ └── whats-new-in-dotnet-standard.md ├── toc.yml ├── visual-basic │ ├── developing-apps │ │ ├── accessing-data.md │ │ ├── creating-and-using-components.md │ │ ├── customizing-extending-my │ │ │ ├── customizing-which-objects-are-available-in-my.md │ │ │ ├── extending-the-my-namespace.md │ │ │ ├── extending-the-visual-basic-application-model.md │ │ │ ├── index.md │ │ │ ├── media │ │ │ │ └── extending-the-visual-basic-application-model │ │ │ │ │ ├── application-model-call-sequence.gif │ │ │ │ │ ├── raise-startupnextinstance-event.gif │ │ │ │ │ └── raise-unhandledexception-event.gif │ │ │ └── packaging-and-deploying-custom-my-extensions.md │ │ ├── development-with-my │ │ │ ├── default-object-instances-provided-by-my-forms-and-my-webservices.md │ │ │ ├── how-my-depends-on-project-type.md │ │ │ ├── index.md │ │ │ ├── media │ │ │ │ ├── how-my-depends-on-project-type │ │ │ │ │ ├── my-object-model-web.png │ │ │ │ │ └── my-object-model-windows-forms.png │ │ │ │ ├── index │ │ │ │ │ └── my-object-model-relationships.gif │ │ │ │ └── overview-of-the-visual-basic-application-model │ │ │ │ │ └── single-instance-application.gif │ │ │ ├── overview-of-the-visual-basic-application-model.md │ │ │ ├── performing-tasks-with-my-application-my-computer-and-my-user.md │ │ │ └── rapid-application-development-with-my-resources-and-my-settings.md │ │ ├── index.md │ │ ├── programming │ │ │ ├── accessing-application-forms.md │ │ │ ├── accessing-application-web-services.md │ │ │ ├── accessing-user-data.md │ │ │ ├── app-settings │ │ │ │ ├── how-to-change-user-settings.md │ │ │ │ ├── how-to-create-property-grids-for-user-settings.md │ │ │ │ ├── how-to-persist-user-settings.md │ │ │ │ ├── how-to-read-application-settings.md │ │ │ │ ├── index.md │ │ │ │ └── toc.yml │ │ │ ├── computer-resources │ │ │ │ ├── accessing-the-computer-s-ports.md │ │ │ │ ├── accessing-the-keyboard.md │ │ │ │ ├── accessing-the-mouse.md │ │ │ │ ├── getting-information-about-the-computer.md │ │ │ │ ├── how-to-check-connection-status.md │ │ │ │ ├── how-to-create-a-registry-key-and-set-its-value.md │ │ │ │ ├── how-to-delete-a-registry-key.md │ │ │ │ ├── how-to-dial-modems-attached-to-serial-ports.md │ │ │ │ ├── how-to-download-a-file.md │ │ │ │ ├── how-to-read-a-value-from-a-registry-key.md │ │ │ │ ├── how-to-receive-strings-from-serial-ports.md │ │ │ │ ├── how-to-send-strings-to-serial-ports.md │ │ │ │ ├── how-to-show-available-serial-ports.md │ │ │ │ ├── how-to-start-an-application-and-send-it-keystrokes.md │ │ │ │ ├── how-to-upload-a-file.md │ │ │ │ ├── index.md │ │ │ │ ├── performing-network-operations.md │ │ │ │ ├── playing-sounds.md │ │ │ │ ├── port-operations-in-the-net-framework.md │ │ │ │ ├── reading-from-and-writing-to-the-registry-using-the-microsoft-win32-namespace.md │ │ │ │ ├── reading-from-and-writing-to-the-registry.md │ │ │ │ ├── security-and-the-registry.md │ │ │ │ ├── storing-data-to-and-reading-from-the-clipboard.md │ │ │ │ └── toc.yml │ │ │ ├── drives-directories-files │ │ │ │ ├── basics-of-net-framework-file-io-and-the-file-system.md │ │ │ │ ├── classes-used-in-net-framework-file-io-and-the-file-system.md │ │ │ │ ├── creating-deleting-and-moving-files-and-directories.md │ │ │ │ ├── file-access.md │ │ │ │ ├── file-encodings.md │ │ │ │ ├── how-to-append-to-text-files.md │ │ │ │ ├── how-to-copy-a-directory-to-another-directory.md │ │ │ │ ├── how-to-copy-files-with-a-specific-pattern-to-a-directory.md │ │ │ │ ├── how-to-create-a-copy-of-a-file-in-a-different-directory.md │ │ │ │ ├── how-to-create-a-copy-of-a-file-in-the-same-directory.md │ │ │ │ ├── how-to-create-a-directory.md │ │ │ │ ├── how-to-create-a-file.md │ │ │ │ ├── how-to-delete-a-file.md │ │ │ │ ├── how-to-find-files-with-a-specific-pattern.md │ │ │ │ ├── how-to-find-subdirectories-with-a-specific-pattern.md │ │ │ │ ├── how-to-get-the-collection-of-files-in-a-directory.md │ │ │ │ ├── how-to-move-a-file.md │ │ │ │ ├── how-to-parse-file-paths.md │ │ │ │ ├── how-to-read-from-binary-files.md │ │ │ │ ├── how-to-read-from-comma-delimited-text-files.md │ │ │ │ ├── how-to-read-from-fixed-width-text-files.md │ │ │ │ ├── how-to-read-from-text-files-with-multiple-formats.md │ │ │ │ ├── how-to-read-from-text-files.md │ │ │ │ ├── how-to-read-text-from-files-with-a-streamreader.md │ │ │ │ ├── how-to-rename-a-file.md │ │ │ │ ├── how-to-retrieve-the-contents-of-the-my-documents-directory.md │ │ │ │ ├── how-to-write-text-to-files-in-the-my-documents-directory.md │ │ │ │ ├── how-to-write-text-to-files-with-a-streamwriter.md │ │ │ │ ├── how-to-write-text-to-files.md │ │ │ │ ├── how-to-write-to-binary-files.md │ │ │ │ ├── index.md │ │ │ │ ├── media │ │ │ │ │ └── basics-of-net-framework-file-io-and-the-file-system │ │ │ │ │ │ └── filestream-cursor-position.gif │ │ │ │ ├── parsing-text-files-with-the-textfieldparser-object.md │ │ │ │ ├── reading-from-files.md │ │ │ │ ├── toc.yml │ │ │ │ ├── troubleshooting-reading-from-and-writing-to-text-files.md │ │ │ │ ├── walkthrough-manipulating-files-and-directories.md │ │ │ │ ├── walkthrough-manipulating-files-by-using-net-framework-methods.md │ │ │ │ └── writing-to-files.md │ │ │ ├── how-to-call-a-web-service-asynchronously.md │ │ │ ├── index.md │ │ │ └── log-info │ │ │ │ ├── how-to-log-exceptions.md │ │ │ │ ├── how-to-log-messages-when-the-application-starts-or-shuts-down.md │ │ │ │ ├── how-to-write-event-information-to-a-text-file.md │ │ │ │ ├── how-to-write-log-messages.md │ │ │ │ ├── how-to-write-to-an-application-event-log.md │ │ │ │ ├── index.md │ │ │ │ ├── media │ │ │ │ └── working-with-application-logs │ │ │ │ │ ├── my-log-call-messages.png │ │ │ │ │ └── my-log-configuration.png │ │ │ │ ├── toc.yml │ │ │ │ ├── troubleshooting-log-listeners.md │ │ │ │ ├── walkthrough-changing-where-my-application-log-writes-information.md │ │ │ │ ├── walkthrough-creating-custom-log-listeners.md │ │ │ │ ├── walkthrough-determining-where-my-application-log-writes-information.md │ │ │ │ ├── walkthrough-filtering-my-application-log-output.md │ │ │ │ └── working-with-application-logs.md │ │ └── windows-forms │ │ │ └── index.md │ ├── getting-started │ │ ├── additional-resources.md │ │ ├── breaking-changes-in-visual-studio.md │ │ ├── index.md │ │ └── whats-new.md │ ├── index.md │ ├── language-reference │ │ ├── attributes.md │ │ ├── configure-language-version.md │ │ ├── constants-and-enumerations.md │ │ ├── data-types │ │ │ ├── boolean-data-type.md │ │ │ ├── byte-data-type.md │ │ │ ├── char-data-type.md │ │ │ ├── date-data-type.md │ │ │ ├── decimal-data-type.md │ │ │ ├── double-data-type.md │ │ │ ├── index.md │ │ │ ├── integer-data-type.md │ │ │ ├── long-data-type.md │ │ │ ├── object-data-type.md │ │ │ ├── sbyte-data-type.md │ │ │ ├── short-data-type.md │ │ │ ├── single-data-type.md │ │ │ ├── string-data-type.md │ │ │ ├── uinteger-data-type.md │ │ │ ├── ulong-data-type.md │ │ │ ├── user-defined-data-type.md │ │ │ └── ushort-data-type.md │ │ ├── directives │ │ │ ├── const-directive.md │ │ │ ├── externalsource-directive.md │ │ │ ├── if-then-else-directives.md │ │ │ ├── index.md │ │ │ └── region-directive.md │ │ ├── error-messages │ │ │ ├── a-double-quote-is-not-a-valid-comment-token-for-delimited-fields.md │ │ │ ├── a-property-or-method-call-cannot-include-a-reference-to-a-private-object.md │ │ │ ├── a-startup-form-has-not-been-specified.md │ │ │ ├── an-unexpected-error-has-occurred.md │ │ │ ├── argument-not-optional.md │ │ │ ├── attribute-attributename-cannot-be-applied-multiple-times.md │ │ │ ├── attribute-cannot-be-applied-because-the-format-of-the-guid-is-not-correct.md │ │ │ ├── automation-error.md │ │ │ ├── bad-checksum-value-non-hex-digits-or-odd-number-of-hex-digits.md │ │ │ ├── bad-dll-calling-convention.md │ │ │ ├── bad-file-mode.md │ │ │ ├── bad-file-name-or-number.md │ │ │ ├── bad-record-length.md │ │ │ ├── bc30306.md │ │ │ ├── bc30577.md │ │ │ ├── bc30638.md │ │ │ ├── bc30828.md │ │ │ ├── bc31043.md │ │ │ ├── bc32039.md │ │ │ ├── bc35000.md │ │ │ ├── bc36548.md │ │ │ ├── bc36556.md │ │ │ ├── bc40059.md │ │ │ ├── bc42025.md │ │ │ ├── bc42358.md │ │ │ ├── can-t-create-necessary-temporary-file.md │ │ │ ├── can-t-open-filename-for-writing.md │ │ │ ├── cannot-create-activex-component.md │ │ │ ├── cannot-refer-to-an-instance-member-of-a-class.md │ │ │ ├── cannot-refer-to-name-because-it-is-member-of-value-typed-field-name-of-class.md │ │ │ ├── class-classname-cannot-be-found.md │ │ │ ├── class-does-not-support-automation-or-does-not-support-expected-interface.md │ │ │ ├── class-statement-must-end-with-a-matching-end-class.md │ │ │ ├── classname-is-not-cls-compliant-because-the-interface-is-not-cls-compliant.md │ │ │ ├── clipboard-format-is-not-valid.md │ │ │ ├── constant-expression-not-representable-in-type-typename.md │ │ │ ├── constants-must-be-of-an-intrinsic-or-enumerated-type.md │ │ │ ├── constructor-name-cannot-call-itself.md │ │ │ ├── copying-the-value-of-byref-parameter-back-to-the-matching-argument-narrows.md │ │ │ ├── custom-modifier-is-not-valid-on-events-declared-without-explicit-delegate-types.md │ │ │ ├── data-type-s-of-the-type-parameter-s-cannot-be-inferred-from-these-arguments.md │ │ │ ├── declaration-expected.md │ │ │ ├── default-property-access-is-ambiguous.md │ │ │ ├── default-property-propertyname1-conflicts-with-default-property-propertyname2.md │ │ │ ├── delegate-class-classname-has-no-invoke-method.md │ │ │ ├── derived-classes-cannot-raise-base-class-events.md │ │ │ ├── device-i-o-error.md │ │ │ ├── dir-function-must-first-be-called-with-a-pathname-argument.md │ │ │ ├── elementname-is-obsolete-visual-basic-warning.md │ │ │ ├── elseif-must-be-preceded-by-a-matching-if-or-elseif.md │ │ │ ├── end-of-statement-expected.md │ │ │ ├── error-creating-assembly-manifest-error-message.md │ │ │ ├── error-creating-win32-resources-error-message.md │ │ │ ├── error-in-loading-dll.md │ │ │ ├── error-saving-temporary-win32-resource-file-filename-error-message.md │ │ │ ├── errors-occurred-while-compiling-the-xml-schemas-in-the-project.md │ │ │ ├── evaluation-of-expression-or-statement-timed-out.md │ │ │ ├── event-eventname1-cannot-implement-event-eventname2-on-interface.md │ │ │ ├── eventname-is-an-event-and-cannot-be-called-directly.md │ │ │ ├── events-cannot-be-declared-with-a-delegate-type-that-has-a-return-type.md │ │ │ ├── events-of-shared-withevents-variables-cannot-be-handled-by-non-shared-methods.md │ │ │ ├── expression-cannot-be-used-as-a-type-constraint.md │ │ │ ├── expression-does-not-produce-a-value.md │ │ │ ├── expression-has-the-type-typename-which-is-a-restricted-type.md │ │ │ ├── expression-is-a-value-and-therefore-cannot-be-the-target-of-an-assignment.md │ │ │ ├── expression-of-type-type-is-not-queryable.md │ │ │ ├── expression-recursively-calls-the-containing-property-propertyname.md │ │ │ ├── expression-too-complex.md │ │ │ ├── extension-attribute-can-be-applied-only-to-module-sub-or-function-declarations.md │ │ │ ├── file-already-open.md │ │ │ ├── file-is-too-large-to-read-into-a-byte-array.md │ │ │ ├── file-name-or-class-name-not-found-during-automation-operation.md │ │ │ ├── file-not-found-visual-basic-run-time-error.md │ │ │ ├── first-operand-in-a-binary-if-expression-must-be-nullable-or-a-reference-type.md │ │ │ ├── first-statement-of-sub-new-must-be-explicit-call-to-mybase-new-or-myclass-new.md │ │ │ ├── first-statement-of-this-sub-new-must-be-a-call-to-mybase-new-or-myclass-new.md │ │ │ ├── for-each-on-type-typename-is-ambiguous.md │ │ │ ├── friend-assembly-reference-reference-is-invalid.md │ │ │ ├── function-evaluation-is-disabled.md │ │ │ ├── function-procedurename-doesn-t-return-a-value-on-all-code-paths.md │ │ │ ├── functionname-is-not-declared-smart-device-visual-basic-compiler-error.md │ │ │ ├── generic-parameters-used-as-optional-parameter-types-must-be-class-constrained.md │ │ │ ├── get-accessor-of-property-propertyname-is-not-accessible.md │ │ │ ├── handles-clause-requires-a-withevents-variable-defined.md │ │ │ ├── identifier-expected.md │ │ │ ├── identifier-is-too-long.md │ │ │ ├── implicit-conversion-from-typename1-to-typename2-in-copying.md │ │ │ ├── index.md │ │ │ ├── initializer-expected.md │ │ │ ├── input-past-end-of-file.md │ │ │ ├── interfacename-membername-is-already-implemented-by-the-base-class.md │ │ │ ├── internal-error-happened-at-location.md │ │ │ ├── is-requires-operands-that-have-reference-types.md │ │ │ ├── isnot-operand-of-type-can-only-be-compared-to-nothing.md │ │ │ ├── keyword-is-valid-only-within-an-instance-method.md │ │ │ ├── labels-that-are-numbers-must-be-followed-by-colons.md │ │ │ ├── lambda-expression-will-not-be-removed-from-this-event-handler.md │ │ │ ├── lambda-expressions-are-not-valid-in-the-first-expression-of-select-case.md │ │ │ ├── late-bound-resolution;-runtime-errors-could-occur.md │ │ │ ├── latebound-overload-resolution-cannot-be-applied.md │ │ │ ├── leading-period-or-exclamation-point-can-only-appear-inside-a-with-statement.md │ │ │ ├── line-is-too-long.md │ │ │ ├── line-statements-are-no-longer-supported-visual-basic-compiler-error.md │ │ │ ├── membername-cannot-expose-type-typename-outside-the-project.md │ │ │ ├── membername-is-ambiguous-across-the-inherited-interfaces.md │ │ │ ├── message-this-error-could-also-be-due-to-mixing-a-file-reference.md │ │ │ ├── method-does-not-have-a-signature-compatible-with-the-delegate.md │ │ │ ├── methodname-has-multiple-definitions-with-identical-signatures.md │ │ │ ├── methods-of-system-nullable-of-t-cannot-be-used-as-operands-of-the-addressof.md │ │ │ ├── module-statements-can-occur-only-at-file-or-namespace-level.md │ │ │ ├── name-is-ambiguous-in-the-namespace-namespacename.md │ │ │ ├── name-membername-is-not-cls-compliant.md │ │ │ ├── name-name-is-not-declared.md │ │ │ ├── name-namespacename-in-the-root-namespace-fullnamespacename-is-not-cls-compliant.md │ │ │ ├── name1-is-ambiguous-imported-from-the-namespaces-or-types-name2.md │ │ │ ├── namespace-or-type-specified-in-the-imports-qualifiedelementname.md │ │ │ ├── namespace-or-type-specified-in-the-project-level-imports-qualifiedelementname.md │ │ │ ├── need-property-array-index.md │ │ │ ├── nested-function-does-not-have-a-signature-that-is-compatible-with-delegate.md │ │ │ ├── no-accessible-main-method-with-an-appropriate-signature-was-found-in-name.md │ │ │ ├── non-cls-compliant-membername-is-not-allowed-in-a-cls-compliant-interface.md │ │ │ ├── nullable-type-inference-is-not-supported-in-this-context.md │ │ │ ├── number-of-indices-exceeds-the-number-of-dimensions-of-the-indexed-array.md │ │ │ ├── object-or-class-does-not-support-the-set-of-events.md │ │ │ ├── object-required.md │ │ │ ├── object-variable-or-with-block-variable-not-set.md │ │ │ ├── operator-declaration-must-be-one-of.md │ │ │ ├── optional-expected.md │ │ │ ├── optional-parameters-must-specify-a-default-value.md │ │ │ ├── ordinal-is-not-valid.md │ │ │ ├── out-of-memory-visual-basic-compiler-error.md │ │ │ ├── out-of-stack-space.md │ │ │ ├── out-of-string-space.md │ │ │ ├── overflow-visual-basic-error.md │ │ │ ├── overflow-visual-basic-run-time-error.md │ │ │ ├── path-file-access-error.md │ │ │ ├── path-not-found.md │ │ │ ├── permission-denied.md │ │ │ ├── procedure-call-or-argument-is-not-valid.md │ │ │ ├── proceduresignature1-not-cls-compliant-because-it-overloads-proceduresignature2.md │ │ │ ├── property-array-index-is-not-valid.md │ │ │ ├── property-let-procedure-not-defined-and-property-get-procedure-did-not-return.md │ │ │ ├── property-not-found.md │ │ │ ├── property-or-method-not-found.md │ │ │ ├── property-propertyname-doesn-t-return-a-value-on-all-code-paths.md │ │ │ ├── range-variable-name-can-be-inferred.md │ │ │ ├── range-variable-variable-hides-a-variable-in-an-enclosing-block.md │ │ │ ├── reference-required-to-assembly-assemblyname-containing-the-base-class-classname.md │ │ │ ├── reference-required-to-assembly-containing-type-but-suitable-reference-not-found.md │ │ │ ├── region-and-end-region-are-not-valid-within-method-bodies-multiline-lambdas.md │ │ │ ├── resume-without-error.md │ │ │ ├── return-type-of-function-procedurename-is-not-cls-compliant.md │ │ │ ├── set-accessor-of-property-propertyname-is-not-accessible.md │ │ │ ├── some-subkeys-cannot-be-deleted.md │ │ │ ├── statement-cannot-end-a-block-outside-of-a-line-if-statement.md │ │ │ ├── statement-is-not-valid-in-a-namespace.md │ │ │ ├── statement-is-not-valid-inside-a-method-multiline-lambda.md │ │ │ ├── string-constants-must-end-with-a-double-quote.md │ │ │ ├── structure-structurename-must-contain.md │ │ │ ├── sub-main-was-not-found-in-name.md │ │ │ ├── sub-or-function-not-defined.md │ │ │ ├── subscript-out-of-range.md │ │ │ ├── textfieldparser-is-unable-to-complete-read-operation.md │ │ │ ├── the-type-for-variable-variablename-will-not-be-inferred.md │ │ │ ├── this-array-is-fixed-or-temporarily-locked.md │ │ │ ├── this-key-is-already-associated-with-an-element-of-this-collection.md │ │ │ ├── too-many-files.md │ │ │ ├── type-arguments-could-not-be-inferred-from-the-delegate.md │ │ │ ├── type-mismatch.md │ │ │ ├── type-of-member-membername-is-not-cls-compliant.md │ │ │ ├── type-of-optional-value-for-optional-parameter-is-not-cls-compliant.md │ │ │ ├── type-of-parameter-parametername-is-not-cls-compliant.md │ │ │ ├── type-of-variablename-cannot-be-inferred.md │ │ │ ├── type-parameters-cannot-be-used-as-qualifiers.md │ │ │ ├── type-typename-has-no-constructors.md │ │ │ ├── type-typename-is-not-cls-compliant.md │ │ │ ├── type-typename-is-not-defined.md │ │ │ ├── type1-must-implement-membername-for-interface.md │ │ │ ├── type1-typename-must-implement-methodname-for-interface-interfacename.md │ │ │ ├── typename-cannot-inherit-from-type-basetypename.md │ │ │ ├── typename-is-a-delegate-type.md │ │ │ ├── typename-is-a-type-and-cannot-be-used-as-an-expression.md │ │ │ ├── unable-to-create-strong-named-assembly-from-key-file-filename-error.md │ │ │ ├── unable-to-embed-resource-file-filename-error-message.md │ │ │ ├── unable-to-emit-assembly-error-message.md │ │ │ ├── unable-to-find-required-file-filename.md │ │ │ ├── unable-to-get-serial-port-names-because-of-an-internal-system-error.md │ │ │ ├── unable-to-link-to-resource-file-filename-error-message.md │ │ │ ├── unable-to-load-information-for-class-classname.md │ │ │ ├── unable-to-write-output-to-memory.md │ │ │ ├── unable-to-write-temporary-file-because-temporary-path-is-not-available.md │ │ │ ├── unable-to-write-to-output-file-filename-error.md │ │ │ ├── underlying-type-typename-of-enum-is-not-cls-compliant.md │ │ │ ├── using-the-iteration-variable-in-a-lambda-expression-may-have-unexpected-results.md │ │ │ ├── value-of-type-type1-cannot-be-converted-to-type2.md │ │ │ ├── value-of-type-typename1-cannot-be-converted-to-typename2-multiple.md │ │ │ ├── value-of-type-typename1-cannot-be-converted-to-typename2.md │ │ │ ├── variable-uses-an-automation-type-not-supported.md │ │ │ ├── variable-variablename-hides-a-variable-in-an-enclosing-block.md │ │ │ ├── variable-variablename-is-used-before-it-has-been-assigned-a-value.md │ │ │ ├── xml-axis-properties-do-not-support-late-binding.md │ │ │ ├── xml-comment-exception-must-have-a-cref-attribute.md │ │ │ ├── xml-entity-references-are-not-supported.md │ │ │ ├── xml-literals-and-xml-properties-are-not-supported-in-embedded-code-in-aspnet.md │ │ │ └── xml-namespace-uri-uri-can-be-bound-only-to-xmlns.md │ │ ├── functions │ │ │ ├── conversion-functions.md │ │ │ ├── ctype-function.md │ │ │ ├── index.md │ │ │ ├── math-functions.md │ │ │ ├── return-values-for-the-cstr-function.md │ │ │ ├── string-functions.md │ │ │ └── type-conversion-functions.md │ │ ├── index.md │ │ ├── keywords │ │ │ ├── arrays-summary.md │ │ │ ├── collection-object-summary.md │ │ │ ├── control-flow-summary.md │ │ │ ├── conversion-summary.md │ │ │ ├── data-types-summary.md │ │ │ ├── dates-and-times-summary.md │ │ │ ├── declarations-and-constants-summary.md │ │ │ ├── derived-math-functions.md │ │ │ ├── directories-and-files-summary.md │ │ │ ├── errors-summary.md │ │ │ ├── financial-summary.md │ │ │ ├── index.md │ │ │ ├── information-and-interaction-summary.md │ │ │ ├── input-and-output-summary.md │ │ │ ├── math-summary.md │ │ │ ├── my-reference.md │ │ │ ├── operators-summary.md │ │ │ ├── registry-summary.md │ │ │ └── string-manipulation-summary.md │ │ ├── modifiers │ │ │ ├── ansi.md │ │ │ ├── assembly.md │ │ │ ├── async.md │ │ │ ├── auto.md │ │ │ ├── byref.md │ │ │ ├── byval.md │ │ │ ├── default.md │ │ │ ├── friend.md │ │ │ ├── in-generic-modifier.md │ │ │ ├── index.md │ │ │ ├── iterator.md │ │ │ ├── key.md │ │ │ ├── module-keyword.md │ │ │ ├── mustinherit.md │ │ │ ├── mustoverride.md │ │ │ ├── narrowing.md │ │ │ ├── notinheritable.md │ │ │ ├── notoverridable.md │ │ │ ├── optional.md │ │ │ ├── out-generic-modifier.md │ │ │ ├── overloads.md │ │ │ ├── overridable.md │ │ │ ├── overrides.md │ │ │ ├── paramarray.md │ │ │ ├── partial.md │ │ │ ├── private-protected.md │ │ │ ├── private.md │ │ │ ├── protected-friend.md │ │ │ ├── protected.md │ │ │ ├── public.md │ │ │ ├── readonly.md │ │ │ ├── shadows.md │ │ │ ├── shared.md │ │ │ ├── static.md │ │ │ ├── unicode.md │ │ │ ├── widening.md │ │ │ ├── withevents.md │ │ │ └── writeonly.md │ │ ├── modules.md │ │ ├── nothing.md │ │ ├── objects │ │ │ ├── index.md │ │ │ ├── my-application-info-object.md │ │ │ ├── my-application-log-object.md │ │ │ ├── my-application-object.md │ │ │ ├── my-computer-audio-object.md │ │ │ ├── my-computer-clipboard-object.md │ │ │ ├── my-computer-clock-object.md │ │ │ ├── my-computer-filesystem-object.md │ │ │ ├── my-computer-filesystem-specialdirectories-object.md │ │ │ ├── my-computer-info-object.md │ │ │ ├── my-computer-keyboard-object.md │ │ │ ├── my-computer-mouse-object.md │ │ │ ├── my-computer-network-object.md │ │ │ ├── my-computer-object.md │ │ │ ├── my-computer-ports-object.md │ │ │ ├── my-computer-registry-object.md │ │ │ ├── my-forms-object.md │ │ │ ├── my-log-object.md │ │ │ ├── my-request-object.md │ │ │ ├── my-resources-object.md │ │ │ ├── my-response-object.md │ │ │ ├── my-settings-object.md │ │ │ ├── my-user-object.md │ │ │ ├── my-webservices-object.md │ │ │ └── textfieldparser-object.md │ │ ├── operators │ │ │ ├── addition-assignment-operator.md │ │ │ ├── addition-operator.md │ │ │ ├── addressof-operator.md │ │ │ ├── and-assignment-operator.md │ │ │ ├── and-operator.md │ │ │ ├── andalso-operator.md │ │ │ ├── arithmetic-operators.md │ │ │ ├── assignment-operator.md │ │ │ ├── assignment-operators.md │ │ │ ├── await-operator.md │ │ │ ├── bit-shift-operators.md │ │ │ ├── comparison-operators.md │ │ │ ├── concatenation-operator.md │ │ │ ├── concatenation-operators.md │ │ │ ├── data-types-of-operator-results.md │ │ │ ├── directcast-operator.md │ │ │ ├── exponentiation-assignment-operator.md │ │ │ ├── exponentiation-operator.md │ │ │ ├── floating-point-division-assignment-operator.md │ │ │ ├── floating-point-division-operator.md │ │ │ ├── function-expression.md │ │ │ ├── gettype-operator.md │ │ │ ├── getxmlnamespace-operator.md │ │ │ ├── if-operator.md │ │ │ ├── index.md │ │ │ ├── integer-division-assignment-operator.md │ │ │ ├── integer-division-operator.md │ │ │ ├── is-operator.md │ │ │ ├── isfalse-operator.md │ │ │ ├── isnot-operator.md │ │ │ ├── istrue-operator.md │ │ │ ├── left-shift-assignment-operator.md │ │ │ ├── left-shift-operator.md │ │ │ ├── like-operator.md │ │ │ ├── logical-bitwise-operators.md │ │ │ ├── miscellaneous-operators.md │ │ │ ├── mod-operator.md │ │ │ ├── multiplication-assignment-operator.md │ │ │ ├── multiplication-operator.md │ │ │ ├── nameof.md │ │ │ ├── new-operator.md │ │ │ ├── not-operator.md │ │ │ ├── null-conditional-operators.md │ │ │ ├── operator-precedence.md │ │ │ ├── operators-listed-by-functionality.md │ │ │ ├── or-operator.md │ │ │ ├── orelse-operator.md │ │ │ ├── right-shift-assignment-operator.md │ │ │ ├── right-shift-operator.md │ │ │ ├── sub-expression.md │ │ │ ├── subtraction-assignment-operator.md │ │ │ ├── subtraction-operator.md │ │ │ ├── trycast-operator.md │ │ │ ├── typeof-operator.md │ │ │ └── xor-operator.md │ │ ├── properties.md │ │ ├── queries │ │ │ ├── aggregate-clause.md │ │ │ ├── distinct-clause.md │ │ │ ├── equals-clause.md │ │ │ ├── from-clause.md │ │ │ ├── group-by-clause.md │ │ │ ├── group-join-clause.md │ │ │ ├── index.md │ │ │ ├── join-clause.md │ │ │ ├── let-clause.md │ │ │ ├── order-by-clause.md │ │ │ ├── select-clause.md │ │ │ ├── skip-clause.md │ │ │ ├── skip-while-clause.md │ │ │ ├── take-clause.md │ │ │ ├── take-while-clause.md │ │ │ └── where-clause.md │ │ ├── runtime-library-members.md │ │ ├── special-characters │ │ │ ├── index.md │ │ │ ├── interpolated.md │ │ │ └── toc.yml │ │ ├── statements │ │ │ ├── a-e-statements.md │ │ │ ├── addhandler-statement.md │ │ │ ├── alias-clause.md │ │ │ ├── as-clause.md │ │ │ ├── attribute-list.md │ │ │ ├── call-statement.md │ │ │ ├── class-statement.md │ │ │ ├── clauses.md │ │ │ ├── const-statement.md │ │ │ ├── continue-statement.md │ │ │ ├── declaration-contexts-and-default-access-levels.md │ │ │ ├── declare-statement.md │ │ │ ├── delegate-statement.md │ │ │ ├── dim-statement.md │ │ │ ├── do-loop-statement.md │ │ │ ├── else-statement.md │ │ │ ├── end-keyword-statement.md │ │ │ ├── end-statement.md │ │ │ ├── enum-statement.md │ │ │ ├── erase-statement.md │ │ │ ├── error-statement.md │ │ │ ├── event-statement.md │ │ │ ├── exit-statement.md │ │ │ ├── f-p-statements.md │ │ │ ├── for-each-next-statement.md │ │ │ ├── for-next-statement.md │ │ │ ├── function-statement.md │ │ │ ├── get-statement.md │ │ │ ├── goto-statement.md │ │ │ ├── handles-clause.md │ │ │ ├── if-then-else-statement.md │ │ │ ├── implements-clause.md │ │ │ ├── implements-statement.md │ │ │ ├── imports-statement-net-namespace-and-type.md │ │ │ ├── imports-statement-xml-namespace.md │ │ │ ├── in-clause.md │ │ │ ├── index.md │ │ │ ├── inherits-statement.md │ │ │ ├── interface-statement.md │ │ │ ├── into-clause.md │ │ │ ├── media │ │ │ │ ├── goto-statement │ │ │ │ │ └── try-construction-branching.gif │ │ │ │ └── option-infer-statement │ │ │ │ │ ├── option-infer-as-integer-on.png │ │ │ │ │ └── option-infer-as-object-off.png │ │ │ ├── mid-statement.md │ │ │ ├── module-statement.md │ │ │ ├── namespace-statement.md │ │ │ ├── of-clause.md │ │ │ ├── on-error-statement.md │ │ │ ├── operator-statement.md │ │ │ ├── option-compare-statement.md │ │ │ ├── option-explicit-statement.md │ │ │ ├── option-infer-statement.md │ │ │ ├── option-keyword-statement.md │ │ │ ├── option-strict-statement.md │ │ │ ├── parameter-list.md │ │ │ ├── property-statement.md │ │ │ ├── q-z-statements.md │ │ │ ├── raiseevent-statement.md │ │ │ ├── redim-statement.md │ │ │ ├── rem-statement.md │ │ │ ├── removehandler-statement.md │ │ │ ├── resume-statement.md │ │ │ ├── return-statement.md │ │ │ ├── select-case-statement.md │ │ │ ├── set-statement.md │ │ │ ├── stop-statement.md │ │ │ ├── structure-statement.md │ │ │ ├── sub-statement.md │ │ │ ├── synclock-statement.md │ │ │ ├── then-statement.md │ │ │ ├── throw-statement.md │ │ │ ├── try-catch-finally-statement.md │ │ │ ├── type-list.md │ │ │ ├── using-statement.md │ │ │ ├── while-end-while-statement.md │ │ │ ├── with-end-with-statement.md │ │ │ └── yield-statement.md │ │ ├── typographic-and-code-conventions.md │ │ ├── xml-axis │ │ │ ├── extension-indexer-property.md │ │ │ ├── index.md │ │ │ ├── xml-attribute-axis-property.md │ │ │ ├── xml-child-axis-property.md │ │ │ ├── xml-descendant-axis-property.md │ │ │ └── xml-value-property.md │ │ ├── xml-literals │ │ │ ├── index.md │ │ │ ├── xml-cdata-literal.md │ │ │ ├── xml-comment-literal.md │ │ │ ├── xml-document-literal.md │ │ │ ├── xml-element-literal.md │ │ │ └── xml-processing-instruction-literal.md │ │ └── xmldoc │ │ │ ├── c.md │ │ │ ├── code.md │ │ │ ├── example.md │ │ │ ├── exception.md │ │ │ ├── include.md │ │ │ ├── index.md │ │ │ ├── list.md │ │ │ ├── para.md │ │ │ ├── param.md │ │ │ ├── paramref.md │ │ │ ├── permission.md │ │ │ ├── remarks.md │ │ │ ├── returns.md │ │ │ ├── see.md │ │ │ ├── seealso.md │ │ │ ├── summary.md │ │ │ ├── typeparam.md │ │ │ └── value.md │ ├── misc │ │ ├── a-delimiter-cannot-be-nothing-or-an-empty-string.md │ │ ├── a-log-has-already-been-created-with-this-name-on-this-machine.md │ │ ├── access-denied-to-name.md │ │ ├── add-failed-duplicate-key-value-supplied.md │ │ ├── address-is-not-a-valid-remote-file-address.md │ │ ├── all-field-widths-except-the-last-element-must-be-greater-than-zero.md │ │ ├── an-invalid-name-was-specified-for-the-event-log.md │ │ ├── another-event-log-has-already-registered-a-source-with-this-name.md │ │ ├── application-defined-or-object-defined-error.md │ │ ├── argument-access-is-not-valid-append-mode.md │ │ ├── argument-access-is-not-valid-input-mode.md │ │ ├── argument-access-is-not-valid.md │ │ ├── argument-argument1-must-be-less-than-or-equal-to-the-length-of-argument2.md │ │ ├── argument-argumentname-cannot-be-a-multidimensional-array.md │ │ ├── argument-argumentname-cannot-be-an-empty-string-or-nothing.md │ │ ├── argument-argumentname-cannot-be-converted-to-a-numeric-value.md │ │ ├── argument-argumentname-cannot-be-converted-to-type-date.md │ │ ├── argument-argumentname-cannot-be-converted-to-type-typename.md │ │ ├── argument-argumentname-is-not-a-valid-value.md │ │ ├── argument-argumentname-is-not-valid-for-the-array.md │ │ ├── argument-argumentname-is-nothing-or-empty.md │ │ ├── argument-argumentname-is-nothing.md │ │ ├── argument-argumentname-must-be-greater-than-0-or-equal-to-1.md │ │ ├── argument-argumentname-must-be-greater-than-or-equal-to-1-1.md │ │ ├── argument-argumentname-must-be-greater-than-or-equal-to-1.md │ │ ├── argument-argumentname-must-be-greater-than-or-equal-to-zero-1.md │ │ ├── argument-argumentname-must-be-greater-than-or-equal-to-zero.md │ │ ├── argument-argumentname-must-be-greater-than-zero.md │ │ ├── argument-argumentname-must-be-in-the-range-of-32768-to-65535.md │ │ ├── argument-argumentname-must-be-within-the-range-0-to-99.md │ │ ├── argument-argumentname-must-be-within-the-range-1-to-255.md │ │ ├── argument-argumentname1-must-be-less-than-or-equal-the-length-of-argumentname2.md │ │ ├── argument-basepath-must-be-a-path-to-a-folder.md │ │ ├── argument-cannot-be-an-empty-string.md │ │ ├── argument-cannot-be-less-than-zero.md │ │ ├── argument-cannot-be-nothing.md │ │ ├── argument-conversion-is-not-valid.md │ │ ├── argument-life-cannot-be-zero.md │ │ ├── argument-nper-must-be-greater-than-zero.md │ │ ├── argument-path-is-nothing-or-empty.md │ │ ├── argument-per-is-not-valid.md │ │ ├── argument-period-must-be-less-than-or-equal-to-argument-life.md │ │ ├── argument-value-pathname-contains-characters-that-are-not-valid-in-a-path-name.md │ │ ├── arguments-are-not-valid.md │ │ ├── array-dimensions-do-not-match-those-specified-in-the-vbfixedarray-attribute.md │ │ ├── automation-object-does-not-have-a-default-value.md │ │ ├── bad-record-number.md │ │ ├── baselogname-cannot-be-nothing-or-an-empty-string.md │ │ ├── baudrate-must-be-greater-than-0.md │ │ ├── bc2000.md │ │ ├── bc2001.md │ │ ├── bc2002.md │ │ ├── bc2003.md │ │ ├── bc2006.md │ │ ├── bc2007.md │ │ ├── bc2008.md │ │ ├── bc2009.md │ │ ├── bc2010.md │ │ ├── bc2011.md │ │ ├── bc2014.md │ │ ├── bc2015.md │ │ ├── bc2016.md │ │ ├── bc2017.md │ │ ├── bc2020.md │ │ ├── bc2023.md │ │ ├── bc2024.md │ │ ├── bc2025.md │ │ ├── bc2026.md │ │ ├── bc2027.md │ │ ├── bc2028.md │ │ ├── bc2030.md │ │ ├── bc2033.md │ │ ├── bc2034.md │ │ ├── bc30003.md │ │ ├── bc30004.md │ │ ├── bc30005.md │ │ ├── bc30006.md │ │ ├── bc30008.md │ │ ├── bc30009.md │ │ ├── bc30010.md │ │ ├── bc30011.md │ │ ├── bc30012.md │ │ ├── bc30013.md │ │ ├── bc30015.md │ │ ├── bc30016.md │ │ ├── bc30018.md │ │ ├── bc30019.md │ │ ├── bc30021.md │ │ ├── bc30022.md │ │ ├── bc30023.md │ │ ├── bc30025.md │ │ ├── bc30026.md │ │ ├── bc30027.md │ │ ├── bc30028.md │ │ ├── bc30030.md │ │ ├── bc30031.md │ │ ├── bc30032.md │ │ ├── bc30034.md │ │ ├── bc30035.md │ │ ├── bc30037.md │ │ ├── bc30038.md │ │ ├── bc30039.md │ │ ├── bc30040.md │ │ ├── bc30041.md │ │ ├── bc30044.md │ │ ├── bc30045.md │ │ ├── bc30046.md │ │ ├── bc30049.md │ │ ├── bc30050.md │ │ ├── bc30051.md │ │ ├── bc30052.md │ │ ├── bc30053.md │ │ ├── bc30057.md │ │ ├── bc30058.md │ │ ├── bc30059.md │ │ ├── bc30060.md │ │ ├── bc30062.md │ │ ├── bc30064.md │ │ ├── bc30065.md │ │ ├── bc30066.md │ │ ├── bc30067.md │ │ ├── bc30069.md │ │ ├── bc30070.md │ │ ├── bc30071.md │ │ ├── bc30072.md │ │ ├── bc30074.md │ │ ├── bc30075.md │ │ ├── bc30081.md │ │ ├── bc30082.md │ │ ├── bc30083.md │ │ ├── bc30084.md │ │ ├── bc30085.md │ │ ├── bc30086.md │ │ ├── bc30087.md │ │ ├── bc30088.md │ │ ├── bc30089.md │ │ ├── bc30090.md │ │ ├── bc30091.md │ │ ├── bc30092.md │ │ ├── bc30093.md │ │ ├── bc30094.md │ │ ├── bc30095.md │ │ ├── bc30096.md │ │ ├── bc30097.md │ │ ├── bc30098.md │ │ ├── bc30099.md │ │ ├── bc30101.md │ │ ├── bc30103.md │ │ ├── bc30105.md │ │ ├── bc30107.md │ │ ├── bc30109.md │ │ ├── bc30110.md │ │ ├── bc30111.md │ │ ├── bc30112.md │ │ ├── bc30113.md │ │ ├── bc30114.md │ │ ├── bc30121.md │ │ ├── bc30122.md │ │ ├── bc30123.md │ │ ├── bc30124.md │ │ ├── bc30125.md │ │ ├── bc30126.md │ │ ├── bc30127.md │ │ ├── bc30128.md │ │ ├── bc30129.md │ │ ├── bc30130.md │ │ ├── bc30131.md │ │ ├── bc30132.md │ │ ├── bc30133.md │ │ ├── bc30134.md │ │ ├── bc30135.md │ │ ├── bc30138.md │ │ ├── bc30139.md │ │ ├── bc30141.md │ │ ├── bc30142.md │ │ ├── bc30146.md │ │ ├── bc30147.md │ │ ├── bc30166.md │ │ ├── bc30175.md │ │ ├── bc30176.md │ │ ├── bc30177.md │ │ ├── bc30178.md │ │ ├── bc30179.md │ │ ├── bc30180.md │ │ ├── bc30181.md │ │ ├── bc30182.md │ │ ├── bc30183.md │ │ ├── bc30184.md │ │ ├── bc30185.md │ │ ├── bc30186.md │ │ ├── bc30192.md │ │ ├── bc30193.md │ │ ├── bc30195.md │ │ ├── bc30196.md │ │ ├── bc30197.md │ │ ├── bc30198.md │ │ ├── bc30199.md │ │ ├── bc30200.md │ │ ├── bc30201.md │ │ ├── bc30204.md │ │ ├── bc30206.md │ │ ├── bc30207.md │ │ ├── bc30208.md │ │ ├── bc30209.md │ │ ├── bc30210.md │ │ ├── bc30211.md │ │ ├── bc30213.md │ │ ├── bc30215.md │ │ ├── bc30217.md │ │ ├── bc30218.md │ │ ├── bc30224.md │ │ ├── bc30225.md │ │ ├── bc30230.md │ │ ├── bc30231.md │ │ ├── bc30232.md │ │ ├── bc30233.md │ │ ├── bc30234.md │ │ ├── bc30235.md │ │ ├── bc30237.md │ │ ├── bc30238.md │ │ ├── bc30239.md │ │ ├── bc30240.md │ │ ├── bc30241.md │ │ ├── bc30242.md │ │ ├── bc30243.md │ │ ├── bc30244.md │ │ ├── bc30246.md │ │ ├── bc30247.md │ │ ├── bc30248.md │ │ ├── bc30249.md │ │ ├── bc30252.md │ │ ├── bc30253.md │ │ ├── bc30256.md │ │ ├── bc30257.md │ │ ├── bc30258.md │ │ ├── bc30260.md │ │ ├── bc30266.md │ │ ├── bc30267.md │ │ ├── bc30268.md │ │ ├── bc30270.md │ │ ├── bc30272.md │ │ ├── bc30273.md │ │ ├── bc30274.md │ │ ├── bc30275.md │ │ ├── bc30277.md │ │ ├── bc30278.md │ │ ├── bc30280.md │ │ ├── bc30281.md │ │ ├── bc30282.md │ │ ├── bc30283.md │ │ ├── bc30284.md │ │ ├── bc30287.md │ │ ├── bc30288.md │ │ ├── bc30289.md │ │ ├── bc30290.md │ │ ├── bc30293.md │ │ ├── bc30294.md │ │ ├── bc30296.md │ │ ├── bc30297.md │ │ ├── bc30299.md │ │ ├── bc30300.md │ │ ├── bc30301.md │ │ ├── bc30302.md │ │ ├── bc30303.md │ │ ├── bc30305.md │ │ ├── bc30307.md │ │ ├── bc30308.md │ │ ├── bc30311.md │ │ ├── bc30321.md │ │ ├── bc30332.md │ │ ├── bc30333.md │ │ ├── bc30337.md │ │ ├── bc30345.md │ │ ├── bc30354.md │ │ ├── bc30357.md │ │ ├── bc30359.md │ │ ├── bc30360.md │ │ ├── bc30361.md │ │ ├── bc30362.md │ │ ├── bc30363.md │ │ ├── bc30364.md │ │ ├── bc30366.md │ │ ├── bc30367.md │ │ ├── bc30368.md │ │ ├── bc30370.md │ │ ├── bc30371.md │ │ ├── bc30375.md │ │ ├── bc30376.md │ │ ├── bc30377.md │ │ ├── bc30379.md │ │ ├── bc30380.md │ │ ├── bc30381.md │ │ ├── bc30382.md │ │ ├── bc30383.md │ │ ├── bc30384.md │ │ ├── bc30385.md │ │ ├── bc30387.md │ │ ├── bc30389.md │ │ ├── bc30390.md │ │ ├── bc30392.md │ │ ├── bc30393.md │ │ ├── bc30395.md │ │ ├── bc30396.md │ │ ├── bc30397.md │ │ ├── bc30398.md │ │ ├── bc30399.md │ │ ├── bc30401.md │ │ ├── bc30408.md │ │ ├── bc30412.md │ │ ├── bc30413.md │ │ ├── bc30414.md │ │ ├── bc30415.md │ │ ├── bc30423.md │ │ ├── bc30429.md │ │ ├── bc30430.md │ │ ├── bc30431.md │ │ ├── bc30433.md │ │ ├── bc30434.md │ │ ├── bc30435.md │ │ ├── bc30436.md │ │ ├── bc30437.md │ │ ├── bc30438.md │ │ ├── bc30441.md │ │ ├── bc30442.md │ │ ├── bc30443.md │ │ ├── bc30444.md │ │ ├── bc30445.md │ │ ├── bc30452.md │ │ ├── bc30454.md │ │ ├── bc30455.md │ │ ├── bc30456.md │ │ ├── bc30458.md │ │ ├── bc30460.md │ │ ├── bc30461.md │ │ ├── bc30465.md │ │ ├── bc30467.md │ │ ├── bc30468.md │ │ ├── bc30469.md │ │ ├── bc30470.md │ │ ├── bc30471.md │ │ ├── bc30474.md │ │ ├── bc30476.md │ │ ├── bc30479.md │ │ ├── bc30480.md │ │ ├── bc30487.md │ │ ├── bc30490.md │ │ ├── bc30493.md │ │ ├── bc30495.md │ │ ├── bc30497.md │ │ ├── bc30500.md │ │ ├── bc30501.md │ │ ├── bc30502.md │ │ ├── bc30503.md │ │ ├── bc30504.md │ │ ├── bc30505.md │ │ ├── bc30508.md │ │ ├── bc30509.md │ │ ├── bc30512.md │ │ ├── bc30516.md │ │ ├── bc30517.md │ │ ├── bc30518.md │ │ ├── bc30519.md │ │ ├── bc30520.md │ │ ├── bc30521.md │ │ ├── bc30524.md │ │ ├── bc30526.md │ │ ├── bc30529.md │ │ ├── bc30530.md │ │ ├── bc30532.md │ │ ├── bc30533.md │ │ ├── bc30542.md │ │ ├── bc30544.md │ │ ├── bc30545.md │ │ ├── bc30547.md │ │ ├── bc30548.md │ │ ├── bc30549.md │ │ ├── bc30550.md │ │ ├── bc30554.md │ │ ├── bc30555.md │ │ ├── bc30562.md │ │ ├── bc30563.md │ │ ├── bc30565.md │ │ ├── bc30566.md │ │ ├── bc30567.md │ │ ├── bc30568.md │ │ ├── bc30569.md │ │ ├── bc30572.md │ │ ├── bc30573.md │ │ ├── bc30574.md │ │ ├── bc30576.md │ │ ├── bc30578.md │ │ ├── bc30579.md │ │ ├── bc30580.md │ │ ├── bc30581.md │ │ ├── bc30582.md │ │ ├── bc30583.md │ │ ├── bc30584.md │ │ ├── bc30585.md │ │ ├── bc30587.md │ │ ├── bc30588.md │ │ ├── bc30590.md │ │ ├── bc30591.md │ │ ├── bc30593.md │ │ ├── bc30600.md │ │ ├── bc30601.md │ │ ├── bc30602.md │ │ ├── bc30603.md │ │ ├── bc30604.md │ │ ├── bc30607.md │ │ ├── bc30610.md │ │ ├── bc30611.md │ │ ├── bc30614.md │ │ ├── bc30615.md │ │ ├── bc30618.md │ │ ├── bc30619.md │ │ ├── bc30620.md │ │ ├── bc30621.md │ │ ├── bc30622.md │ │ ├── bc30623.md │ │ ├── bc30624.md │ │ ├── bc30625.md │ │ ├── bc30626.md │ │ ├── bc30627.md │ │ ├── bc30628.md │ │ ├── bc30629.md │ │ ├── bc30630.md │ │ ├── bc30631.md │ │ ├── bc30632.md │ │ ├── bc30633.md │ │ ├── bc30634.md │ │ ├── bc30635.md │ │ ├── bc30636.md │ │ ├── bc30637.md │ │ ├── bc30639.md │ │ ├── bc30640.md │ │ ├── bc30641.md │ │ ├── bc30642.md │ │ ├── bc30643.md │ │ ├── bc30645.md │ │ ├── bc30647.md │ │ ├── bc30649.md │ │ ├── bc30650.md │ │ ├── bc30651.md │ │ ├── bc30652.md │ │ ├── bc30653.md │ │ ├── bc30654.md │ │ ├── bc30656.md │ │ ├── bc30657.md │ │ ├── bc30658.md │ │ ├── bc30659.md │ │ ├── bc30660.md │ │ ├── bc30661.md │ │ ├── bc30662.md │ │ ├── bc30664.md │ │ ├── bc30665.md │ │ ├── bc30666.md │ │ ├── bc30667.md │ │ ├── bc30668.md │ │ ├── bc30670.md │ │ ├── bc30671.md │ │ ├── bc30672.md │ │ ├── bc30674.md │ │ ├── bc30675.md │ │ ├── bc30676.md │ │ ├── bc30677.md │ │ ├── bc30678.md │ │ ├── bc30679.md │ │ ├── bc30680.md │ │ ├── bc30681.md │ │ ├── bc30683.md │ │ ├── bc30688.md │ │ ├── bc30689.md │ │ ├── bc30690.md │ │ ├── bc30691.md │ │ ├── bc30695.md │ │ ├── bc30696.md │ │ ├── bc30697.md │ │ ├── bc30699.md │ │ ├── bc30700.md │ │ ├── bc30701.md │ │ ├── bc30702.md │ │ ├── bc30703.md │ │ ├── bc30704.md │ │ ├── bc30705.md │ │ ├── bc30706.md │ │ ├── bc30707.md │ │ ├── bc30708.md │ │ ├── bc30709.md │ │ ├── bc30710.md │ │ ├── bc30711.md │ │ ├── bc30713.md │ │ ├── bc30714.md │ │ ├── bc30715.md │ │ ├── bc30716.md │ │ ├── bc30717.md │ │ ├── bc30718.md │ │ ├── bc30719.md │ │ ├── bc30720.md │ │ ├── bc30721.md │ │ ├── bc30723.md │ │ ├── bc30724.md │ │ ├── bc30725.md │ │ ├── bc30726.md │ │ ├── bc30728.md │ │ ├── bc30730.md │ │ ├── bc30731.md │ │ ├── bc30732.md │ │ ├── bc30733.md │ │ ├── bc30734.md │ │ ├── bc30735.md │ │ ├── bc30736.md │ │ ├── bc30738.md │ │ ├── bc30739.md │ │ ├── bc30741.md │ │ ├── bc30742.md │ │ ├── bc30743.md │ │ ├── bc30744.md │ │ ├── bc30747.md │ │ ├── bc30748.md │ │ ├── bc30749.md │ │ ├── bc30750.md │ │ ├── bc30751.md │ │ ├── bc30752.md │ │ ├── bc30753.md │ │ ├── bc30754.md │ │ ├── bc30755.md │ │ ├── bc30756.md │ │ ├── bc30757.md │ │ ├── bc30758.md │ │ ├── bc30759.md │ │ ├── bc30760.md │ │ ├── bc30761.md │ │ ├── bc30762.md │ │ ├── bc30763.md │ │ ├── bc30764.md │ │ ├── bc30765.md │ │ ├── bc30767.md │ │ ├── bc30768.md │ │ ├── bc30769.md │ │ ├── bc30770.md │ │ ├── bc30771.md │ │ ├── bc30772.md │ │ ├── bc30780.md │ │ ├── bc30781.md │ │ ├── bc30782.md │ │ ├── bc30783.md │ │ ├── bc30784.md │ │ ├── bc30785.md │ │ ├── bc30786.md │ │ ├── bc30791.md │ │ ├── bc30792.md │ │ ├── bc30793.md │ │ ├── bc30794.md │ │ ├── bc30795.md │ │ ├── bc30796.md │ │ ├── bc30797.md │ │ ├── bc30798.md │ │ ├── bc30800.md │ │ ├── bc30802.md │ │ ├── bc30803.md │ │ ├── bc30804.md │ │ ├── bc30805.md │ │ ├── bc30807.md │ │ ├── bc30808.md │ │ ├── bc30809.md │ │ ├── bc30810.md │ │ ├── bc30811.md │ │ ├── bc30814.md │ │ ├── bc30815.md │ │ ├── bc30816.md │ │ ├── bc30817.md │ │ ├── bc30818.md │ │ ├── bc30819.md │ │ ├── bc30820.md │ │ ├── bc30821.md │ │ ├── bc30822.md │ │ ├── bc30823.md │ │ ├── bc30826.md │ │ ├── bc30827.md │ │ ├── bc30829.md │ │ ├── bc30906.md │ │ ├── bc30907.md │ │ ├── bc30908.md │ │ ├── bc30911.md │ │ ├── bc30912.md │ │ ├── bc30914.md │ │ ├── bc30915.md │ │ ├── bc30916.md │ │ ├── bc30917.md │ │ ├── bc30918.md │ │ ├── bc30919.md │ │ ├── bc30921.md │ │ ├── bc30922.md │ │ ├── bc30923.md │ │ ├── bc30924.md │ │ ├── bc30925.md │ │ ├── bc30926.md │ │ ├── bc30927.md │ │ ├── bc30928.md │ │ ├── bc30930.md │ │ ├── bc30931.md │ │ ├── bc30932.md │ │ ├── bc30934.md │ │ ├── bc30935.md │ │ ├── bc30937.md │ │ ├── bc30939.md │ │ ├── bc30940.md │ │ ├── bc30943.md │ │ ├── bc30944.md │ │ ├── bc30945.md │ │ ├── bc30946.md │ │ ├── bc30947.md │ │ ├── bc30948.md │ │ ├── bc30949.md │ │ ├── bc30950.md │ │ ├── bc30951.md │ │ ├── bc30952.md │ │ ├── bc30954.md │ │ ├── bc30958.md │ │ ├── bc30960.md │ │ ├── bc30962.md │ │ ├── bc30970.md │ │ ├── bc30974.md │ │ ├── bc30975.md │ │ ├── bc30976.md │ │ ├── bc30978.md │ │ ├── bc30979.md │ │ ├── bc30980.md │ │ ├── bc30981.md │ │ ├── bc30983.md │ │ ├── bc30984.md │ │ ├── bc30985.md │ │ ├── bc30987.md │ │ ├── bc30988.md │ │ ├── bc30989.md │ │ ├── bc30990.md │ │ ├── bc30991.md │ │ ├── bc30992.md │ │ ├── bc30993.md │ │ ├── bc30994.md │ │ ├── bc30995.md │ │ ├── bc30999.md │ │ ├── bc31007.md │ │ ├── bc31011.md │ │ ├── bc31013.md │ │ ├── bc31014.md │ │ ├── bc31021.md │ │ ├── bc31023.md │ │ ├── bc31024.md │ │ ├── bc31025.md │ │ ├── bc31027.md │ │ ├── bc31028.md │ │ ├── bc31029.md │ │ ├── bc31030.md │ │ ├── bc31031.md │ │ ├── bc31033.md │ │ ├── bc31035.md │ │ ├── bc31040.md │ │ ├── bc31041.md │ │ ├── bc31042.md │ │ ├── bc31044.md │ │ ├── bc31047.md │ │ ├── bc31048.md │ │ ├── bc31049.md │ │ ├── bc31051.md │ │ ├── bc31052.md │ │ ├── bc31053.md │ │ ├── bc31058.md │ │ ├── bc31059.md │ │ ├── bc31060.md │ │ ├── bc31061.md │ │ ├── bc31063.md │ │ ├── bc31064.md │ │ ├── bc31065.md │ │ ├── bc31067.md │ │ ├── bc31068.md │ │ ├── bc31069.md │ │ ├── bc31070.md │ │ ├── bc31071.md │ │ ├── bc31072.md │ │ ├── bc31073.md │ │ ├── bc31074.md │ │ ├── bc31075.md │ │ ├── bc31076.md │ │ ├── bc31077.md │ │ ├── bc31080.md │ │ ├── bc31082.md │ │ ├── bc31083.md │ │ ├── bc31085.md │ │ ├── bc31086.md │ │ ├── bc31087.md │ │ ├── bc31088.md │ │ ├── bc31089.md │ │ ├── bc31091.md │ │ ├── bc31092.md │ │ ├── bc31094.md │ │ ├── bc31095.md │ │ ├── bc31096.md │ │ ├── bc31097.md │ │ ├── bc31099.md │ │ ├── bc31100.md │ │ ├── bc31101.md │ │ ├── bc31104.md │ │ ├── bc31105.md │ │ ├── bc31106.md │ │ ├── bc31107.md │ │ ├── bc31108.md │ │ ├── bc31109.md │ │ ├── bc31110.md │ │ ├── bc31111.md │ │ ├── bc31112.md │ │ ├── bc31113.md │ │ ├── bc31114.md │ │ ├── bc31115.md │ │ ├── bc31116.md │ │ ├── bc31117.md │ │ ├── bc31118.md │ │ ├── bc31119.md │ │ ├── bc31120.md │ │ ├── bc31121.md │ │ ├── bc31123.md │ │ ├── bc31124.md │ │ ├── bc31125.md │ │ ├── bc31126.md │ │ ├── bc31127.md │ │ ├── bc31128.md │ │ ├── bc31129.md │ │ ├── bc31130.md │ │ ├── bc31131.md │ │ ├── bc31132.md │ │ ├── bc31133.md │ │ ├── bc31134.md │ │ ├── bc31135.md │ │ ├── bc31136.md │ │ ├── bc31137.md │ │ ├── bc31138.md │ │ ├── bc31139.md │ │ ├── bc31140.md │ │ ├── bc31141.md │ │ ├── bc31142.md │ │ ├── bc31143.md │ │ ├── bc31146.md │ │ ├── bc31148.md │ │ ├── bc31149.md │ │ ├── bc31150.md │ │ ├── bc31151.md │ │ ├── bc31152.md │ │ ├── bc31153.md │ │ ├── bc31154.md │ │ ├── bc31155.md │ │ ├── bc31156.md │ │ ├── bc31157.md │ │ ├── bc31159.md │ │ ├── bc31160.md │ │ ├── bc31161.md │ │ ├── bc31162.md │ │ ├── bc31163.md │ │ ├── bc31164.md │ │ ├── bc31165.md │ │ ├── bc31166.md │ │ ├── bc31167.md │ │ ├── bc31169.md │ │ ├── bc31170.md │ │ ├── bc31171.md │ │ ├── bc31172.md │ │ ├── bc31173.md │ │ ├── bc31174.md │ │ ├── bc31175.md │ │ ├── bc31176.md │ │ ├── bc31177.md │ │ ├── bc31178.md │ │ ├── bc31179.md │ │ ├── bc31181.md │ │ ├── bc31182.md │ │ ├── bc31184.md │ │ ├── bc31186.md │ │ ├── bc31187.md │ │ ├── bc31189.md │ │ ├── bc31190.md │ │ ├── bc31191.md │ │ ├── bc31192.md │ │ ├── bc31193.md │ │ ├── bc31195.md │ │ ├── bc31196.md │ │ ├── bc31197.md │ │ ├── bc31198.md │ │ ├── bc31199.md │ │ ├── bc31394.md │ │ ├── bc31395.md │ │ ├── bc31396.md │ │ ├── bc31398.md │ │ ├── bc31399.md │ │ ├── bc31400.md │ │ ├── bc31401.md │ │ ├── bc31403.md │ │ ├── bc31404.md │ │ ├── bc31405.md │ │ ├── bc31406.md │ │ ├── bc31407.md │ │ ├── bc31408.md │ │ ├── bc31409.md │ │ ├── bc31410.md │ │ ├── bc31411.md │ │ ├── bc31412.md │ │ ├── bc31413.md │ │ ├── bc31415.md │ │ ├── bc31416.md │ │ ├── bc31417.md │ │ ├── bc31418.md │ │ ├── bc31419.md │ │ ├── bc31420.md │ │ ├── bc31421.md │ │ ├── bc31422.md │ │ ├── bc31424.md │ │ ├── bc31425.md │ │ ├── bc31426.md │ │ ├── bc31427.md │ │ ├── bc31428.md │ │ ├── bc31429.md │ │ ├── bc31430.md │ │ ├── bc31431.md │ │ ├── bc31432.md │ │ ├── bc31433.md │ │ ├── bc31434.md │ │ ├── bc31435.md │ │ ├── bc31437.md │ │ ├── bc31438.md │ │ ├── bc31439.md │ │ ├── bc31440.md │ │ ├── bc31441.md │ │ ├── bc31442.md │ │ ├── bc31443.md │ │ ├── bc31500.md │ │ ├── bc31501.md │ │ ├── bc31502.md │ │ ├── bc31503.md │ │ ├── bc31504.md │ │ ├── bc31505.md │ │ ├── bc31506.md │ │ ├── bc31507.md │ │ ├── bc31508.md │ │ ├── bc31509.md │ │ ├── bc31510.md │ │ ├── bc31511.md │ │ ├── bc31512.md │ │ ├── bc31513.md │ │ ├── bc31514.md │ │ ├── bc31515.md │ │ ├── bc31516.md │ │ ├── bc31517.md │ │ ├── bc31518.md │ │ ├── bc31519.md │ │ ├── bc31520.md │ │ ├── bc31521.md │ │ ├── bc31522.md │ │ ├── bc31523.md │ │ ├── bc31524.md │ │ ├── bc31525.md │ │ ├── bc31526.md │ │ ├── bc31527.md │ │ ├── bc31528.md │ │ ├── bc31529.md │ │ ├── bc31530.md │ │ ├── bc31531.md │ │ ├── bc31532.md │ │ ├── bc31533.md │ │ ├── bc31534.md │ │ ├── bc31536.md │ │ ├── bc31537.md │ │ ├── bc31538.md │ │ ├── bc32000.md │ │ ├── bc32001.md │ │ ├── bc32002.md │ │ ├── bc32004.md │ │ ├── bc32006.md │ │ ├── bc32007.md │ │ ├── bc32009.md │ │ ├── bc32010.md │ │ ├── bc32013.md │ │ ├── bc32014.md │ │ ├── bc32015.md │ │ ├── bc32016.md │ │ ├── bc32017.md │ │ ├── bc32019.md │ │ ├── bc32020.md │ │ ├── bc32021.md │ │ ├── bc32023.md │ │ ├── bc32024.md │ │ ├── bc32026.md │ │ ├── bc32027.md │ │ ├── bc32028.md │ │ ├── bc32029.md │ │ ├── bc32030.md │ │ ├── bc32031.md │ │ ├── bc32032.md │ │ ├── bc32033.md │ │ ├── bc32034.md │ │ ├── bc32035.md │ │ ├── bc32036.md │ │ ├── bc32037.md │ │ ├── bc32038.md │ │ ├── bc32040.md │ │ ├── bc32041.md │ │ ├── bc32042.md │ │ ├── bc32043.md │ │ ├── bc32044.md │ │ ├── bc32045.md │ │ ├── bc32046.md │ │ ├── bc32047.md │ │ ├── bc32048.md │ │ ├── bc32049.md │ │ ├── bc32050.md │ │ ├── bc32051.md │ │ ├── bc32052.md │ │ ├── bc32054.md │ │ ├── bc32055.md │ │ ├── bc32056.md │ │ ├── bc32058.md │ │ ├── bc32059.md │ │ ├── bc32060.md │ │ ├── bc32065.md │ │ ├── bc32066.md │ │ ├── bc32067.md │ │ ├── bc32068.md │ │ ├── bc32070.md │ │ ├── bc32071.md │ │ ├── bc32072.md │ │ ├── bc32073.md │ │ ├── bc32074.md │ │ ├── bc32075.md │ │ ├── bc32076.md │ │ ├── bc32077.md │ │ ├── bc32078.md │ │ ├── bc32079.md │ │ ├── bc32080.md │ │ ├── bc32081.md │ │ ├── bc32082.md │ │ ├── bc32083.md │ │ ├── bc32084.md │ │ ├── bc32085.md │ │ ├── bc32086.md │ │ ├── bc32087.md │ │ ├── bc32088.md │ │ ├── bc32089.md │ │ ├── bc32090.md │ │ ├── bc32092.md │ │ ├── bc32093.md │ │ ├── bc32094.md │ │ ├── bc32095.md │ │ ├── bc32097.md │ │ ├── bc32099.md │ │ ├── bc32100.md │ │ ├── bc32101.md │ │ ├── bc32102.md │ │ ├── bc32103.md │ │ ├── bc32104.md │ │ ├── bc32105.md │ │ ├── bc32106.md │ │ ├── bc32107.md │ │ ├── bc32108.md │ │ ├── bc32109.md │ │ ├── bc32110.md │ │ ├── bc32111.md │ │ ├── bc32113.md │ │ ├── bc32114.md │ │ ├── bc32115.md │ │ ├── bc32116.md │ │ ├── bc32117.md │ │ ├── bc32118.md │ │ ├── bc32119.md │ │ ├── bc32120.md │ │ ├── bc32121.md │ │ ├── bc32122.md │ │ ├── bc32123.md │ │ ├── bc32125.md │ │ ├── bc32127.md │ │ ├── bc32129.md │ │ ├── bc32130.md │ │ ├── bc32200.md │ │ ├── bc32201.md │ │ ├── bc32203.md │ │ ├── bc32204.md │ │ ├── bc32205.md │ │ ├── bc32207.md │ │ ├── bc32208.md │ │ ├── bc32209.md │ │ ├── bc32300.md │ │ ├── bc32301.md │ │ ├── bc32303.md │ │ ├── bc32304.md │ │ ├── bc32400.md │ │ ├── bc32501.md │ │ ├── bc32504.md │ │ ├── bc32505.md │ │ ├── bc32506.md │ │ ├── bc32507.md │ │ ├── bc32508.md │ │ ├── bc32509.md │ │ ├── bc32510.md │ │ ├── bc33001.md │ │ ├── bc33002.md │ │ ├── bc33003.md │ │ ├── bc33004.md │ │ ├── bc33005.md │ │ ├── bc33006.md │ │ ├── bc33007.md │ │ ├── bc33008.md │ │ ├── bc33009.md │ │ ├── bc33010.md │ │ ├── bc33011.md │ │ ├── bc33012.md │ │ ├── bc33013.md │ │ ├── bc33014.md │ │ ├── bc33015.md │ │ ├── bc33016.md │ │ ├── bc33017.md │ │ ├── bc33018.md │ │ ├── bc33019.md │ │ ├── bc33020.md │ │ ├── bc33021.md │ │ ├── bc33022.md │ │ ├── bc33023.md │ │ ├── bc33024.md │ │ ├── bc33025.md │ │ ├── bc33026.md │ │ ├── bc33027.md │ │ ├── bc33028.md │ │ ├── bc33029.md │ │ ├── bc33030.md │ │ ├── bc33031.md │ │ ├── bc33032.md │ │ ├── bc33033.md │ │ ├── bc33034.md │ │ ├── bc33035.md │ │ ├── bc33037.md │ │ ├── bc33038.md │ │ ├── bc33039.md │ │ ├── bc33040.md │ │ ├── bc33041.md │ │ ├── bc33100.md │ │ ├── bc33101.md │ │ ├── bc33102.md │ │ ├── bc33104.md │ │ ├── bc33105.md │ │ ├── bc33106.md │ │ ├── bc33109.md │ │ ├── bc33110.md │ │ ├── bc33111.md │ │ ├── bc33112.md │ │ ├── bc36000.md │ │ ├── bc36001.md │ │ ├── bc36002.md │ │ ├── bc36005.md │ │ ├── bc36006.md │ │ ├── bc36007.md │ │ ├── bc36008.md │ │ ├── bc36009.md │ │ ├── bc36010.md │ │ ├── bc36011.md │ │ ├── bc36012.md │ │ ├── bc36013.md │ │ ├── bc36015.md │ │ ├── bc36016.md │ │ ├── bc36533.md │ │ ├── bc36534.md │ │ ├── bc36535.md │ │ ├── bc36536.md │ │ ├── bc36547.md │ │ ├── bc36549.md │ │ ├── bc36551.md │ │ ├── bc36552.md │ │ ├── bc36553.md │ │ ├── bc36554.md │ │ ├── bc36557.md │ │ ├── bc36558.md │ │ ├── bc36559.md │ │ ├── bc36560.md │ │ ├── bc36561.md │ │ ├── bc36565.md │ │ ├── bc36566.md │ │ ├── bc36567.md │ │ ├── bc36568.md │ │ ├── bc36569.md │ │ ├── bc36572.md │ │ ├── bc36574.md │ │ ├── bc36575.md │ │ ├── bc36576.md │ │ ├── bc36577.md │ │ ├── bc36578.md │ │ ├── bc36579.md │ │ ├── bc36580.md │ │ ├── bc36581.md │ │ ├── bc36582.md │ │ ├── bc36583.md │ │ ├── bc36584.md │ │ ├── bc36585.md │ │ ├── bc36586.md │ │ ├── bc36589.md │ │ ├── bc36590.md │ │ ├── bc36591.md │ │ ├── bc36594.md │ │ ├── bc36595.md │ │ ├── bc36597.md │ │ ├── bc36598.md │ │ ├── bc36600.md │ │ ├── bc36601.md │ │ ├── bc36602.md │ │ ├── bc36603.md │ │ ├── bc36604.md │ │ ├── bc36605.md │ │ ├── bc36606.md │ │ ├── bc36607.md │ │ ├── bc36609.md │ │ ├── bc36610.md │ │ ├── bc36613.md │ │ ├── bc36614.md │ │ ├── bc36615.md │ │ ├── bc36617.md │ │ ├── bc36618.md │ │ ├── bc36619.md │ │ ├── bc36620.md │ │ ├── bc36621.md │ │ ├── bc36622.md │ │ ├── bc36625.md │ │ ├── bc36626.md │ │ ├── bc36627.md │ │ ├── bc36628.md │ │ ├── bc36631.md │ │ ├── bc36632.md │ │ ├── bc36634.md │ │ ├── bc36636.md │ │ ├── bc36637.md │ │ ├── bc36638.md │ │ ├── bc36639.md │ │ ├── bc36640.md │ │ ├── bc36641.md │ │ ├── bc36642.md │ │ ├── bc36643.md │ │ ├── bc36648-bc36645.md │ │ ├── bc36649-bc36646.md │ │ ├── bc36650-bc36653.md │ │ ├── bc36651-bc36654.md │ │ ├── bc36655-bc36652.md │ │ ├── bc36659-bc36656.md │ │ ├── bc36660-bc36657.md │ │ ├── bc36661-bc36658.md │ │ ├── bc36662.md │ │ ├── bc36663.md │ │ ├── bc36664.md │ │ ├── bc36666-bc36665.md │ │ ├── bc36707.md │ │ ├── bc36708.md │ │ ├── bc36709.md │ │ ├── bc36710.md │ │ ├── bc36711.md │ │ ├── bc36714.md │ │ ├── bc36807.md │ │ ├── bc36808.md │ │ ├── bc36809.md │ │ ├── bc36907.md │ │ ├── bc36909.md │ │ ├── bc40000.md │ │ ├── bc40003.md │ │ ├── bc40004.md │ │ ├── bc40005.md │ │ ├── bc40009.md │ │ ├── bc40010.md │ │ ├── bc40011.md │ │ ├── bc40012.md │ │ ├── bc40014.md │ │ ├── bc40018.md │ │ ├── bc40019.md │ │ ├── bc40020.md │ │ ├── bc40021.md │ │ ├── bc40022.md │ │ ├── bc40023.md │ │ ├── bc40024.md │ │ ├── bc40026.md │ │ ├── bc40030.md │ │ ├── bc40034.md │ │ ├── bc40038.md │ │ ├── bc40040.md │ │ ├── bc40043.md │ │ ├── bc40046.md │ │ ├── bc40047.md │ │ ├── bc40048.md │ │ ├── bc40049.md │ │ ├── bc40050.md │ │ ├── bc40051.md │ │ ├── bc40052.md │ │ ├── bc40053.md │ │ ├── bc40054.md │ │ ├── bc40055.md │ │ ├── bc41000.md │ │ ├── bc41001.md │ │ ├── bc41002.md │ │ ├── bc41003.md │ │ ├── bc41004.md │ │ ├── bc41005.md │ │ ├── bc41006.md │ │ ├── bc41007.md │ │ ├── bc41008.md │ │ ├── bc41998.md │ │ ├── bc42000.md │ │ ├── bc42001.md │ │ ├── bc42002.md │ │ ├── bc42003.md │ │ ├── bc42004.md │ │ ├── bc42014.md │ │ ├── bc42016.md │ │ ├── bc42018.md │ │ ├── bc42019.md │ │ ├── bc42020.md │ │ ├── bc42021.md │ │ ├── bc42022.md │ │ ├── bc42024.md │ │ ├── bc42028.md │ │ ├── bc42029.md │ │ ├── bc42030.md │ │ ├── bc42031.md │ │ ├── bc42032.md │ │ ├── bc42034.md │ │ ├── bc42035.md │ │ ├── bc42036.md │ │ ├── bc42099.md │ │ ├── bc42101.md │ │ ├── bc42102.md │ │ ├── bc42106.md │ │ ├── bc42108.md │ │ ├── bc42109.md │ │ ├── bc42111.md │ │ ├── bc42200.md │ │ ├── bc42203.md │ │ ├── bc42204.md │ │ ├── bc42205.md │ │ ├── bc42206.md │ │ ├── bc42207.md │ │ ├── bc42300.md │ │ ├── bc42301.md │ │ ├── bc42302.md │ │ ├── bc42303.md │ │ ├── bc42304.md │ │ ├── bc42305.md │ │ ├── bc42306.md │ │ ├── bc42307.md │ │ ├── bc42308.md │ │ ├── bc42309.md │ │ ├── bc42310.md │ │ ├── bc42311.md │ │ ├── bc42312.md │ │ ├── bc42313.md │ │ ├── bc42314.md │ │ ├── bc42315.md │ │ ├── bc42316.md │ │ ├── bc42317.md │ │ ├── bc42318.md │ │ ├── bc42320.md │ │ ├── bc42321.md │ │ ├── bc42322.md │ │ ├── bc42328.md │ │ ├── before-and-after-arguments-cannot-be-combined.md │ │ ├── cannot-calculate-number-of-periods-using-the-arguments-provided.md │ │ ├── cannot-calculate-rate-using-the-arguments-provided.md │ │ ├── cannot-call-friend-function-on-object-which-is-not-instance-of-defining-class.md │ │ ├── cannot-convert-argument-argumentname-of-type-type1-to-type-type2.md │ │ ├── cannot-convert-start-value-of-type1-and-step-value-of-type2-to-a-common-type.md │ │ ├── cannot-convert-start-value-to-a-common-type.md │ │ ├── cannot-delete-a-registry-hive.md │ │ ├── cannot-determine-array-type-because-it-is-nothing.md │ │ ├── cannot-rename-with-different-drive.md │ │ ├── cannot-save-file-to-temp.md │ │ ├── cant-perform-requested-operation.md │ │ ├── cast-from-string-string-to-type-typename-is-not-valid.md │ │ ├── cast-from-type-typename1-to-type-typename2-is-not-valid.md │ │ ├── class-classname-does-not-implement-the-system-collections-icollection-interface.md │ │ ├── class-not-registered-on-local-machine.md │ │ ├── code-resource-lock-error.md │ │ ├── code-resource-not-found.md │ │ ├── collection-index-must-be-in-the-range-1-to-the-size-of-the-collection.md │ │ ├── compiler-messages.md │ │ ├── connection-to-type-library-or-object-library-for-remote-process-has-been-lost.md │ │ ├── could-not-complete-operation-since-target-directory-is-under-source-directory.md │ │ ├── could-not-obtain-full-operation-system-name-due-to-internal-error.md │ │ ├── could-not-obtain-memory-information-due-to-internal-error.md │ │ ├── databits-must-be-greater-than-0.md │ │ ├── device-unavailable.md │ │ ├── disk-full.md │ │ ├── disk-not-ready.md │ │ ├── division-by-zero-error.md │ │ ├── division-by-zero-run-time-error.md │ │ ├── drive-drivename-not-found.md │ │ ├── encoding-cannot-be-set-to-nothing.md │ │ ├── error-number-must-be-within-the-range-0-and-65535.md │ │ ├── expression-name-is-not-a-procedure-but-occurs-as-the-target-of-a-procedure-call.md │ │ ├── feature-not-yet-implemented.md │ │ ├── field-fieldname-of-type-typename-is-readonly.md │ │ ├── file-already-exists.md │ │ ├── file-filename-cannot-be-deleted-because-it-is-open.md │ │ ├── file-filename-is-write-protected.md │ │ ├── file-filename-not-found.md │ │ ├── file-format-not-valid.md │ │ ├── file-i-o-with-type-typename-is-not-valid.md │ │ ├── file-information-cannot-be-queried-if-the-file-does-not-exist.md │ │ ├── file-information-cannot-be-queried-while-open-for-writing.md │ │ ├── file-io-of-a-structure-with-field-fieldname-of-type-typename-is-not-valid.md │ │ ├── file-s-open-mode-wasn-t-set-to-a-valid-value.md │ │ ├── file-specified-by-filename-does-not-use-the-encoding-specified-by-fileencoding.md │ │ ├── file-specified-in-filename-is-not-a-valid-xml-file.md │ │ ├── for-loop-not-initialized.md │ │ ├── format-not-valid-in-resource-file.md │ │ ├── get-not-supported-at-run-time.md │ │ ├── get-not-supported-write-only-property.md │ │ ├── insufficient-security-permissions-to-set-the-system-date.md │ │ ├── insufficient-security-permissions-to-set-the-system-time.md │ │ ├── internal-error-in-the-microsoft-visual-basic-runtime.md │ │ ├── internal-error.md │ │ ├── invalid-pattern-string.md │ │ ├── key-cannot-be-deleted-because-it-has-subkeys.md │ │ ├── late-bound-assignment-to-a-field-of-value-type-typename-is-not-valid.md │ │ ├── length-of-argument-argumentname-must-be-greater-than-zero.md │ │ ├── line-number-cannot-be-parsed-using-the-current-delimiters.md │ │ ├── line-number-cannot-be-parsed-using-the-current-fieldwidths.md │ │ ├── line-number-cannot-be-read-because-it-exceeds-the-maximum-line-size.md │ │ ├── locale-id-name-is-not-supported-on-this-system.md │ │ ├── loop-control-variable-of-type-typename-does-not-implement-system-icomparable.md │ │ ├── managed-classes-derived-from-a-com-class-cannot-be-called-late-bound.md │ │ ├── method-methodname-cannot-be-called-with-number-arguments.md │ │ ├── method-methodname-has-no-parameter-named-parametername.md │ │ ├── method-or-data-member-not-found.md │ │ ├── my-application-log-cannot-determine-the-amount-of-free-disk-space.md │ │ ├── named-argument-argumentname-specified-multiple-times.md │ │ ├── named-argument-not-found.md │ │ ├── named-arguments-cannot-match-paramarray-parameters.md │ │ ├── no-accessible-overloaded-methodname-can-be-called-with-these-arguments-list-2.md │ │ ├── no-accessible-overloaded-methodname-can-be-called-with-these-arguments-list.md │ │ ├── no-accessible-overloaded-methodname-can-be-called-with-these-arguments.md │ │ ├── no-accessible-overloaded-methodname-can-be-called-without-widening.md │ │ ├── no-default-member-found-for-type-typename.md │ │ ├── no-files-found-matching-filename.md │ │ ├── no-method-methodname-can-accept-an-argument-of-type-typename-for-parameter.md │ │ ├── no-mouse-is-present.md │ │ ├── no-mouse-wheel-is-present.md │ │ ├── numberofchars-must-be-greater-than-zero.md │ │ ├── object-doesn-t-support-current-locale-setting.md │ │ ├── object-doesn-t-support-named-arguments.md │ │ ├── object-doesn-t-support-this-action.md │ │ ├── object-doesn-t-support-this-property-or-method.md │ │ ├── off.md │ │ ├── on.md │ │ ├── one-or-more-folders-in-the-target-path-do-not-exist.md │ │ ├── only-the-first-eight-characters-of-a-custom-log-name-are-significant.md │ │ ├── operator-is-not-valid-for-name1-and-name2.md │ │ ├── operator-is-not-valid-for-type-typename.md │ │ ├── out-of-memory-run-time-error.md │ │ ├── path-pathname-not-found.md │ │ ├── picture-is-not-valid.md │ │ ├── printer-error.md │ │ ├── process-processname-was-not-found.md │ │ ├── property-propertyname-cannot-be-set-to-an-empty-string-or-nothing.md │ │ ├── property-propertyname-cannot-be-set-to-nothing.md │ │ ├── property-value-is-not-valid.md │ │ ├── public-member-membername-on-type-typename-not-found.md │ │ ├── redim-can-only-change-the-right-most-dimension.md │ │ ├── redim-cannot-change-the-number-of-dimensions.md │ │ ├── redim-preserve-operand-cannot-be-nothing.md │ │ ├── registry-key-keyname-could-not-be-created.md │ │ ├── registry-key-keyname-could-not-be-found.md │ │ ├── replacements-too-long.md │ │ ├── root-folder-cannot-be-renamed.md │ │ ├── run-time-messages.md │ │ ├── search-text-not-found.md │ │ ├── set-not-permitted.md │ │ ├── set-not-supported-at-run-time.md │ │ ├── set-not-supported-read-only-property.md │ │ ├── simplifiedchinese-and-vbstrconv-traditionalchinese-cannot-be-combined.md │ │ ├── some-files-and-folders-caused-exceptions-during-the-operation.md │ │ ├── sorry-we-don-t-have-specifics-on-this-visual-basic-error.md │ │ ├── source-folder-and-target-folder-are-the-same.md │ │ ├── source-name-specified-in-eventlogsource-is-registered-to-another-log.md │ │ ├── specified-dll-function-not-found.md │ │ ├── specified-event-log-does-not-exist-on-this-machine.md │ │ ├── specified-registry-key-does-not-exist.md │ │ ├── specified-registry-key-is-not-valid.md │ │ ├── specified-registry-path-does-not-start-with-a-valid-hive-name.md │ │ ├── stop-statement-encountered.md │ │ ├── strconv-linguisticcasing-requires-strconv-lowercase-or-strconv-uppercase.md │ │ ├── string-length-exceeds-maximum-length-of-32767-characters-for-filesystem-apis.md │ │ ├── system-event-log-cannot-be-deleted.md │ │ ├── target-folder-is-a-file.md │ │ ├── targetfilepath-specifies-an-existing-folder.md │ │ ├── textfieldparser-does-not-support-comment-tokens-that-contain-whitespace.md │ │ ├── textfieldparser-does-not-support-delimiters-that-contain-endline-characters.md │ │ ├── the-address-for-uploadfile-needs-to-include-a-filename.md │ │ ├── the-connectiontimeout-must-be-greater-than-0.md │ │ ├── the-file-is-already-open.md │ │ ├── the-file-is-currently-closed.md │ │ ├── the-file-is-currently-open-for-reading.md │ │ ├── the-file-is-currently-open-for-writing.md │ │ ├── the-folder-cannot-be-created-since-a-file-already-exists-with-the-same-path.md │ │ ├── the-input-path-refers-to-a-file-but-ends-with-a-directory-separator-character.md │ │ ├── the-path-has-not-been-set.md │ │ ├── the-remote-server-machine-does-not-exist-or-is-unavailable.md │ │ ├── the-source-folder-does-not-exist.md │ │ ├── the-specified-path-does-not-exist.md │ │ ├── the-stream-passed-to-textfieldparser-cannot-be-read.md │ │ ├── the-value-of-argumentname-must-be-a-positive-number.md │ │ ├── the-value-of-argumentname-must-be-greater-than-or-equal-to-1000.md │ │ ├── this-operation-can-only-be-done-when-the-file-is-closed.md │ │ ├── this-single-instance-application-could-not-connect-to-the-original-instance.md │ │ ├── this-system-does-not-contain-support-for-the-japanese-locale.md │ │ ├── this-system-does-not-contain-support-for-the-locale-specified.md │ │ ├── this-system-does-not-contain-support-for-the-simplifiedchinese-locale.md │ │ ├── this-system-does-not-contain-support-for-the-traditional-chinese-locale.md │ │ ├── too-many-dll-application-clients.md │ │ ├── type-of-argument-argumentname-is-typename-which-is-not-numeric.md │ │ ├── unable-to-obtain-a-stream-for-the-log.md │ │ ├── unable-to-ping-because-a-network-connection-is-not-available.md │ │ ├── unable-to-read-delimited-fields-because-delimiters-is-nothing-or-empty.md │ │ ├── unable-to-read-delimited-fields.md │ │ ├── unable-to-read-fixed-width-fields-because-fieldwidths-is-nothing-or-empty.md │ │ ├── unable-to-sink-events-of-object.md │ │ ├── unable-to-write-to-log-file-because-reduce-free-disk-space-below-reservedspace.md │ │ ├── unable-to-write-to-log-file-it-would-cause-it-to-exceed-maximumsize-value.md │ │ ├── use-filegetobject-instead-of-fileget-when-using-argument-of-type-object.md │ │ ├── use-fileputobject-instead-of-fileput-when-using-argument-of-type-object.md │ │ ├── use-of-default-instance-of-a-class-in-the-class-constructor.md │ │ ├── user-interrupt-occurred.md │ │ ├── vbstrconv-wide-and-vbstrconv-narrow-are-not-applicable-to-the-locale-specified.md │ │ ├── vbstrconv-wide-and-vbstrconv-narrow-cannot-be-combined.md │ │ ├── wrong-number-of-arguments-or-property-assignment-not-valid.md │ │ ├── you-must-specify-a-file-name.md │ │ ├── you-must-specify-a-name.md │ │ └── you-must-specify-path-that-is-under-the-current-folder-or-one-of-sub-folders.md │ ├── programming-guide │ │ ├── com-interop │ │ │ ├── com-interoperability-in-net-framework-applications.md │ │ │ ├── how-to-call-a-windows-function-that-takes-unsigned-types.md │ │ │ ├── how-to-call-windows-apis.md │ │ │ ├── how-to-reference-com-objects.md │ │ │ ├── how-to-work-with-activex-controls.md │ │ │ ├── index.md │ │ │ ├── introduction-to-com-interop.md │ │ │ ├── troubleshooting-interoperability.md │ │ │ ├── walkthrough-calling-windows-apis.md │ │ │ ├── walkthrough-creating-com-objects.md │ │ │ └── walkthrough-implementing-inheritance-with-com-objects.md │ │ ├── concepts │ │ │ ├── async │ │ │ │ ├── async-return-types.md │ │ │ │ ├── cancel-an-async-task-or-a-list-of-tasks.md │ │ │ │ ├── cancel-async-tasks-after-a-period-of-time.md │ │ │ │ ├── cancel-remaining-async-tasks-after-one-is-complete.md │ │ │ │ ├── control-flow-in-async-programs.md │ │ │ │ ├── fine-tuning-your-async-application.md │ │ │ │ ├── handling-reentrancy-in-async-apps.md │ │ │ │ ├── how-to-extend-the-async-walkthrough-by-using-task-whenall.md │ │ │ │ ├── how-to-make-multiple-web-requests-in-parallel-by-using-async-and-await.md │ │ │ │ ├── index.md │ │ │ │ ├── media │ │ │ │ │ ├── fine-tuning-your-async-application │ │ │ │ │ │ └── cancellation-and-start-button.png │ │ │ │ │ └── index │ │ │ │ │ │ └── navigation-trace-async-program.png │ │ │ │ ├── start-multiple-async-tasks-and-process-them-as-they-complete.md │ │ │ │ ├── toc.yml │ │ │ │ ├── using-async-for-file-access.md │ │ │ │ └── walkthrough-accessing-the-web-by-using-async-and-await.md │ │ │ ├── attributes │ │ │ │ ├── accessing-attributes-by-using-reflection.md │ │ │ │ ├── attributeusage.md │ │ │ │ ├── common-attributes.md │ │ │ │ ├── creating-custom-attributes.md │ │ │ │ ├── how-to-create-a-c-cpp-union-by-using-attributes.md │ │ │ │ ├── index.md │ │ │ │ └── toc.yml │ │ │ ├── caller-information.md │ │ │ ├── collections.md │ │ │ ├── covariance-contravariance │ │ │ │ ├── creating-variant-generic-interfaces.md │ │ │ │ ├── index.md │ │ │ │ ├── toc.yml │ │ │ │ ├── using-variance-for-func-and-action-generic-delegates.md │ │ │ │ ├── using-variance-in-delegates.md │ │ │ │ ├── using-variance-in-interfaces-for-generic-collections.md │ │ │ │ ├── variance-in-delegates.md │ │ │ │ └── variance-in-generic-interfaces.md │ │ │ ├── expression-trees │ │ │ │ ├── debugging-expression-trees-in-visual-studio.md │ │ │ │ ├── debugview-syntax.md │ │ │ │ ├── how-to-execute-expression-trees.md │ │ │ │ ├── how-to-modify-expression-trees.md │ │ │ │ ├── how-to-use-expression-trees-to-build-dynamic-queries.md │ │ │ │ ├── index.md │ │ │ │ ├── media │ │ │ │ │ └── debugging-expression-trees-in-visual-studio │ │ │ │ │ │ ├── debugview-visual-basic.png │ │ │ │ │ │ ├── expression-to-string-visualizer-vb.png │ │ │ │ │ │ ├── expression-tree-visualizers-vb.png │ │ │ │ │ │ ├── readable-expressions-visualizer.png │ │ │ │ │ │ └── string-visualizer-vb.png │ │ │ │ └── toc.yml │ │ │ ├── index.md │ │ │ ├── iterators.md │ │ │ ├── linq │ │ │ │ ├── adding-elements-attributes-and-nodes-to-an-xml-tree.md │ │ │ │ ├── advanced-linq-to-xml-programming.md │ │ │ │ ├── advanced-query-techniques-linq-to-xml.md │ │ │ │ ├── aggregation-operations.md │ │ │ │ ├── applicability-of-functional-transformation.md │ │ │ │ ├── atomized-xname-and-xnamespace-objects-linq-to-xml.md │ │ │ │ ├── basic-queries-linq-to-xml.md │ │ │ │ ├── basic-query-operations.md │ │ │ │ ├── classification-of-standard-query-operators-by-manner-of-execution.md │ │ │ │ ├── cloning-vs-attaching.md │ │ │ │ ├── concatenation-operations.md │ │ │ │ ├── concepts-and-terminology-functional-transformation.md │ │ │ │ ├── converting-data-types.md │ │ │ │ ├── creating-the-source-office-open-xml-document.md │ │ │ │ ├── creating-xml-trees.md │ │ │ │ ├── deferred-execution-and-lazy-evaluation-in-linq-to-xml.md │ │ │ │ ├── deferred-execution-example.md │ │ │ │ ├── details-of-office-open-xml-wordprocessingml-documents.md │ │ │ │ ├── element-operations.md │ │ │ │ ├── enabling-a-data-source-for-linq-querying.md │ │ │ │ ├── equality-operations.md │ │ │ │ ├── example-that-outputs-office-open-xml-document-parts.md │ │ │ │ ├── features-that-support-linq.md │ │ │ │ ├── filtering-data.md │ │ │ │ ├── finding-text-in-word-documents.md │ │ │ │ ├── finding-the-default-paragraph-style.md │ │ │ │ ├── functional-construction-linq-to-xml.md │ │ │ │ ├── functional-programming-vs-imperative-programming.md │ │ │ │ ├── functional-transformation-of-xml.md │ │ │ │ ├── functional-vs-procedural-programming-linq-to-xml.md │ │ │ │ ├── generation-operations.md │ │ │ │ ├── getting-started-linq-to-xml.md │ │ │ │ ├── getting-started-with-linq.md │ │ │ │ ├── grouping-data.md │ │ │ │ ├── how-to-add-custom-methods-for-linq-queries.md │ │ │ │ ├── how-to-build-linq-to-xml-examples.md │ │ │ │ ├── how-to-calculate-intermediate-values.md │ │ │ │ ├── how-to-catch-parsing-errors.md │ │ │ │ ├── how-to-chain-axis-method-calls-linq-to-xml.md │ │ │ │ ├── how-to-change-the-namespace-for-an-entire-xml-tree.md │ │ │ │ ├── how-to-combine-and-compare-string-collections-linq.md │ │ │ │ ├── how-to-combine-linq-queries-with-regular-expressions.md │ │ │ │ ├── how-to-compare-the-contents-of-two-folders-linq.md │ │ │ │ ├── how-to-compute-column-values-in-a-csv-text-file-linq.md │ │ │ │ ├── how-to-control-namespace-prefixes-linq-to-xml.md │ │ │ │ ├── how-to-control-the-type-of-a-projection.md │ │ │ │ ├── how-to-count-occurrences-of-a-word-in-a-string-linq.md │ │ │ │ ├── how-to-create-a-document-with-namespaces.md │ │ │ │ ├── how-to-create-a-list-of-items.md │ │ │ │ ├── how-to-create-a-tree-from-an-xmlreader.md │ │ │ │ ├── how-to-create-hierarchy-using-grouping.md │ │ │ │ ├── how-to-debug-empty-query-results-sets.md │ │ │ │ ├── how-to-filter-on-an-attribute-xpath-linq-to-xml.md │ │ │ │ ├── how-to-filter-on-an-optional-element.md │ │ │ │ ├── how-to-filter-on-element-names-linq-to-xml.md │ │ │ │ ├── how-to-find-a-child-element-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-a-list-of-child-elements-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-a-single-descendant-using-the-descendants-method.md │ │ │ │ ├── how-to-find-a-union-of-two-location-paths-xpath.md │ │ │ │ ├── how-to-find-all-nodes-in-a-namespace.md │ │ │ │ ├── how-to-find-an-attribute-of-the-parent-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-an-element-with-a-specific-attribute.md │ │ │ │ ├── how-to-find-an-element-with-a-specific-child-element.md │ │ │ │ ├── how-to-find-attributes-of-siblings-with-a-specific-name.md │ │ │ │ ├── how-to-find-child-elements-based-on-position.md │ │ │ │ ├── how-to-find-descendant-elements-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-descendants-of-a-child-element-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-descendants-with-a-specific-element-name.md │ │ │ │ ├── how-to-find-elements-in-a-namespace.md │ │ │ │ ├── how-to-find-elements-with-a-specific-attribute.md │ │ │ │ ├── how-to-find-preceding-siblings-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-related-elements-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-sibling-nodes-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-the-immediate-preceding-sibling-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-the-root-element-xpath-linq-to-xml.md │ │ │ │ ├── how-to-find-the-set-difference-between-two-lists-linq.md │ │ │ │ ├── how-to-generate-text-files-from-xml.md │ │ │ │ ├── how-to-generate-xml-from-csv-files.md │ │ │ │ ├── how-to-group-files-by-extension-linq.md │ │ │ │ ├── how-to-join-content-from-dissimilar-files-linq.md │ │ │ │ ├── how-to-join-two-collections-linq-to-xml.md │ │ │ │ ├── how-to-list-all-nodes-in-a-tree.md │ │ │ │ ├── how-to-load-xml-from-a-file.md │ │ │ │ ├── how-to-modify-an-office-open-xml-document.md │ │ │ │ ├── how-to-parse-a-string.md │ │ │ │ ├── how-to-perform-streaming-transform-of-large-xml-documents.md │ │ │ │ ├── how-to-populate-an-xml-tree-from-the-file-system.md │ │ │ │ ├── how-to-populate-an-xml-tree-with-an-xmlwriter-linq-to-xml.md │ │ │ │ ├── how-to-populate-object-collections-from-multiple-sources-linq.md │ │ │ │ ├── how-to-project-a-new-type-linq-to-xml.md │ │ │ │ ├── how-to-project-an-anonymous-type.md │ │ │ │ ├── how-to-project-an-object-graph.md │ │ │ │ ├── how-to-query-an-arraylist-with-linq.md │ │ │ │ ├── how-to-query-an-assembly-s-metadata-with-reflection-linq.md │ │ │ │ ├── how-to-query-for-characters-in-a-string-linq.md │ │ │ │ ├── how-to-query-for-duplicate-files-in-a-directory-tree-linq.md │ │ │ │ ├── how-to-query-for-files-with-a-specified-attribute-or-name.md │ │ │ │ ├── how-to-query-for-sentences-that-contain-a-specified-set-of-words.md │ │ │ │ ├── how-to-query-for-the-largest-file-or-files-in-a-directory-tree.md │ │ │ │ ├── how-to-query-for-the-total-number-of-bytes-in-a-set-of-folders.md │ │ │ │ ├── how-to-query-linq-to-xml-using-xpath.md │ │ │ │ ├── how-to-query-the-contents-of-files-in-a-folder-linq.md │ │ │ │ ├── how-to-read-and-write-an-encoded-document.md │ │ │ │ ├── how-to-reorder-the-fields-of-a-delimited-file.md │ │ │ │ ├── how-to-retrieve-a-collection-of-attributes-linq-to-xml.md │ │ │ │ ├── how-to-retrieve-a-collection-of-elements-linq-to-xml.md │ │ │ │ ├── how-to-retrieve-a-single-attribute-linq-to-xml.md │ │ │ │ ├── how-to-retrieve-a-single-child-element-linq-to-xml.md │ │ │ │ ├── how-to-retrieve-paragraphs-from-an-office-open-xml-document.md │ │ │ │ ├── how-to-retrieve-the-shallow-value-of-an-element.md │ │ │ │ ├── how-to-retrieve-the-value-of-an-attribute-linq-to-xml.md │ │ │ │ ├── how-to-retrieve-the-value-of-an-element-linq-to-xml.md │ │ │ │ ├── how-to-serialize-using-datacontractserializer.md │ │ │ │ ├── how-to-serialize-using-xmlserializer.md │ │ │ │ ├── how-to-sort-elements-on-multiple-keys.md │ │ │ │ ├── how-to-sort-elements.md │ │ │ │ ├── how-to-sort-or-filter-text-data-by-any-word-or-field-linq.md │ │ │ │ ├── how-to-split-a-file-into-many-files-by-using-groups-linq.md │ │ │ │ ├── how-to-stream-xml-fragments-from-an-xmlreader.md │ │ │ │ ├── how-to-stream-xml-fragments-with-access-to-header-information.md │ │ │ │ ├── how-to-transform-the-shape-of-an-xml-tree.md │ │ │ │ ├── how-to-use-annotation-trees-to-transform-linq-to-xml-trees-in-an-xslt-style.md │ │ │ │ ├── how-to-validate-using-xsd-linq-to-xml.md │ │ │ │ ├── how-to-work-with-dictionaries-using-linq-to-xml.md │ │ │ │ ├── how-to-write-a-linq-to-xml-axis-method.md │ │ │ │ ├── how-to-write-a-query-that-finds-elements-based-on-context.md │ │ │ │ ├── how-to-write-queries-on-xml-in-namespaces.md │ │ │ │ ├── how-to-write-queries-with-complex-filtering.md │ │ │ │ ├── in-memory-xml-tree-modification-vs-functional-construction.md │ │ │ │ ├── index.md │ │ │ │ ├── introduction-to-linq.md │ │ │ │ ├── introduction-to-pure-functional-transformations.md │ │ │ │ ├── introduction-to-xml-literals.md │ │ │ │ ├── join-operations.md │ │ │ │ ├── language-integrated-axes.md │ │ │ │ ├── linq-and-file-directories.md │ │ │ │ ├── linq-and-reflection.md │ │ │ │ ├── linq-and-strings.md │ │ │ │ ├── linq-to-adonet-portal-page.md │ │ │ │ ├── linq-to-objects.md │ │ │ │ ├── linq-to-xml-annotations.md │ │ │ │ ├── linq-to-xml-axes-overview.md │ │ │ │ ├── linq-to-xml-axes.md │ │ │ │ ├── linq-to-xml-classes-overview.md │ │ │ │ ├── linq-to-xml-events.md │ │ │ │ ├── linq-to-xml-for-xpath-users.md │ │ │ │ ├── linq-to-xml-overview.md │ │ │ │ ├── linq-to-xml-programming-overview.md │ │ │ │ ├── linq-to-xml-security.md │ │ │ │ ├── linq-to-xml-vs-dom.md │ │ │ │ ├── linq-to-xml-vs-other-xml-technologies.md │ │ │ │ ├── linq-to-xml.md │ │ │ │ ├── maintaining-name-value-pairs.md │ │ │ │ ├── media │ │ │ │ │ ├── aggregation-operations │ │ │ │ │ │ └── linq-aggregation-operations.png │ │ │ │ │ ├── concatenation-operations │ │ │ │ │ │ └── concatenation-two-sequences.png │ │ │ │ │ ├── filtering-data │ │ │ │ │ │ └── linq-filter-operation.png │ │ │ │ │ ├── grouping-data │ │ │ │ │ │ └── linq-group-operation.png │ │ │ │ │ ├── introduction-to-linq │ │ │ │ │ │ └── linq-query-intellisense.png │ │ │ │ │ ├── join-operations │ │ │ │ │ │ └── join-method-overlapping-circles.png │ │ │ │ │ ├── partitioning-data │ │ │ │ │ │ └── linq-partitioning-operations.png │ │ │ │ │ ├── projection-operations │ │ │ │ │ │ ├── select-action-graphic.png │ │ │ │ │ │ └── select-many-action-graphic.png │ │ │ │ │ ├── quantifier-operations │ │ │ │ │ │ └── linq-quantifier-operations.png │ │ │ │ │ ├── set-operations │ │ │ │ │ │ ├── distinct-method-behavior.png │ │ │ │ │ │ ├── except-behavior-graphic.png │ │ │ │ │ │ ├── intersection-two-sequences.png │ │ │ │ │ │ └── union-operation-two-sequences.png │ │ │ │ │ ├── sorting-data │ │ │ │ │ │ └── alphabetical-sort-operation.png │ │ │ │ │ └── type-relationships-in-query-operations │ │ │ │ │ │ └── linq-query-description-terms.png │ │ │ │ ├── mixed-declarative-code-imperative-code-bugs-linq-to-xml.md │ │ │ │ ├── modifying-elements-attributes-and-nodes-in-an-xml-tree.md │ │ │ │ ├── modifying-xml-trees-linq-to-xml.md │ │ │ │ ├── namespaces-overview-linq-to-xml.md │ │ │ │ ├── parsing-xml.md │ │ │ │ ├── partitioning-data.md │ │ │ │ ├── performance-linq-to-xml.md │ │ │ │ ├── performance-of-chained-queries-linq-to-xml.md │ │ │ │ ├── pre-atomization-of-xname-objects-linq-to-xml.md │ │ │ │ ├── preserving-white-space-while-loading-or-parsing-xml.md │ │ │ │ ├── preserving-white-space-while-serializing.md │ │ │ │ ├── programming-guide-linq-to-xml.md │ │ │ │ ├── programming-with-nodes.md │ │ │ │ ├── projecting-xml-in-a-different-shape.md │ │ │ │ ├── projection-operations.md │ │ │ │ ├── projections-and-transformations-linq-to-xml.md │ │ │ │ ├── pure-functional-transformations-of-xml.md │ │ │ │ ├── quantifier-operations.md │ │ │ │ ├── query-expression-syntax-for-standard-query-operators.md │ │ │ │ ├── querying-an-xdocument-vs-querying-an-xelement.md │ │ │ │ ├── querying-xml-trees.md │ │ │ │ ├── refactoring-into-pure-functions.md │ │ │ │ ├── refactoring-using-a-pure-function.md │ │ │ │ ├── refactoring-using-an-extension-method.md │ │ │ │ ├── reference-linq-to-xml.md │ │ │ │ ├── removing-elements-attributes-and-nodes-from-an-xml-tree.md │ │ │ │ ├── retrieving-the-paragraphs-and-their-styles.md │ │ │ │ ├── retrieving-the-text-of-the-paragraphs.md │ │ │ │ ├── sample-xml-documents-linq-to-xml.md │ │ │ │ ├── sample-xml-file-books-linq-to-xml.md │ │ │ │ ├── sample-xml-file-consolidated-purchase-orders.md │ │ │ │ ├── sample-xml-file-customers-and-orders-in-a-namespace.md │ │ │ │ ├── sample-xml-file-customers-and-orders-linq-to-xml.md │ │ │ │ ├── sample-xml-file-multiple-purchase-orders-in-a-namespace.md │ │ │ │ ├── sample-xml-file-multiple-purchase-orders-linq-to-xml.md │ │ │ │ ├── sample-xml-file-numerical-data-in-a-namespace.md │ │ │ │ ├── sample-xml-file-numerical-data-linq-to-xml.md │ │ │ │ ├── sample-xml-file-test-configuration-in-a-namespace.md │ │ │ │ ├── sample-xml-file-test-configuration-linq-to-xml.md │ │ │ │ ├── sample-xml-file-typical-purchase-order-in-a-namespace.md │ │ │ │ ├── sample-xml-file-typical-purchase-order-linq-to-xml.md │ │ │ │ ├── sample-xsd-file-customers-and-orders.md │ │ │ │ ├── scope-of-default-namespaces.md │ │ │ │ ├── serializing-object-graphs-that-contain-xelement-objects.md │ │ │ │ ├── serializing-to-an-xmlreader-invoking-xslt.md │ │ │ │ ├── serializing-to-files-textwriters-and-xmlwriters.md │ │ │ │ ├── serializing-with-an-xml-declaration.md │ │ │ │ ├── serializing-xml-trees.md │ │ │ │ ├── set-operations.md │ │ │ │ ├── shape-of-wordprocessingml-documents.md │ │ │ │ ├── sorting-data.md │ │ │ │ ├── standard-query-operators-overview.md │ │ │ │ ├── statically-compiled-queries-linq-to-xml.md │ │ │ │ ├── style-part-of-a-wordprocessingml-document.md │ │ │ │ ├── toc.yml │ │ │ │ ├── tutorial-deferred-execution.md │ │ │ │ ├── tutorial-manipulating-content-in-a-wordprocessingml-document.md │ │ │ │ ├── type-relationships-in-query-operations.md │ │ │ │ ├── using-xslt-to-transform-an-xml-tree.md │ │ │ │ ├── valid-content-of-xelement-and-xdocument-objects.md │ │ │ │ ├── visual-studio-ide-and-tools-support-for-linq.md │ │ │ │ ├── walkthrough-writing-queries.md │ │ │ │ ├── wordprocessingml-document-with-styles.md │ │ │ │ ├── working-with-global-namespaces-linq-to-xml.md │ │ │ │ ├── working-with-xml-namespaces.md │ │ │ │ ├── writing-your-first-linq-query.md │ │ │ │ ├── xattribute-class-overview.md │ │ │ │ ├── xdocument-class-overview.md │ │ │ │ └── xelement-class-overview.md │ │ │ ├── object-oriented-programming.md │ │ │ ├── reflection.md │ │ │ └── serialization │ │ │ │ ├── how-to-read-object-data-from-an-xml-file.md │ │ │ │ ├── how-to-write-object-data-to-an-xml-file.md │ │ │ │ ├── index.md │ │ │ │ ├── media │ │ │ │ └── index │ │ │ │ │ └── serialization-process.gif │ │ │ │ ├── toc.yml │ │ │ │ └── walkthrough-persisting-an-object-in-visual-studio.md │ │ ├── index.md │ │ ├── language-features │ │ │ ├── arrays │ │ │ │ ├── array-dimensions.md │ │ │ │ ├── how-to-assign-one-array-to-another-array.md │ │ │ │ ├── how-to-initialize-an-array-variable.md │ │ │ │ ├── how-to-sort-an-array.md │ │ │ │ ├── index.md │ │ │ │ ├── media │ │ │ │ │ ├── array-dimensions │ │ │ │ │ │ ├── one-dimensional-array.gif │ │ │ │ │ │ ├── three-dimensional-array.gif │ │ │ │ │ │ └── two-dimensional-array.gif │ │ │ │ │ └── index │ │ │ │ │ │ └── students-array-elements.gif │ │ │ │ ├── toc.yml │ │ │ │ └── troubleshooting-arrays.md │ │ │ ├── collection-initializers │ │ │ │ ├── how-to-create-a-collection-used-by-a-collection-initializer.md │ │ │ │ ├── how-to-create-an-add-extension-method-used-by-a-collection-initializer.md │ │ │ │ ├── index.md │ │ │ │ └── toc.yml │ │ │ ├── constants-enums │ │ │ │ ├── constant-and-literal-data-types.md │ │ │ │ ├── constants-overview.md │ │ │ │ ├── enumerations-and-name-qualification.md │ │ │ │ ├── enumerations-overview.md │ │ │ │ ├── how-to-declare-a-constant.md │ │ │ │ ├── how-to-declare-enumerations.md │ │ │ │ ├── how-to-determine-the-string-associated-with-an-enumeration-value.md │ │ │ │ ├── how-to-group-related-constant-values-together.md │ │ │ │ ├── how-to-iterate-through-an-enumeration.md │ │ │ │ ├── how-to-refer-to-an-enumeration-member.md │ │ │ │ ├── index.md │ │ │ │ ├── toc.yml │ │ │ │ ├── user-defined-constants.md │ │ │ │ └── when-to-use-an-enumeration.md │ │ │ ├── control-flow │ │ │ │ ├── decision-structures.md │ │ │ │ ├── how-to-dispose-of-a-system-resource.md │ │ │ │ ├── index.md │ │ │ │ ├── loop-structures.md │ │ │ │ ├── media │ │ │ │ │ ├── decision-structures │ │ │ │ │ │ └── if-then-else-construction.gif │ │ │ │ │ ├── loop-structures │ │ │ │ │ │ └── do-until-loop-true-condition.gif │ │ │ │ │ └── nested-control-structures │ │ │ │ │ │ └── example-invalid-nesting.gif │ │ │ │ ├── nested-control-structures.md │ │ │ │ ├── other-control-structures.md │ │ │ │ ├── toc.yml │ │ │ │ └── walkthrough-implementing-ienumerable-of-t.md │ │ │ ├── data-types │ │ │ │ ├── array-conversions.md │ │ │ │ ├── character-data-types.md │ │ │ │ ├── composite-data-types.md │ │ │ │ ├── conversions-between-strings-and-other-types.md │ │ │ │ ├── efficient-use-of-data-types.md │ │ │ │ ├── elementary-data-types.md │ │ │ │ ├── generic-procedures.md │ │ │ │ ├── generic-types.md │ │ │ │ ├── how-to-convert-an-object-to-another-type.md │ │ │ │ ├── how-to-declare-a-structure.md │ │ │ │ ├── how-to-define-a-class-that-can-provide-identical-functionality.md │ │ │ │ ├── how-to-hold-more-than-one-value-in-a-variable.md │ │ │ │ ├── how-to-use-a-generic-class.md │ │ │ │ ├── implicit-and-explicit-conversions.md │ │ │ │ ├── index.md │ │ │ │ ├── media │ │ │ │ │ └── generic-types │ │ │ │ │ │ └── generic-screwdriver-set.gif │ │ │ │ ├── miscellaneous-data-types.md │ │ │ │ ├── nullable-value-types.md │ │ │ │ ├── numeric-data-types.md │ │ │ │ ├── structure-variables.md │ │ │ │ ├── structures-and-classes.md │ │ │ │ ├── structures-and-other-programming-elements.md │ │ │ │ ├── structures.md │ │ │ │ ├── troubleshooting-data-types.md │ │ │ │ ├── tuples.md │ │ │ │ ├── type-characters.md │ │ │ │ ├── type-conversions.md │ │ │ │ ├── value-types-and-reference-types.md │ │ │ │ └── widening-and-narrowing-conversions.md │ │ │ ├── declared-elements │ │ │ │ ├── access-levels.md │ │ │ │ ├── declared-element-characteristics.md │ │ │ │ ├── declared-element-names.md │ │ │ │ ├── differences-between-shadowing-and-overriding.md │ │ │ │ ├── how-to-access-a-variable-hidden-by-a-derived-class.md │ │ │ │ ├── how-to-control-the-availability-of-a-variable.md │ │ │ │ ├── how-to-control-the-scope-of-a-variable.md │ │ │ │ ├── how-to-hide-a-variable-with-the-same-name-as-your-variable.md │ │ │ │ ├── how-to-hide-an-inherited-variable.md │ │ │ │ ├── index.md │ │ │ │ ├── lifetime.md │ │ │ │ ├── media │ │ │ │ │ └── shadowing │ │ │ │ │ │ ├── shadow-scope-diagram.gif │ │ │ │ │ │ └── shadowing-inherit-diagram.gif │ │ │ │ ├── references-to-declared-elements.md │ │ │ │ ├── scope.md │ │ │ │ ├── shadowing.md │ │ │ │ ├── toc.yml │ │ │ │ └── type-promotion.md │ │ │ ├── delegates │ │ │ │ ├── how-to-invoke-a-delegate-method.md │ │ │ │ ├── how-to-pass-procedures-to-another-procedure.md │ │ │ │ ├── index.md │ │ │ │ ├── relaxed-delegate-conversion.md │ │ │ │ └── toc.yml │ │ │ ├── early-late-binding │ │ │ │ ├── calling-a-property-or-method-using-a-string-name.md │ │ │ │ ├── determining-object-type.md │ │ │ │ ├── index.md │ │ │ │ ├── toc.yml │ │ │ │ └── working-with-dynamic-objects.md │ │ │ ├── error-types.md │ │ │ ├── events │ │ │ │ ├── how-to-declare-custom-events-to-avoid-blocking.md │ │ │ │ ├── how-to-declare-custom-events-to-conserve-memory.md │ │ │ │ ├── index.md │ │ │ │ ├── toc.yml │ │ │ │ ├── troubleshooting-inherited-event-handlers.md │ │ │ │ ├── walkthrough-declaring-and-raising-events.md │ │ │ │ └── walkthrough-handling-events.md │ │ │ ├── index.md │ │ │ ├── interfaces │ │ │ │ ├── index.md │ │ │ │ └── walkthrough-creating-and-implementing-interfaces.md │ │ │ ├── linq │ │ │ │ ├── how-to-call-a-stored-procedure-by-using-linq.md │ │ │ │ ├── how-to-combine-data-with-linq-by-using-joins.md │ │ │ │ ├── how-to-count-sum-or-average-data-by-using-linq.md │ │ │ │ ├── how-to-filter-query-results-by-using-linq.md │ │ │ │ ├── how-to-find-the-minimum-or-maximum-value-in-a-query-result.md │ │ │ │ ├── how-to-modify-data-in-a-database-by-using-linq.md │ │ │ │ ├── how-to-query-a-database-by-using-linq.md │ │ │ │ ├── how-to-return-a-linq-query-result-as-a-specific-type.md │ │ │ │ ├── how-to-sort-query-results-by-using-linq.md │ │ │ │ ├── index.md │ │ │ │ ├── introduction-to-linq.md │ │ │ │ └── toc.yml │ │ │ ├── objects-and-classes │ │ │ │ ├── anonymous-type-definition.md │ │ │ │ ├── anonymous-types.md │ │ │ │ ├── how-to-declare-an-object-by-using-an-object-initializer.md │ │ │ │ ├── how-to-infer-property-names-and-types-in-anonymous-type-declarations.md │ │ │ │ ├── index.md │ │ │ │ ├── inheritance-basics.md │ │ │ │ ├── media │ │ │ │ │ └── object-lifetime-how-objects-are-created-and-destroyed │ │ │ │ │ │ ├── finalize-method-destructor.gif │ │ │ │ │ │ └── subnew-constructor-inheritance.gif │ │ │ │ ├── object-initializers-named-and-anonymous-types.md │ │ │ │ ├── object-lifetime-how-objects-are-created-and-destroyed.md │ │ │ │ ├── overloaded-properties-and-methods.md │ │ │ │ ├── toc.yml │ │ │ │ └── walkthrough-defining-classes.md │ │ │ ├── operators-and-expressions │ │ │ │ ├── arithmetic-operators.md │ │ │ │ ├── boolean-expressions.md │ │ │ │ ├── common-tasks-performed-with-visual-basic-operators.md │ │ │ │ ├── comparison-operators.md │ │ │ │ ├── concatenation-operators.md │ │ │ │ ├── efficient-combination-of-operators.md │ │ │ │ ├── how-to-calculate-numeric-values.md │ │ │ │ ├── how-to-match-a-string-against-a-pattern.md │ │ │ │ ├── how-to-test-whether-two-objects-are-the-same.md │ │ │ │ ├── index.md │ │ │ │ ├── logical-and-bitwise-operators.md │ │ │ │ ├── toc.yml │ │ │ │ └── value-comparisons.md │ │ │ ├── procedures │ │ │ │ ├── auto-implemented-properties.md │ │ │ │ ├── considerations-in-overloading-procedures.md │ │ │ │ ├── differences-between-modifiable-and-nonmodifiable-arguments.md │ │ │ │ ├── differences-between-parameters-and-arguments.md │ │ │ │ ├── differences-between-passing-an-argument-by-value-and-by-reference.md │ │ │ │ ├── differences-between-properties-and-variables.md │ │ │ │ ├── extension-methods.md │ │ │ │ ├── function-procedures.md │ │ │ │ ├── how-to-call-a-procedure-that-does-not-return-a-value.md │ │ │ │ ├── how-to-call-a-procedure-that-returns-a-value.md │ │ │ │ ├── how-to-call-a-property-procedure.md │ │ │ │ ├── how-to-call-an-event-handler.md │ │ │ │ ├── how-to-call-an-extension-method.md │ │ │ │ ├── how-to-call-an-operator-procedure.md │ │ │ │ ├── how-to-call-an-overloaded-procedure.md │ │ │ │ ├── how-to-change-the-value-of-a-procedure-argument.md │ │ │ │ ├── how-to-create-a-lambda-expression.md │ │ │ │ ├── how-to-create-a-procedure-that-returns-a-value.md │ │ │ │ ├── how-to-create-a-procedure.md │ │ │ │ ├── how-to-create-a-property.md │ │ │ │ ├── how-to-declare-a-property-with-mixed-access-levels.md │ │ │ │ ├── how-to-declare-and-call-a-default-property.md │ │ │ │ ├── how-to-define-a-conversion-operator.md │ │ │ │ ├── how-to-define-a-parameter-for-a-procedure.md │ │ │ │ ├── how-to-define-an-operator.md │ │ │ │ ├── how-to-define-multiple-versions-of-a-procedure.md │ │ │ │ ├── how-to-force-an-argument-to-be-passed-by-value.md │ │ │ │ ├── how-to-get-a-value-from-a-property.md │ │ │ │ ├── how-to-overload-a-procedure-that-takes-an-indefinite-number-of-parameters.md │ │ │ │ ├── how-to-overload-a-procedure-that-takes-optional-parameters.md │ │ │ │ ├── how-to-pass-arguments-to-a-procedure.md │ │ │ │ ├── how-to-protect-a-procedure-argument-against-value-changes.md │ │ │ │ ├── how-to-put-a-value-in-a-property.md │ │ │ │ ├── how-to-return-a-value-from-a-procedure.md │ │ │ │ ├── how-to-use-a-class-that-defines-operators.md │ │ │ │ ├── how-to-write-an-extension-method.md │ │ │ │ ├── index.md │ │ │ │ ├── lambda-expressions.md │ │ │ │ ├── media │ │ │ │ │ ├── overload-resolution │ │ │ │ │ │ └── determine-overloaded-version.gif │ │ │ │ │ └── procedure-parameters-and-arguments │ │ │ │ │ │ └── pass-argument-parameter.gif │ │ │ │ ├── operator-procedures.md │ │ │ │ ├── optional-parameters.md │ │ │ │ ├── overload-resolution.md │ │ │ │ ├── parameter-arrays.md │ │ │ │ ├── partial-methods.md │ │ │ │ ├── passing-arguments-by-position-and-by-name.md │ │ │ │ ├── passing-arguments-by-value-and-by-reference.md │ │ │ │ ├── procedure-overloading.md │ │ │ │ ├── procedure-parameters-and-arguments.md │ │ │ │ ├── property-procedures.md │ │ │ │ ├── recursive-procedures.md │ │ │ │ ├── ref-return-values.md │ │ │ │ ├── sub-procedures.md │ │ │ │ ├── toc.yml │ │ │ │ └── troubleshooting-procedures.md │ │ │ ├── statements.md │ │ │ ├── strings │ │ │ │ ├── converting-between-strings-and-other-data-types.md │ │ │ │ ├── how-culture-affects-strings.md │ │ │ │ ├── how-to-access-characters-in-strings.md │ │ │ │ ├── how-to-convert-a-string-to-an-array-of-characters.md │ │ │ │ ├── how-to-convert-an-array-of-bytes-into-a-string.md │ │ │ │ ├── how-to-convert-hexadecimal-strings-to-numbers.md │ │ │ │ ├── how-to-convert-strings-into-an-array-of-bytes.md │ │ │ │ ├── how-to-create-a-string-from-an-array-of-char-values.md │ │ │ │ ├── how-to-create-strings-using-a-stringbuilder.md │ │ │ │ ├── how-to-search-within-a-string.md │ │ │ │ ├── how-to-validate-file-names-and-paths.md │ │ │ │ ├── how-to-validate-strings-that-represent-dates-or-times.md │ │ │ │ ├── index.md │ │ │ │ ├── interpolated-strings.md │ │ │ │ ├── introduction-to-strings.md │ │ │ │ ├── nothing-and-strings.md │ │ │ │ ├── string-basics.md │ │ │ │ ├── toc.yml │ │ │ │ ├── types-of-string-manipulation-methods.md │ │ │ │ ├── using-regular-expressions-with-the-maskedtextbox-control.md │ │ │ │ ├── validating-strings.md │ │ │ │ ├── walkthrough-encrypting-and-decrypting-strings.md │ │ │ │ ├── walkthrough-validating-that-passwords-are-complex.md │ │ │ │ └── zero-based-vs-one-based-string-access.md │ │ │ ├── variables │ │ │ │ ├── how-to-access-members-of-an-object.md │ │ │ │ ├── how-to-create-a-new-variable.md │ │ │ │ ├── how-to-create-a-variable-that-does-not-change-in-value.md │ │ │ │ ├── how-to-declare-an-object-variable-and-assign-an-object-to-it.md │ │ │ │ ├── how-to-determine-what-type-an-object-variable-refers-to.md │ │ │ │ ├── how-to-determine-whether-two-objects-are-identical.md │ │ │ │ ├── how-to-determine-whether-two-objects-are-related.md │ │ │ │ ├── how-to-make-an-object-variable-not-refer-to-any-instance.md │ │ │ │ ├── how-to-move-data-into-and-out-of-a-variable.md │ │ │ │ ├── how-to-refer-to-the-current-instance-of-an-object.md │ │ │ │ ├── how-to-speed-up-access-to-an-object-with-a-long-qualification-path.md │ │ │ │ ├── index.md │ │ │ │ ├── local-type-inference.md │ │ │ │ ├── object-variable-assignment.md │ │ │ │ ├── object-variable-declaration.md │ │ │ │ ├── object-variable-values.md │ │ │ │ ├── object-variables.md │ │ │ │ ├── toc.yml │ │ │ │ ├── troubleshooting-variables.md │ │ │ │ └── variable-declaration.md │ │ │ └── xml │ │ │ │ ├── accessing-xml.md │ │ │ │ ├── creating-xml.md │ │ │ │ ├── embedded-expressions-in-xml.md │ │ │ │ ├── how-to-access-xml-attributes.md │ │ │ │ ├── how-to-access-xml-child-elements.md │ │ │ │ ├── how-to-access-xml-descendant-elements.md │ │ │ │ ├── how-to-create-xml-literals.md │ │ │ │ ├── how-to-declare-and-use-xml-namespace-prefixes.md │ │ │ │ ├── how-to-embed-expressions-in-xml-literals.md │ │ │ │ ├── how-to-load-xml-from-a-file-string-or-stream.md │ │ │ │ ├── how-to-modify-xml-literals.md │ │ │ │ ├── how-to-transform-xml-by-using-linq.md │ │ │ │ ├── index.md │ │ │ │ ├── manipulating-xml.md │ │ │ │ ├── media │ │ │ │ └── overview-of-linq-to-xml │ │ │ │ │ └── play-video-icon-example.gif │ │ │ │ ├── names-of-declared-xml-elements-and-attributes.md │ │ │ │ ├── overview-of-linq-to-xml.md │ │ │ │ ├── toc.yml │ │ │ │ ├── white-space-in-xml-literals.md │ │ │ │ ├── xml-literals-and-the-xml-1-0-specification.md │ │ │ │ └── xml-literals-overview.md │ │ └── program-structure │ │ │ ├── coding-conventions.md │ │ │ ├── comments-in-code.md │ │ │ ├── conditional-compilation.md │ │ │ ├── documenting-your-code-with-xml.md │ │ │ ├── how-to-break-and-combine-statements-in-code.md │ │ │ ├── how-to-collapse-and-hide-sections-of-code.md │ │ │ ├── how-to-create-xml-documentation.md │ │ │ ├── how-to-label-statements.md │ │ │ ├── keywords-as-element-names-in-code.md │ │ │ ├── limitations.md │ │ │ ├── main-procedure.md │ │ │ ├── me-my-mybase-and-myclass.md │ │ │ ├── media │ │ │ ├── comments-in-code │ │ │ │ ├── visual-basic-comment-button.gif │ │ │ │ └── visual-basic-uncomment-button.gif │ │ │ └── namespaces │ │ │ │ └── visual-basic-namespace-hierarchy.gif │ │ │ ├── namespaces.md │ │ │ ├── naming-conventions.md │ │ │ ├── processing-the-xml-file.md │ │ │ ├── program-structure-and-code-conventions.md │ │ │ ├── references-and-the-imports-statement.md │ │ │ ├── special-characters-in-code.md │ │ │ ├── structure-of-a-visual-basic-program.md │ │ │ └── toc.yml │ ├── reference │ │ ├── command-line-compiler │ │ │ ├── addmodule.md │ │ │ ├── baseaddress.md │ │ │ ├── bugreport.md │ │ │ ├── building-from-the-command-line.md │ │ │ ├── codepage.md │ │ │ ├── compiler-options-listed-alphabetically.md │ │ │ ├── compiler-options-listed-by-category.md │ │ │ ├── debug.md │ │ │ ├── define.md │ │ │ ├── delaysign.md │ │ │ ├── deterministic.md │ │ │ ├── doc.md │ │ │ ├── errorreport.md │ │ │ ├── filealign.md │ │ │ ├── help.md │ │ │ ├── highentropyva.md │ │ │ ├── how-to-invoke-the-command-line-compiler.md │ │ │ ├── imports.md │ │ │ ├── index.md │ │ │ ├── keycontainer.md │ │ │ ├── keyfile.md │ │ │ ├── langversion.md │ │ │ ├── libpath.md │ │ │ ├── link.md │ │ │ ├── linkresource.md │ │ │ ├── main.md │ │ │ ├── moduleassemblyname.md │ │ │ ├── netcf.md │ │ │ ├── noconfig.md │ │ │ ├── nologo.md │ │ │ ├── nostdlib.md │ │ │ ├── nowarn.md │ │ │ ├── nowin32manifest.md │ │ │ ├── optimize.md │ │ │ ├── optioncompare.md │ │ │ ├── optionexplicit.md │ │ │ ├── optioninfer.md │ │ │ ├── optionstrict.md │ │ │ ├── out.md │ │ │ ├── platform.md │ │ │ ├── quiet.md │ │ │ ├── recurse.md │ │ │ ├── reference.md │ │ │ ├── refonly-compiler-option.md │ │ │ ├── refout-compiler-option.md │ │ │ ├── removeintchecks.md │ │ │ ├── resource.md │ │ │ ├── rootnamespace.md │ │ │ ├── sample-compilation-command-lines.md │ │ │ ├── sdkpath.md │ │ │ ├── specify-response-file.md │ │ │ ├── subsystemversion.md │ │ │ ├── target.md │ │ │ ├── utf8output.md │ │ │ ├── vbruntime.md │ │ │ ├── verbose.md │ │ │ ├── warnaserror.md │ │ │ ├── win32icon.md │ │ │ ├── win32manifest.md │ │ │ └── win32resource.md │ │ ├── index.md │ │ ├── language-specification │ │ │ ├── index.md │ │ │ └── toc.yml │ │ └── net-framework-reference-information.md │ ├── toc.yml │ └── walkthroughs.md └── welcome.md ├── images ├── Logo_DotNet.png ├── alerts.png └── core │ └── list-bullet.png ├── includes ├── binary-serialization-warning.md ├── book-preview.md ├── compiler-options.md ├── core-changes │ ├── aspnetcore │ │ └── 3.0 │ │ │ ├── authn-apis-json-types.md │ │ │ ├── authn-exchangecodeasync-signature-change.md │ │ │ ├── authn-google-plus-authn-changes.md │ │ │ ├── authn-httpcontext-property-removed.md │ │ │ ├── authz-assembly-change.md │ │ │ ├── authz-iauthzpolicyprovider-new-method.md │ │ │ ├── caching-memory-property-removed.md │ │ │ ├── caching-new-sqlclient-package.md │ │ │ ├── caching-response-pubternal-to-internal.md │ │ │ ├── dataprotection-azstorage-using-azstorage-apis.md │ │ │ ├── hosting-ancmv1-hosting-bundle-removal.md │ │ │ ├── hosting-generic-host-startup-ctor-restriction.md │ │ │ ├── hosting-ihostingenv-iapplifetime-types-replaced.md │ │ │ ├── hosting-objectpoolprovider-webhostbuilder-dependencies.md │ │ │ ├── http-defaulthttpcontext-extensibility-removed.md │ │ │ ├── http-headernames-constants-staticreadonly.md │ │ │ ├── http-response-body-changes.md │ │ │ ├── http-synchronous-io-disabled.md │ │ │ ├── identity-signinasync-throws-exception.md │ │ │ ├── identity-signinmanager-ctor-parameter.md │ │ │ ├── identity-ui-adddefaultui-overload-removed.md │ │ │ ├── identity-ui-bootstrap-version.md │ │ │ ├── identity-ui-static-web-assets.md │ │ │ ├── kestrel-connection-adapters-removed.md │ │ │ ├── kestrel-empty-assembly-removed.md │ │ │ ├── kestrel-request-trailer-headers.md │ │ │ ├── kestrel-transport-abstractions.md │ │ │ ├── localization-apis-marked-obsolete.md │ │ │ ├── logging-debuglogger-to-internal.md │ │ │ ├── mvc-action-async-suffix-trimmed.md │ │ │ ├── mvc-precompilation-tool-deprecated.md │ │ │ ├── mvc-pubternal-to-internal.md │ │ │ ├── mvc-webapi-compat-shim-removed.md │ │ │ ├── obsolete-apis-removed.md │ │ │ ├── razor-runtime-compilation-package.md │ │ │ ├── session-obsolete-apis-removed.md │ │ │ ├── sharedfx-all-framework-removed.md │ │ │ ├── sharedfx-app-shared-framework-assemblies.md │ │ │ ├── signalr-hubconnection-methods-removed.md │ │ │ ├── signalr-hubconnectioncontext-ctors.md │ │ │ ├── signalr-js-client-package-name.md │ │ │ ├── signalr-obsolete-apis.md │ │ │ ├── signalr-successhandshakedata-replaced.md │ │ │ ├── spas-spaservices-nodeservices-fallback.md │ │ │ ├── spas-spaservices-nodeservices-obsolete.md │ │ │ └── targetfx-netfx-tfm-support.md │ ├── categoryselector.md │ ├── corefx │ │ ├── change-in-null-in-utf8jsonwriter.md │ │ ├── custom-encoderfallbackbuffer-cannot-be-recursive.md │ │ ├── floating-point-changes.md │ │ ├── floating-point-parsing-does-not-overflow.md │ │ ├── jsonelement-api-changes.md │ │ ├── jsonencodedtext-encode-has-additional-argument.md │ │ ├── jsonfactoryconverter-createconverter.md │ │ ├── move-invalidasynchronousstateexception.md │ │ ├── move-typedescriptionproviderattribute.md │ │ ├── net-core-3-0-follows-unicode-utf8-best-practices.md │ │ ├── serializer-throws-notsupportedexception.md │ │ ├── version-information-changes.md │ │ └── ziparchiveentry-and-inconsistent-entry-sizes.md │ ├── cryptography │ │ ├── better-argument-validation-in-pkcs8privatekeyinfo-ctor.md │ │ ├── envelopedcms-defaults-to-aes256.md │ │ ├── minimum-rsaopenssl-key-size-change.md │ │ └── net-core-3-0-prefers-openssl-1-1-x.md │ ├── globalization │ │ └── c-locale-maps-to-invariant-locale.md │ ├── networking │ │ └── httprequestmessage-version-change.md │ ├── versionselector.md │ ├── visualbasic │ │ ├── microsoft.visualbasic.applicationservices-unavailable.md │ │ ├── microsoft.visualbasic.devices-unavailable.md │ │ ├── microsoft.visualbasic.myservices-unavailable.md │ │ └── vbnewline-is-obsolete.md │ └── windowsforms │ │ ├── changed-access-for-runtimeidfirstitem.md │ │ ├── control-defaultfont-changed.md │ │ ├── deprecate-allowupdatechildcontrolindexfortabcontrols.md │ │ ├── deprecate-donotloadlatestricheditcontrol.md │ │ ├── deprecate-donotsupportselectallshortcutinmultilinetextbox.md │ │ ├── deprecate-dontsupportreentrantfiltermessage.md │ │ ├── deprecate-enablevisualstylevalidation.md │ │ ├── deprecate-uselegacycontextmenustripsourcecontrolvalue.md │ │ ├── deprecate-uselegacyimages.md │ │ ├── deprecate-uselegacyscrolling.md │ │ ├── modernized-folderbrowserdialog.md │ │ ├── remove-duplicated-apis.md │ │ └── remove-serializationattribute.md ├── core-testing-note-aspnet.md ├── csharp-interactive-note.md ├── csharp-interactive-partial-note.md ├── csharp-interactive-with-utc-partial-note.md ├── csharplangspec-md.md ├── debugging-api-recommended-note.md ├── desktop-guide-preview-note.md ├── dotnet-restore-note-options.md ├── dotnet-restore-note.md ├── elevated-access-unix.md ├── esql-md.md ├── internalonly-unmanaged.md ├── lserver-md.md ├── migration-guide │ ├── retargeting │ │ ├── adonet │ │ │ └── dbparameterprecision-dbparameterscale-are-now-public-virtual-members.md │ │ ├── asp │ │ │ ├── aspnet-accessibility-improvements-net-framework-471.md │ │ │ ├── htmltextwriter-does-not-render-br-element-correctly.md │ │ │ ├── httpruntimeappdomainapppath-throws-nullreferenceexception.md │ │ │ ├── machinekeyencode-machinekeydecode-methods-are-now-obsolete.md │ │ │ ├── multi-line-aspnet-textbox-spacing-changed-when-using-antixssencoder.md │ │ │ ├── throttle-concurrent-requests-per-session.md │ │ │ └── webutilityhtmlencode-webutilityhtmldecode-round-trip-bmp-correctly.md │ │ ├── clickonce │ │ │ ├── apps-published-with-clickonce-that-use-sha-256-code-signing-certificate-may.md │ │ │ └── clickonce-supports-sha-256-on-40-targeted-apps.md │ │ ├── core │ │ │ ├── aescryptoserviceprovider-decryptor-provides-reusable-transform.md │ │ │ ├── allow-unicode-bidirectional-control-characters-uris.md │ │ │ ├── calls-claimsidentity-constructors.md │ │ │ ├── change-path-separator-character-fullname-property-ziparchiveentry-objects.md │ │ │ ├── changes-path-normalization.md │ │ │ ├── currentculture-currentuiculture-flow-across-tasks.md │ │ │ ├── deflatestream-uses-native-apis-for-decompression.md │ │ │ ├── ensure-systemuri-uses-consistent-reserved-character-set.md │ │ │ ├── etw-event-names-cannot-differ-only-by-start-stop-suffix.md │ │ │ ├── foreach-iterator-variable-now-scoped-within-iteration-so-closure-capturing.md │ │ │ ├── iasyncresultcompletedsynchronously-property-must-be-correct-for-resulting.md │ │ │ ├── listlttgtforeach-can-throw-exception-when-modifying-list-item.md │ │ │ ├── long-path-support.md │ │ │ ├── managed-cryptography-classes-do-not-throw-cryptographyexception-fips-mode.md │ │ │ ├── obsoleteattribute-exports-both-deprecatedattribute-winmd-scenarios.md │ │ │ ├── path-colon-checks-are-stricter.md │ │ │ ├── resgen-refuses-load-content-from-web.md │ │ │ ├── serialport-background-thread-exceptions.md │ │ │ ├── servicebase-doesnt-propagate-onstart-exceptions.md │ │ │ ├── stack-traces-obtained-when-using-portable-pdbs-now-include-source-file-line.md │ │ │ ├── systemuri-parsing-adheres-rfc-3987.md │ │ │ └── systemuriiswellformeduristring-method-returns-false-for-relative-uris-with.md │ │ ├── ef │ │ │ ├── building-an-entity-framework-edmx-with-visual-studio-2013-can-fail-error.md │ │ │ └── entity-framework-version-must-match-net.md │ │ ├── jit │ │ │ ├── il-ret-not-allowed-try-region.md │ │ │ └── new-64-bit-jit-compiler-net-framework-46.md │ │ ├── msbuild │ │ │ └── resolveassemblyreference-task-now-warns-dependencies-with-wrong-architecture.md │ │ ├── networking │ │ │ ├── certificate-eku-oid-validation.md │ │ │ ├── default-value-servicepointmanagersecurityprotocol.md │ │ │ ├── only-tls-10-11-12-protocols-supported-systemnetservicepointmanager.md │ │ │ ├── sslstream-supports-tls-alerts.md │ │ │ └── tls-1x-by-default-passes-schsendauxrecord-flag-underlying-schannel-api.md │ │ ├── security │ │ │ ├── cspparametersparentwindowhandle-now-expects-hwnd-value.md │ │ │ ├── default-signedxml-signedxms-algorithms-changed-sha256.md │ │ │ ├── rsacng-now-correctly-loads-rsa-keys-non-standard-key-size.md │ │ │ └── signedxmlgetpublickey-returns-rsacng-on-net462-or-lightup-without.md │ │ ├── vb │ │ │ └── vbnet-no-longer-supports-partial-namespace-qualification-for-systemwindows.md │ │ ├── versionselector.md │ │ ├── wcf │ │ │ ├── calling-createdefaultauthorizationcontext-with-null-argument-has-changed.md │ │ │ ├── deadlock-may-result-when-using-reentrant-services.md │ │ │ ├── improved-accessibility-for-some-net-sdk-tools.md │ │ │ ├── operationcontextcurrent-may-return-null-when-called-using-clause.md │ │ │ ├── serialization-control-characters-with-datacontractjsonserializer-now.md │ │ │ ├── wcf-binding-with-transportwithmessagecredential-security-mode.md │ │ │ ├── wcf-message-security-now-able-use-tls11-tls12.md │ │ │ ├── wcf-transport-security-supports-certificates-stored-using-cng.md │ │ │ └── x509certificateclaimsetfindclaims-considers-all-claimtypes.md │ │ ├── wf │ │ │ ├── accessibility-improvements-windows-workflow-foundation-wf-designer.md │ │ │ ├── avoiding-endless-recursion-for-iworkflowinstancemanagementtransactedcancel.md │ │ │ ├── new-ambiguous-dispatcherinvoke-overloads-could-result-different-behavior.md │ │ │ ├── some-workflow-drag-and-drop-apis-are-obsolete.md │ │ │ ├── workflow-30-types-are-obsolete.md │ │ │ ├── workflow-checksums-changed-from-md5-sha1.md │ │ │ ├── workflow-xaml-checksums-for-symbols-changed-from-sha1-sha256.md │ │ │ ├── workflow-xoml-definition-sqltrackingservice-cache-keys-changed-from-md5.md │ │ │ ├── workflow-xoml-file-checksums-changed-from-md5-sha256.md │ │ │ └── workflowdesignerload-doesnt-remove-symbol-property.md │ │ ├── winforms │ │ │ ├── accessibility-improvements-windows-forms-controls-for-net-472.md │ │ │ ├── accessibility-improvements-windows-forms-controls-for-net-48.md │ │ │ ├── accessibility-improvements-windows-forms-controls.md │ │ │ ├── applicationfiltermessage-no-longer-throws-for-re-entrant-implementations.md │ │ │ ├── contextmenustripsourcecontrol-property-contains-valid-control-case-nested.md │ │ │ ├── dataobjectgetdata-now-retrieves-data-utf-8.md │ │ │ ├── encoderparameter-ctor-obsolete.md │ │ │ ├── icontobitmap-successfully-converts-icons-with-png-frames-into-bitmap-objects.md │ │ │ ├── incorrect-implementation-memberdescriptorequals.md │ │ │ ├── privatefontcollectionaddfontfile-method-releases-font-resources.md │ │ │ └── winforms-domain-upbutton-downbutton-actions-are-sync-now.md │ │ ├── wpf │ │ │ ├── accessibility-improvements-wpf.md │ │ │ ├── add-selectiontextbrush-public-property-textboxpasswordbox-non-adorner.md │ │ │ ├── calls-systemwindowsinputpencontextdisable-on-touch-enabled-systems-may-throw.md │ │ │ ├── currentculture-not-preserved-across-wpf-dispatcher-operations.md │ │ │ ├── default-hash-algorithm-for-wpf-packagedigitalsignaturemanager-now-sha256.md │ │ │ ├── default-hash-algorithm-for-wpfs-markup-compiler-now-sha256.md │ │ │ ├── hwndhost-now-correctly-resizes-child-hwnd-during-dpi-changes.md │ │ │ ├── keyboard-focus-now-moves-correctly-across-multiple-layers-winformswpf.md │ │ │ ├── nullreferenceexception-exception-handling-code-from.md │ │ │ ├── selector-selectionchanged-event-selectedvalue-property.md │ │ │ ├── tabcontrol-selectionchanged-event-selectedcontent-property.md │ │ │ ├── two-way-data-binding-property-with-non-public-setter-not-supported.md │ │ │ ├── wpf-appdomain-shutdown-handling-may-now-call-dispatcherinvoke-cleanup-weak.md │ │ │ ├── wpf-changing-primary-key-when-displaying-ado-data-masterdetail-scenario.md │ │ │ ├── wpf-focusvisual-for-radiobutton-checkbox-now-displays-correctly-when.md │ │ │ ├── wpf-grid-allocation-space-star-columns.md │ │ │ ├── wpf-layout-rounding-margins-has-changed.md │ │ │ ├── wpf-pointer-based-touch-stack.md │ │ │ ├── wpf-textboxpasswordbox-text-selection-does-not-follow-system-colors.md │ │ │ └── wpf-textboxtext-can-be-out-of-sync-with-databinding.md │ │ └── xml │ │ │ ├── xml-schema-validation-stricter.md │ │ │ ├── xmlwriter-throws-on-invalid-surrogate-pairs.md │ │ │ └── xsd-schema-validation-now-correctly-detects-violations-unique-constraints-if.md │ └── runtime │ │ ├── adonet │ │ └── adonet-now-attempts-automatically-reconnect-broken-sql-connections.md │ │ ├── asp │ │ ├── aspnet-fix-handling-inputattributes-labelattributes-for-webforms-checkbox.md │ │ ├── aspnet-incorrect-multipart-handling-may-result-lost-form-data.md │ │ ├── aspnet-mvc-now-escapes-spaces-strings-passed-via-route-parameters.md │ │ ├── aspnet-validationcontextmembername-not-null-when-using-custom.md │ │ ├── gridviews-with-allowcustompaging-set-true-may-fire-pageindexchanging-event.md │ │ ├── httprequestcontentencoding-property-prohibits-utf7.md │ │ ├── httputilityjavascriptstringencode-escapes-ampersand.md │ │ ├── ipad-should-not-be-used-custom-capabilities-file-because-it-now-browser.md │ │ ├── no-longer-able-set-enableviewstatemac-false.md │ │ ├── pageloadcomplete-event-no-longer-causes.md │ │ ├── profiling-aspnet-mvc4-apps-can-lead-fatal-execution-engine-error.md │ │ ├── sharing-session-state-with-aspnet-stateserver-requires-all-servers-web-farm.md │ │ └── webutilityhtmldecode-no-longer-decodes-invalid-input-sequences.md │ │ ├── core │ │ ├── allow-unicode-uris-that-resemble-unc-shares.md │ │ ├── appdomainsetupdynamicbase-no-longer-randomized-by.md │ │ ├── assemblies-compiled-with-regexcompiletoassembly-breaks-between-40-45.md │ │ ├── blockingcollectionlttgttrytakefromany-does-not-throw-anymore.md │ │ ├── calling-attributegetcustomattributes-on-an-indexer-property-no-longer-throws.md │ │ ├── change-behavior-for-taskwaitall-methods-with-time-out-arguments.md │ │ ├── compiler-support-for-type-forwarding-when-multi-targeting-mscorlib.md │ │ ├── concurrentdictionary-serialized-net-framework-45-with.md │ │ ├── concurrentqueuelttgttrypeek-can-return-an-erroneous-null-via-its-out.md │ │ ├── corprfgcroothandles-are-not-being-enumerated-by-profilers.md │ │ ├── deserialization-objects-across-appdomains-can-fail.md │ │ ├── etw-eventlisteners-do-not-capture-events-from-providers-with-explicit.md │ │ ├── eventlistener-truncates-strings-with-embedded-nulls.md │ │ ├── eventsourcewriteevent-impls-must-pass-writeevent-same-parameters-that-it.md │ │ ├── exceptions-during-unobserved-processing-systemthreadingtaskstask-no-longer.md │ │ ├── listsort-algorithm-changed.md │ │ ├── marshalsizeof-marshalptrtostructure-overloads-break-dynamic-code.md │ │ ├── missing-target-framework-moniker-results-40-behavior.md │ │ ├── net-com-successfully-marshals-byref-safearray-parameters-on-events.md │ │ ├── net-interop-will-now-queryinterface-for-iagileobject-a-winrt-interface.md │ │ ├── persian-calendar-now-uses-hijri-solar-algorithm.md │ │ ├── reflection-objects-can-no-longer-be-passed-from-managed-code-out-of-process.md │ │ ├── some-net-apis-cause-first-chance-handled-entrypointnotfoundexceptions.md │ │ ├── support-special-relative-uri-notation-when-unicode-present.md │ │ ├── systemthreadingtaskstask-no-longer-throw-objectdisposedexception-after.md │ │ ├── systemuri-escaping-now-supports-rfc-3986.md │ │ ├── targetframeworkname-for-default-app-domain-no-longer-defaults-null-if-not.md │ │ ├── winrt-stream-adapters-no-long-call-flushasync-automatically-on-close.md │ │ └── x509certificate2tostringboolean-does-not-throw-now-when-net-cannot-handle.md │ │ ├── data │ │ ├── attempting-tcpip-connection-sql-server-database-that-resolves-localhost.md │ │ ├── connection-pool-blocking-period-for-azure-sql-databases-removed.md │ │ ├── sqlbulkcopy-uses-destination-column-encoding-for-strings.md │ │ ├── sqlconnection-can-no-longer-connect-sql-server-1997-databases-using-via.md │ │ ├── sqlconnectionopen-fails-on-windows-7-with-non-ifs-winsock-bsp-lsp-present.md │ │ └── sqlvariant-data-uses-collation-rather-than-database.md │ │ ├── debugger │ │ └── null-coalescer-values-are-not-visible-debugger-until-one-step-later.md │ │ ├── ef │ │ ├── change-behavior-data-definition-language-ddl-apis.md │ │ ├── different-exception-handling-for-objectcontextcreatedatabase.md │ │ ├── ef-no-longer-throws-for-queryviews-with-specific-characteristics.md │ │ ├── entityframework-60-loads-very-slowly-apps-launched-from-visual-studio.md │ │ ├── log-file-name-created-by-objectcontextcreatedatabase-method-has-changed.md │ │ ├── objectcontexttranslate-objectcontextexecutestorequery-now-support-enum-type.md │ │ └── opt-in-break-revert-from-different-45-sql-generation-simpler-40.md │ │ ├── globalization │ │ └── unicode-standard-version-80-categories-now-supported.md │ │ ├── jit │ │ └── incorrect-code-generation-when-passing-comparing-uint16-values.md │ │ ├── linq │ │ └── enumerableemptylttresultgt-always-returns-cached-instance.md │ │ ├── mef │ │ └── mef-catalogs-implement-ienumerable-therefore-can-no-longer-be-used-create.md │ │ ├── networking │ │ ├── contentdisposition-datetimes-returns-slightly-different-string.md │ │ ├── deserialization-mailmessage-objects-serialized-under-net-framework-45-may.md │ │ └── systemnetpeertopeercollaboration-unavailable-on-windows-8.md │ │ ├── printing │ │ └── data-written-printsystemjobinfojobstream-must-be-xps-format.md │ │ ├── runtime │ │ └── improved-wcf-chain-trust-certificate-validation-for-nettcp-authentication.md │ │ ├── security │ │ ├── rsacng-dsacng-are-once-again-usable-partial-trust-scenarios.md │ │ ├── rsacngverifyhash-now-returns-false-for-any-verification-failure.md │ │ └── signedxml-encryptedxml-breaking-changes.md │ │ ├── serialization │ │ ├── binaryformatter-can-fail-find-type-from-loadfrom-context.md │ │ ├── exception-message-has-changed-for-failed-datacontract-serialization-case-an.md │ │ ├── netdatacontractserializer-fails-deserialize-concurrentdictionary-serialized.md │ │ ├── soapformatter-cannot-deserialize-hashtable-similar-ordered-collection.md │ │ └── xmlserializer-fails-while-serializing-type-that-hides-an-accessible-member.md │ │ ├── setup │ │ ├── net-framework-46-does-not-use-45xx-version-when-registering-itself-registry.md │ │ └── product-versioning-changes-net-framework-46-later-versions.md │ │ ├── tools │ │ └── contractinvariant-contractrequirestexception-do-not-consider.md │ │ ├── versionselector.md │ │ ├── wcf │ │ ├── error-codes-for-maxrequestlength-maxreceivedmessagesize-are-different.md │ │ ├── minfreememorypercentagetoactiveservice-now-respected.md │ │ ├── remove-ssl3-from-wcf-transportdefaults.md │ │ ├── replace-method-odata-urls-disabled-by-default.md │ │ ├── svctraceviewer-combobox-high-contrast-change.md │ │ ├── systemservicemodelwebwebservicehost-object-no-longer-adds-default-endpoint.md │ │ ├── wcf-addressheadercollection-now-throws-an-argumentexception-if-addressheader.md │ │ ├── wcf-msmqsecurehashalgorithm-default-value-now-sha256.md │ │ ├── wcf-pipeconnectiongethashalgorithm-now-uses-sha256.md │ │ └── wcf-services-that-use-nettcp-with-ssl-security-md5-certificate.md │ │ ├── web │ │ ├── dataannotationsdatatypeattributedisableregex-app-setting-on-by-default-net.md │ │ └── managed-browser-hosting-controls-from-net-framework-11-20-are-blocked.md │ │ ├── wf │ │ ├── systemactivities-now-aptca.md │ │ ├── wf-serializes-expressionsliterallttgt-datetimes-differently-now-breaks.md │ │ ├── workflow-now-throws-original-exception-instead-nullreferenceexception-some.md │ │ └── workflow-sql-persistence-adds-primary-key-clusters-disallows-null-values.md │ │ ├── winforms │ │ ├── previewlostkeyboardfocus-called-repeatedly-if-its-handler-shows-windows.md │ │ └── winforms-checkforoverflowunderflow-property-now-true-for-systemdrawing.md │ │ ├── wpf │ │ ├── accessing-wpf-datagrids-selected-items-from-handler-unloadingrow-event-can.md │ │ ├── calling-datagridcommitedit-from-celleditending-handler-drops-focus.md │ │ ├── calling-itemsrefresh-on-wpf-listbox-listview-datagrid-with-items-selected.md │ │ ├── chained-popups-with-staysopenfalse.md │ │ ├── changing-isenabled-property-parent-textblock-control-affects-any-child.md │ │ ├── coerceisselectionboxhighlighted.md │ │ ├── crash-selector-when-removing-an-item-from-custom-incc-collection.md │ │ ├── data-binding-improvement-for-keyedcollection.md │ │ ├── datagridcellspanelbringindexintoview-throws-argumentoutofrangeexception.md │ │ ├── fixed-hang-when-listbox-contains-duplicate-value-types.md │ │ ├── flowdocument-may-show-an-extra-line-text.md │ │ ├── glyphruncomputeinkboundingbox-formattedtextextent-return-different-values.md │ │ ├── horizontal-scrolling-virtualization.md │ │ ├── improvements-grid-star-rows-space-allocating-algorithm.md │ │ ├── intermittently-unable-scroll-bottom-item-itemscontrols-like-listbox-datagrid.md │ │ ├── item-scrolling-flat-list-with-items-different-pixel-height.md │ │ ├── itemsclear-does-not-remove-duplicates-from-selecteditems.md │ │ ├── keyboard-navigation-improvement-listbox-with-hyperlinks.md │ │ ├── keytips-behavior-improved-wpf.md │ │ ├── listboxitem-isselected-binding-issue-with-observablecollectionlttgtmove.md │ │ ├── new-enum-values-wpfs-pagerangeselection.md │ │ ├── objectdisposedexception-thrown-by-wpf-spellchecker.md │ │ ├── performance-improvement-automation-tree-for-grouping-itemscontrols.md │ │ ├── resizing-grid-can-hang.md │ │ ├── ribbongroup-background-set-transparent-localized-builds.md │ │ ├── right-clicking-on-wpf-datagrid-row-header-changes-selection.md │ │ ├── scrolling-wpf-treeview-grouped-listbox-virtualizingstackpanel-can-cause-hang.md │ │ ├── wpf-datatemplate-elements-are-now-visible-uia.md │ │ ├── wpf-dispatchersynchronizationcontextcreatecopy-now-returns-new-copy-instead.md │ │ ├── wpf-printing-stack-update.md │ │ ├── wpf-spawns-wisptisexe-process-which-can-freeze-mouse.md │ │ ├── wpf-spell-checking-fails-unexpected-ways.md │ │ ├── wpf-spell-checking-text-enabled-controls-will-not-work-windows-10-for.md │ │ ├── wpf-textbox-defaults-undo-limit-100.md │ │ ├── wpf-textbox-selected-text-appears-different-color-when-box-inactive.md │ │ ├── wpf-treeviewitem-must-be-used-within-treeview.md │ │ └── wpf-windows-are-rendered-without-clipping-when-extending-outside-single.md │ │ └── xml │ │ ├── xmlschemaexception-now-sets-line-positions-properly.md │ │ ├── xmltextreader-dtd-entity-expansion-limited-10000000-characters.md │ │ ├── xslt-forward-compat-now-works.md │ │ └── xslt-style-sheet-exception-message-changed.md ├── net-46-native-md.md ├── net-client-v40-long-md.md ├── net-core-22-md.md ├── net-core-30-md.md ├── net-current-v10plus-md.md ├── net-current-v11plus-md.md ├── net-current-v20plus-md.md ├── net-current-v30plus-md.md ├── net-current-v40plus-md.md ├── net-current-v451-nov-plus.md ├── net-current-v451plus-md.md ├── net-current-v452plus-md.md ├── net-current-v45plus-md.md ├── net-current-v461plus-md.md ├── net-current-v462plus-md.md ├── net-current-v46plus-md.md ├── net-current-v472plus.md ├── net-current-v47plus.md ├── net-current-version.md ├── net-framework-4x-versions.md ├── net-security-note-md.md ├── net-standard-table.md ├── net-win8-profile-md.md ├── netfx-current-long-md.md ├── netfx-current-short-md.md ├── netfx35-long-md.md ├── netfx35-short-md.md ├── netfx40-long-md.md ├── netfx40-short-md.md ├── note-settings-general-md.md ├── pcl-to-standard.md ├── pipelines-do-not-use-1.md ├── pipelines-do-not-use-2.md ├── preprocessor-symbols.md ├── roslyn-installation.md ├── sqltecxlinq-md.md ├── ssastoria-md.md ├── tla2sharptla-netframewkattrsharpplural-md.md ├── tla2sharptla-ui-md.md ├── tla2sharptla-uiautomation-md.md ├── tla2sharptla-win32-md.md ├── tla2sharptla-winclient-md.md ├── tla2sharptla-winnetsvrfam-md.md ├── tla2sharptla-winxp-md.md ├── tla2sharptla-winxpsp2-md.md ├── tla2sharptla-wpf-md.md ├── tla2sharptla-xaml-md.md ├── tlasharptla-ui-md.md ├── tlasharptla-uiautomation-md.md ├── tlasharptla-win32-md.md ├── tlasharptla-winclient-md.md ├── tlasharptla-winforms-md.md ├── tlasharptla-winnetsvrfam-md.md ├── tlasharptla-winnetsvrfamsp1-md.md ├── tlasharptla-winxp-md.md ├── tlasharptla-winxpsp2-md.md ├── tlasharptla-xaml-md.md ├── topic-appliesto-net-core-21plus.md ├── topic-appliesto-net-core-22plus.md ├── topic-appliesto-net-core-2plus.md ├── topic-appliesto-net-core-all.md ├── tpl-install-instructions.md ├── vb-separator-langversion.md ├── vbtecdlinq-md.md ├── vbteclinq-md.md ├── vbteclinqext-md.md ├── version-keys-note.md ├── wf1-md.md ├── wfd1-md.md ├── wfd2-md.md ├── win7-md.md ├── win8-appname-long-md.md ├── win8-appstore-long-md.md ├── win8-md.md ├── win81-md.md ├── winblue-server-2-md.md ├── windowsver-md.md ├── winserver8-md.md ├── winxp-md.md ├── winxpfamily-md.md ├── winxpsvr-md.md ├── ws2003-md.md ├── ws2003sp1-md.md ├── wv-md.md ├── wxp-md.md └── wxpsp2-md.md ├── index.md ├── issues-policy.md └── styleguide ├── images ├── area.png ├── guide.png ├── release.png ├── repository.png └── technology.png ├── labels-projects.md ├── template.md └── voice-tone.md /.acrolinx-config.edn: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/.acrolinx-config.edn -------------------------------------------------------------------------------- /.ghal.rules.json: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/.ghal.rules.json -------------------------------------------------------------------------------- /.gitattributes: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/.gitattributes -------------------------------------------------------------------------------- /.github/CODEOWNERS: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/.github/CODEOWNERS -------------------------------------------------------------------------------- /.github/no-response.yml: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/.github/no-response.yml -------------------------------------------------------------------------------- /.gitignore: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/.gitignore -------------------------------------------------------------------------------- /.markdownlint.json: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/.markdownlint.json -------------------------------------------------------------------------------- /.openpublishing.build.ps1: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/.openpublishing.build.ps1 -------------------------------------------------------------------------------- /.vscode/extensions.json: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/.vscode/extensions.json -------------------------------------------------------------------------------- /CODE_OF_CONDUCT.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/CODE_OF_CONDUCT.md -------------------------------------------------------------------------------- /CONTRIBUTING.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/CONTRIBUTING.md -------------------------------------------------------------------------------- /FETCH_HEAD: -------------------------------------------------------------------------------- 1 | -------------------------------------------------------------------------------- /LICENSE: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/LICENSE -------------------------------------------------------------------------------- /LICENSE-CODE: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/LICENSE-CODE -------------------------------------------------------------------------------- /README.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/README.md -------------------------------------------------------------------------------- /ThirdPartyNotices.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/ThirdPartyNotices.md -------------------------------------------------------------------------------- /_zip/missingapi.yml: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/_zip/missingapi.yml -------------------------------------------------------------------------------- /api/index.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/api/index.md -------------------------------------------------------------------------------- /appveyor.yml: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/appveyor.yml -------------------------------------------------------------------------------- /cSpell.json: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/cSpell.json -------------------------------------------------------------------------------- /data-constraints: -------------------------------------------------------------------------------- 1 | -------------------------------------------------------------------------------- /docfx.json: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docfx.json -------------------------------------------------------------------------------- /docs/architecture/toc.yml: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/architecture/toc.yml -------------------------------------------------------------------------------- /docs/breadcrumb/toc.yml: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/breadcrumb/toc.yml -------------------------------------------------------------------------------- /docs/core/about.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/core/about.md -------------------------------------------------------------------------------- /docs/core/build/index.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/core/build/index.md -------------------------------------------------------------------------------- /docs/core/get-started.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/core/get-started.md -------------------------------------------------------------------------------- /docs/core/index.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/core/index.md -------------------------------------------------------------------------------- /docs/core/packages.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/core/packages.md -------------------------------------------------------------------------------- /docs/core/porting/index.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/core/porting/index.md -------------------------------------------------------------------------------- /docs/core/porting/tools.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/core/porting/tools.md -------------------------------------------------------------------------------- /docs/core/rid-catalog.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/core/rid-catalog.md -------------------------------------------------------------------------------- /docs/core/sdk.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/core/sdk.md -------------------------------------------------------------------------------- /docs/core/testing/index.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/core/testing/index.md -------------------------------------------------------------------------------- /docs/core/toc.yml: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/core/toc.yml -------------------------------------------------------------------------------- /docs/core/tools/csproj.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/core/tools/csproj.md -------------------------------------------------------------------------------- /docs/core/tools/dotnet.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/core/tools/dotnet.md -------------------------------------------------------------------------------- /docs/core/tools/index.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/core/tools/index.md -------------------------------------------------------------------------------- /docs/csharp/async.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/async.md -------------------------------------------------------------------------------- /docs/csharp/basic-types.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/basic-types.md -------------------------------------------------------------------------------- /docs/csharp/codedoc.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/codedoc.md -------------------------------------------------------------------------------- /docs/csharp/deconstruct.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/deconstruct.md -------------------------------------------------------------------------------- /docs/csharp/discards.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/discards.md -------------------------------------------------------------------------------- /docs/csharp/index.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/index.md -------------------------------------------------------------------------------- /docs/csharp/indexers.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/indexers.md -------------------------------------------------------------------------------- /docs/csharp/iterators.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/iterators.md -------------------------------------------------------------------------------- /docs/csharp/linq/index.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/linq/index.md -------------------------------------------------------------------------------- /docs/csharp/methods.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/methods.md -------------------------------------------------------------------------------- /docs/csharp/misc/CS4009.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/CS4009.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0003.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0003.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0004.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0004.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0005.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0005.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0008.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0008.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0009.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0009.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0010.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0010.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0011.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0011.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0012.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0012.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0013.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0013.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0014.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0014.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0017.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0017.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0020.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0020.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0021.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0021.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0022.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0022.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0023.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0023.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0025.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0025.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0026.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0026.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0027.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0027.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0028.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0028.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0030.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0030.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0031.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0031.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0035.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0035.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0036.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0036.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0037.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0037.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0040.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0040.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0041.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0041.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0042.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0042.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0043.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0043.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0053.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0053.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0054.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0054.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0055.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0055.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0056.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0056.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0057.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0057.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0058.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0058.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0059.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0059.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0060.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0060.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0061.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0061.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0065.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0065.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0066.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0066.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0067.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0067.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0068.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0068.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0069.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0069.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0070.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0070.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0072.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0072.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0073.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0073.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0074.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0074.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0075.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0075.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0076.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0076.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0077.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0077.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0078.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0078.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0079.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0079.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0080.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0080.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0081.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0081.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0082.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0082.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0100.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0100.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0101.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0101.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0102.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0102.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0104.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0104.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0105.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0105.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0107.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0107.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0109.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0109.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0110.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0110.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0111.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0111.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0112.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0112.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0113.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0113.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0114.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0114.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0117.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0117.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0118.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0118.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0119.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0119.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0121.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0121.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0123.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0123.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0126.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0126.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0127.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0127.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0128.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0128.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0131.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0131.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0132.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0132.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0133.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0133.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0135.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0135.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0136.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0136.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0138.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0138.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0139.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0139.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0140.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0140.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0143.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0143.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0144.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0144.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0145.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0145.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0146.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0146.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0148.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0148.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0149.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0149.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0150.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0150.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0152.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0152.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0153.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0153.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0154.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0154.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0155.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0155.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0156.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0156.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0157.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0157.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0158.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0158.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0159.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0159.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0160.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0160.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0161.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0161.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0162.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0162.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0164.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0164.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0167.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0167.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0168.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0168.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0169.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0169.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0170.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0170.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0171.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0171.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0172.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0172.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0174.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0174.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0175.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0175.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0176.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0176.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0177.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0177.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0179.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0179.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0180.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0180.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0182.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0182.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0183.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0183.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0184.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0184.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0185.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0185.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0186.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0186.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0191.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0191.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0192.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0192.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0193.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0193.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0196.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0196.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0197.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0197.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0198.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0198.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0199.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0199.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0200.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0200.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0202.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0202.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0204.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0204.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0205.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0205.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0206.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0206.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0208.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0208.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0209.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0209.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0210.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0210.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0211.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0211.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0212.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0212.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0213.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0213.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0214.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0214.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0215.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0215.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0216.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0216.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0217.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0217.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0218.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0218.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0219.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0219.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0220.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0220.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0221.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0221.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0225.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0225.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0226.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0226.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0227.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0227.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0228.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0228.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0230.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0230.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0231.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0231.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0236.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0236.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0238.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0238.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0239.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0239.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0241.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0241.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0242.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0242.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0243.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0243.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0244.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0244.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0245.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0245.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0247.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0247.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0248.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0248.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0249.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0249.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0250.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0250.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0251.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0251.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0252.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0252.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0253.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0253.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0254.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0254.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0255.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0255.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0261.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0261.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0262.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0262.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0263.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0263.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0264.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0264.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0265.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0265.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0267.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0267.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0268.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0268.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0271.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0271.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0272.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0272.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0273.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0273.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0274.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0274.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0275.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0275.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0276.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0276.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0277.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0277.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0278.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0278.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0279.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0279.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0280.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0280.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0281.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0281.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0282.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0282.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0283.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0283.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0305.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0305.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0306.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0306.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0307.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0307.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0308.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0308.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0312.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0312.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0313.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0313.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0314.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0314.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0315.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0315.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0316.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0316.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0400.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0400.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0401.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0401.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0402.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0402.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0403.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0403.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0404.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0404.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0405.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0405.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0406.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0406.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0407.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0407.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0409.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0409.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0410.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0410.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0411.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0411.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0412.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0412.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0414.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0414.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0415.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0415.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0416.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0416.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0418.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0418.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0419.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0419.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0422.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0422.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0423.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0423.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0424.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0424.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0425.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0425.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0426.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0426.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0428.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0428.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0430.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0430.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0431.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0431.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0432.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0432.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0434.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0434.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0435.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0435.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0436.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0436.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0437.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0437.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0438.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0438.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0439.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0439.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0440.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0440.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0441.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0441.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0442.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0442.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0443.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0443.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0444.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0444.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0447.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0447.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0448.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0448.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0449.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0449.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0450.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0450.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0451.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0451.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0452.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0452.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0453.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0453.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0454.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0454.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0455.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0455.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0456.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0456.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0457.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0457.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0458.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0458.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0459.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0459.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0460.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0460.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0462.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0462.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0463.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0463.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0464.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0464.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0466.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0466.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0468.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0468.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0469.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0469.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0470.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0470.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0471.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0471.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0472.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0472.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0473.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0473.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0500.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0500.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0501.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0501.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0502.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0502.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0503.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0503.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0505.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0505.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0506.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0506.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0508.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0508.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0509.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0509.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0513.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0513.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0514.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0514.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0515.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0515.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0516.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0516.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0517.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0517.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0520.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0520.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0522.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0522.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0524.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0524.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0525.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0525.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0526.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0526.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0527.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0527.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0528.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0528.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0529.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0529.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0531.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0531.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0533.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0533.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0534.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0534.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0535.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0535.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0537.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0537.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0538.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0538.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0539.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0539.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0540.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0540.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0541.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0541.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0542.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0542.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0543.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0543.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0544.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0544.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0546.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0546.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0547.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0547.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0548.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0548.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0549.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0549.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0550.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0550.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0551.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0551.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0553.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0553.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0554.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0554.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0555.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0555.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0556.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0556.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0557.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0557.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0558.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0558.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0559.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0559.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0562.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0562.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0564.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0564.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0567.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0567.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0568.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0568.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0569.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0569.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0572.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0572.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0573.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0573.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0574.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0574.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0575.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0575.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0576.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0576.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0577.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0577.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0578.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0578.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0582.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0582.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0583.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0583.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0584.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0584.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0585.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0585.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0586.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0586.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0587.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0587.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0588.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0588.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0589.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0589.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0590.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0590.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0591.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0591.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0594.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0594.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0596.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0596.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0599.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0599.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0601.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0601.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0602.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0602.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0609.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0609.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0610.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0610.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0611.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0611.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0612.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0612.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0617.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0617.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0619.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0619.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0620.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0620.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0621.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0621.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0622.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0622.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0623.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0623.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0625.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0625.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0626.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0626.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0628.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0628.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0629.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0629.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0631.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0631.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0633.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0633.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0635.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0635.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0636.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0636.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0637.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0637.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0641.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0641.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0642.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0642.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0643.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0643.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0644.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0644.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0645.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0645.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0646.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0646.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0647.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0647.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0648.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0648.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0649.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0649.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0652.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0652.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0653.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0653.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0655.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0655.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0656.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0656.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0657.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0657.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0658.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0658.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0659.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0659.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0660.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0660.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0661.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0661.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0662.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0662.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0663.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0663.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0664.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0664.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0665.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0665.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0666.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0666.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0667.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0667.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0668.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0668.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0669.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0669.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0670.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0670.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0672.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0672.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0673.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0673.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0674.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0674.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0677.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0677.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0678.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0678.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0681.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0681.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0682.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0682.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0683.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0683.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0684.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0684.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0685.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0685.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0687.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0687.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0688.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0688.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0689.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0689.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0690.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0690.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0692.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0692.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0693.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0693.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0694.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0694.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0695.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0695.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0698.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0698.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0699.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0699.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0701.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0701.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0704.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0704.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0706.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0706.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0708.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0708.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0709.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0709.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0710.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0710.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0711.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0711.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0712.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0712.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0713.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0713.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0714.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0714.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0715.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0715.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0716.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0716.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0717.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0717.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0718.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0718.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0719.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0719.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0720.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0720.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0721.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0721.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0722.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0722.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0723.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0723.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0724.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0724.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0726.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0726.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0727.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0727.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0728.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0728.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0729.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0729.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0730.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0730.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0733.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0733.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0734.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0734.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0735.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0735.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0736.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0736.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0737.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0737.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0738.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0738.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0739.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0739.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0742.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0742.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0743.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0743.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0744.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0744.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0745.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0745.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0746.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0746.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0747.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0747.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0748.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0748.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0750.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0750.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0751.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0751.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0752.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0752.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0753.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0753.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0754.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0754.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0755.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0755.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0756.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0756.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0757.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0757.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0758.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0758.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0759.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0759.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0761.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0761.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0762.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0762.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0763.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0763.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0764.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0764.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0765.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0765.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0766.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0766.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0809.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0809.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0811.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0811.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0815.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0815.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0818.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0818.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0819.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0819.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0820.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0820.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0821.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0821.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0822.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0822.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0824.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0824.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0825.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0825.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0828.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0828.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0831.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0831.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0832.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0832.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0833.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0833.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0835.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0835.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0836.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0836.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0837.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0837.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0838.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0838.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0839.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0839.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0841.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0841.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0842.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0842.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs0844.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs0844.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1002.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1002.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1003.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1003.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1004.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1004.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1007.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1007.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1008.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1008.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1010.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1010.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1011.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1011.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1012.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1012.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1013.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1013.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1014.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1014.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1015.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1015.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1016.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1016.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1017.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1017.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1020.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1020.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1021.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1021.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1022.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1022.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1023.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1023.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1024.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1024.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1025.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1025.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1027.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1027.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1028.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1028.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1030.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1030.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1031.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1031.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1032.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1032.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1033.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1033.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1034.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1034.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1035.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1035.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1036.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1036.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1037.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1037.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1038.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1038.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1039.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1039.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1040.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1040.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1041.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1041.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1043.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1043.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1044.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1044.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1055.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1055.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1056.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1056.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1057.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1057.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1059.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1059.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1100.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1100.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1101.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1101.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1102.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1102.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1103.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1103.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1104.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1104.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1105.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1105.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1106.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1106.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1107.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1107.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1108.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1108.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1109.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1109.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1110.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1110.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1113.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1113.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1200.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1200.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1201.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1201.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1202.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1202.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1203.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1203.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1503.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1503.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1504.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1504.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1507.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1507.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1508.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1508.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1509.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1509.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1510.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1510.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1511.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1511.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1512.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1512.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1513.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1513.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1514.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1514.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1515.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1515.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1517.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1517.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1518.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1518.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1520.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1520.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1521.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1521.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1522.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1522.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1524.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1524.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1525.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1525.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1526.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1526.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1527.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1527.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1528.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1528.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1529.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1529.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1530.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1530.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1534.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1534.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1535.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1535.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1536.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1536.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1537.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1537.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1541.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1541.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1542.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1542.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1545.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1545.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1547.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1547.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1551.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1551.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1552.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1552.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1553.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1553.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1554.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1554.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1555.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1555.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1556.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1556.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1557.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1557.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1558.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1558.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1559.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1559.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1560.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1560.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1561.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1561.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1562.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1562.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1563.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1563.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1565.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1565.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1566.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1566.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1569.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1569.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1570.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1570.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1571.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1571.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1572.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1572.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1573.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1573.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1574.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1574.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1575.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1575.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1576.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1576.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1577.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1577.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1578.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1578.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1580.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1580.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1581.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1581.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1583.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1583.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1584.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1584.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1585.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1585.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1586.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1586.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1587.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1587.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1588.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1588.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1589.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1589.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1590.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1590.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1592.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1592.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1593.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1593.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1594.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1594.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1597.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1597.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1599.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1599.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1600.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1600.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1601.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1601.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1604.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1604.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1605.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1605.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1606.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1606.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1608.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1608.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1609.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1609.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1611.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1611.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1613.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1613.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1615.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1615.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1617.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1617.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1618.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1618.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1619.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1619.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1620.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1620.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1621.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1621.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1622.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1622.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1623.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1623.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1624.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1624.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1625.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1625.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1626.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1626.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1627.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1627.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1628.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1628.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1629.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1629.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1630.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1630.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1631.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1631.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1632.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1632.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1633.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1633.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1634.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1634.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1635.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1635.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1637.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1637.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1638.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1638.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1639.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1639.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1641.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1641.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1642.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1642.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1643.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1643.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1645.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1645.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1646.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1646.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1647.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1647.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1648.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1648.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1649.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1649.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1650.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1650.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1651.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1651.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1654.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1654.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1655.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1655.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1657.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1657.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1660.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1660.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1661.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1661.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1662.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1662.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1663.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1663.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1664.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1664.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1665.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1665.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1666.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1666.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1667.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1667.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1668.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1668.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1670.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1670.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1671.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1671.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1672.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1672.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1673.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1673.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1675.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1675.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1676.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1676.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1677.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1677.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1678.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1678.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1679.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1679.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1680.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1680.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1681.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1681.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1682.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1682.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1684.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1684.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1686.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1686.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1687.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1687.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1688.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1688.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1689.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1689.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1692.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1692.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1694.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1694.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1695.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1695.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1696.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1696.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1697.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1697.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1698.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1698.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1702.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1702.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1706.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1706.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1707.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1707.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1709.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1709.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1710.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1710.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1711.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1711.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1712.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1712.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1713.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1713.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1714.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1714.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1715.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1715.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1717.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1717.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1718.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1718.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1719.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1719.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1720.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1720.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1722.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1722.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1723.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1723.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1724.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1724.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1725.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1725.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1727.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1727.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1728.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1728.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1730.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1730.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1731.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1731.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1732.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1732.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1733.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1733.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1900.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1900.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1902.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1902.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1906.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1906.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1908.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1908.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1909.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1909.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1910.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1910.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1911.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1911.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1912.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1912.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1913.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1913.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1914.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1914.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1917.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1917.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1918.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1918.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1920.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1920.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1922.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1922.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1925.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1925.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1927.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1927.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1928.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1928.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1929.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1929.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1930.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1930.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1931.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1931.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1932.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1932.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1934.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1934.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1935.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1935.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1937.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1937.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1938.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1938.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1939.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1939.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1940.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1940.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1944.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1944.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1945.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1945.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1947.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1947.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1948.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1948.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1949.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1949.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1950.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1950.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1951.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1951.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1952.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1952.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1953.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1953.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1954.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1954.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1955.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1955.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1957.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1957.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1958.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1958.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs1959.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs1959.md -------------------------------------------------------------------------------- /docs/csharp/misc/cs2001.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/misc/cs2001.md -------------------------------------------------------------------------------- /docs/csharp/structs.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/structs.md -------------------------------------------------------------------------------- /docs/csharp/toc.yml: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/toc.yml -------------------------------------------------------------------------------- /docs/csharp/tuples.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/csharp/tuples.md -------------------------------------------------------------------------------- /docs/csharp/whats-new/index.md: -------------------------------------------------------------------------------- 1 | --- 2 | redirect_url: csharp-8 3 | ms.custom: "updateeachrelease" 4 | --- 5 | -------------------------------------------------------------------------------- /docs/desktop-wpf/data/index.md: -------------------------------------------------------------------------------- 1 | --- 2 | redirect_url: data-binding-overview 3 | --- -------------------------------------------------------------------------------- /docs/desktop-wpf/fundamentals/index.md: -------------------------------------------------------------------------------- 1 | --- 2 | redirect_url: xaml 3 | --- -------------------------------------------------------------------------------- /docs/desktop-wpf/index.md: -------------------------------------------------------------------------------- 1 | --- 2 | redirect_url: overview/index 3 | --- -------------------------------------------------------------------------------- /docs/desktop-wpf/migration/index.md: -------------------------------------------------------------------------------- 1 | --- 2 | redirect_url: differences-from-net-framework 3 | --- -------------------------------------------------------------------------------- /docs/desktop-wpf/toc.yml: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/desktop-wpf/toc.yml -------------------------------------------------------------------------------- /docs/framework/index.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/framework/index.md -------------------------------------------------------------------------------- /docs/framework/toc.yml: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/framework/toc.yml -------------------------------------------------------------------------------- /docs/fsharp/index.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/fsharp/index.md -------------------------------------------------------------------------------- /docs/fsharp/toc.yml: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/fsharp/toc.yml -------------------------------------------------------------------------------- /docs/fsharp/tour.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/fsharp/tour.md -------------------------------------------------------------------------------- /docs/images/hub/grpc.svg: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/images/hub/grpc.svg -------------------------------------------------------------------------------- /docs/project-json.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/project-json.md -------------------------------------------------------------------------------- /docs/spark/index.yml: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/spark/index.yml -------------------------------------------------------------------------------- /docs/spark/toc.yml: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/spark/toc.yml -------------------------------------------------------------------------------- /docs/standard/async.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/standard/async.md -------------------------------------------------------------------------------- /docs/standard/clr.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/standard/clr.md -------------------------------------------------------------------------------- /docs/standard/index.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/standard/index.md -------------------------------------------------------------------------------- /docs/standard/io/toc.yml: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/standard/io/toc.yml -------------------------------------------------------------------------------- /docs/standard/toc.yml: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/standard/toc.yml -------------------------------------------------------------------------------- /docs/standard/tour.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/standard/tour.md -------------------------------------------------------------------------------- /docs/toc.yml: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/toc.yml -------------------------------------------------------------------------------- /docs/welcome.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/docs/welcome.md -------------------------------------------------------------------------------- /images/Logo_DotNet.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/images/Logo_DotNet.png -------------------------------------------------------------------------------- /images/alerts.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/images/alerts.png -------------------------------------------------------------------------------- /includes/book-preview.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/includes/book-preview.md -------------------------------------------------------------------------------- /includes/esql-md.md: -------------------------------------------------------------------------------- 1 | Entity SQL 2 | -------------------------------------------------------------------------------- /includes/lserver-md.md: -------------------------------------------------------------------------------- 1 | Windows Server 2008 2 | -------------------------------------------------------------------------------- /includes/net-46-native-md.md: -------------------------------------------------------------------------------- 1 | Available since 4.6, .NET Native only 2 | -------------------------------------------------------------------------------- /includes/net-client-v40-long-md.md: -------------------------------------------------------------------------------- 1 | .NET Framework 4 Client Profile 2 | -------------------------------------------------------------------------------- /includes/net-core-22-md.md: -------------------------------------------------------------------------------- 1 | Available since .NET Core 2.2 2 | -------------------------------------------------------------------------------- /includes/net-core-30-md.md: -------------------------------------------------------------------------------- 1 | Available since .NET Core 3.0 2 | -------------------------------------------------------------------------------- /includes/net-current-v10plus-md.md: -------------------------------------------------------------------------------- 1 | Available since 1.0 2 | -------------------------------------------------------------------------------- /includes/net-current-v11plus-md.md: -------------------------------------------------------------------------------- 1 | Available since 1.1 2 | -------------------------------------------------------------------------------- /includes/net-current-v20plus-md.md: -------------------------------------------------------------------------------- 1 | Available since 2.0 2 | -------------------------------------------------------------------------------- /includes/net-current-v40plus-md.md: -------------------------------------------------------------------------------- 1 | Available since 4 2 | -------------------------------------------------------------------------------- /includes/net-current-v451-nov-plus.md: -------------------------------------------------------------------------------- 1 | Available since November 2013 update to 4.5.1 2 | -------------------------------------------------------------------------------- /includes/net-current-v451plus-md.md: -------------------------------------------------------------------------------- 1 | Available since 4.5.1 2 | -------------------------------------------------------------------------------- /includes/net-current-v452plus-md.md: -------------------------------------------------------------------------------- 1 | Available since 4.5.2 2 | -------------------------------------------------------------------------------- /includes/net-current-v45plus-md.md: -------------------------------------------------------------------------------- 1 | Available since 4.5 2 | -------------------------------------------------------------------------------- /includes/net-current-v461plus-md.md: -------------------------------------------------------------------------------- 1 | Available since 4.6.1 2 | -------------------------------------------------------------------------------- /includes/net-current-v462plus-md.md: -------------------------------------------------------------------------------- 1 | Available since 4.6.2 2 | -------------------------------------------------------------------------------- /includes/net-current-v46plus-md.md: -------------------------------------------------------------------------------- 1 | Available since 4.6 2 | -------------------------------------------------------------------------------- /includes/net-current-v472plus.md: -------------------------------------------------------------------------------- 1 | Available since 4.7.2 2 | -------------------------------------------------------------------------------- /includes/net-current-v47plus.md: -------------------------------------------------------------------------------- 1 | Available since 4.7 2 | -------------------------------------------------------------------------------- /includes/net-current-version.md: -------------------------------------------------------------------------------- 1 | .NET Framework 4.8 2 | -------------------------------------------------------------------------------- /includes/net-win8-profile-md.md: -------------------------------------------------------------------------------- 1 | .NET for Windows 8.x Store apps 2 | -------------------------------------------------------------------------------- /includes/netfx-current-long-md.md: -------------------------------------------------------------------------------- 1 | .NET Framework 4.6.1 2 | -------------------------------------------------------------------------------- /includes/netfx-current-short-md.md: -------------------------------------------------------------------------------- 1 | .NET Framework 4.6.1 2 | -------------------------------------------------------------------------------- /includes/netfx35-long-md.md: -------------------------------------------------------------------------------- 1 | .NET Framework version 3.5 2 | -------------------------------------------------------------------------------- /includes/netfx35-short-md.md: -------------------------------------------------------------------------------- 1 | .NET Framework 3.5 2 | -------------------------------------------------------------------------------- /includes/netfx40-long-md.md: -------------------------------------------------------------------------------- 1 | .NET Framework version 4 2 | -------------------------------------------------------------------------------- /includes/netfx40-short-md.md: -------------------------------------------------------------------------------- 1 | .NET Framework 4 2 | -------------------------------------------------------------------------------- /includes/sqltecxlinq-md.md: -------------------------------------------------------------------------------- 1 | LINQ to XML 2 | -------------------------------------------------------------------------------- /includes/ssastoria-md.md: -------------------------------------------------------------------------------- 1 | WCF Data Services 2 | -------------------------------------------------------------------------------- /includes/tla2sharptla-netframewkattrsharpplural-md.md: -------------------------------------------------------------------------------- 1 | .NET Framework attributes 2 | -------------------------------------------------------------------------------- /includes/tla2sharptla-ui-md.md: -------------------------------------------------------------------------------- 1 | UI 2 | -------------------------------------------------------------------------------- /includes/tla2sharptla-uiautomation-md.md: -------------------------------------------------------------------------------- 1 | UI Automation 2 | -------------------------------------------------------------------------------- /includes/tla2sharptla-win32-md.md: -------------------------------------------------------------------------------- 1 | Win32 2 | -------------------------------------------------------------------------------- /includes/tla2sharptla-winclient-md.md: -------------------------------------------------------------------------------- 1 | WPF 2 | -------------------------------------------------------------------------------- /includes/tla2sharptla-winnetsvrfam-md.md: -------------------------------------------------------------------------------- 1 | Windows Server 2003 2 | -------------------------------------------------------------------------------- /includes/tla2sharptla-winxp-md.md: -------------------------------------------------------------------------------- 1 | Microsoft Windows XP 2 | -------------------------------------------------------------------------------- /includes/tla2sharptla-winxpsp2-md.md: -------------------------------------------------------------------------------- 1 | Windows XP SP2 2 | -------------------------------------------------------------------------------- /includes/tla2sharptla-wpf-md.md: -------------------------------------------------------------------------------- 1 | WPF 2 | -------------------------------------------------------------------------------- /includes/tla2sharptla-xaml-md.md: -------------------------------------------------------------------------------- 1 | XAML 2 | -------------------------------------------------------------------------------- /includes/tlasharptla-ui-md.md: -------------------------------------------------------------------------------- 1 | user interface (UI) 2 | -------------------------------------------------------------------------------- /includes/tlasharptla-uiautomation-md.md: -------------------------------------------------------------------------------- 1 | Microsoft UI Automation 2 | -------------------------------------------------------------------------------- /includes/tlasharptla-win32-md.md: -------------------------------------------------------------------------------- 1 | Win32 2 | -------------------------------------------------------------------------------- /includes/tlasharptla-winforms-md.md: -------------------------------------------------------------------------------- 1 | Windows Forms 2 | -------------------------------------------------------------------------------- /includes/tlasharptla-winnetsvrfam-md.md: -------------------------------------------------------------------------------- 1 | Microsoft Windows Server 2003 2 | -------------------------------------------------------------------------------- /includes/tlasharptla-winnetsvrfamsp1-md.md: -------------------------------------------------------------------------------- 1 | Microsoft Windows Server 2003 (SP1) 2 | -------------------------------------------------------------------------------- /includes/tlasharptla-winxp-md.md: -------------------------------------------------------------------------------- 1 | Microsoft Windows XP 2 | -------------------------------------------------------------------------------- /includes/tlasharptla-winxpsp2-md.md: -------------------------------------------------------------------------------- 1 | Microsoft Windows XP Service Pack 2 (SP2) 2 | -------------------------------------------------------------------------------- /includes/tlasharptla-xaml-md.md: -------------------------------------------------------------------------------- 1 | Extensible Application Markup Language (XAML) 2 | -------------------------------------------------------------------------------- /includes/topic-appliesto-net-core-21plus.md: -------------------------------------------------------------------------------- 1 | **This article applies to: ✓** .NET Core 2.1 SDK 2 | -------------------------------------------------------------------------------- /includes/topic-appliesto-net-core-2plus.md: -------------------------------------------------------------------------------- 1 | **This article applies to: ✓** .NET Core 2.x SDK 2 | -------------------------------------------------------------------------------- /includes/vbtecdlinq-md.md: -------------------------------------------------------------------------------- 1 | LINQ to SQL 2 | -------------------------------------------------------------------------------- /includes/vbteclinq-md.md: -------------------------------------------------------------------------------- 1 | LINQ 2 | -------------------------------------------------------------------------------- /includes/vbteclinqext-md.md: -------------------------------------------------------------------------------- 1 | Language-Integrated Query (LINQ) 2 | -------------------------------------------------------------------------------- /includes/wf1-md.md: -------------------------------------------------------------------------------- 1 | WF 2 | -------------------------------------------------------------------------------- /includes/wfd1-md.md: -------------------------------------------------------------------------------- 1 | Windows Workflow Designer 2 | -------------------------------------------------------------------------------- /includes/wfd2-md.md: -------------------------------------------------------------------------------- 1 | Workflow Designer 2 | -------------------------------------------------------------------------------- /includes/win7-md.md: -------------------------------------------------------------------------------- 1 | Windows 7 2 | -------------------------------------------------------------------------------- /includes/win8-appname-long-md.md: -------------------------------------------------------------------------------- 1 | Windows 8.x Store 2 | -------------------------------------------------------------------------------- /includes/win8-appstore-long-md.md: -------------------------------------------------------------------------------- 1 | Windows Store 2 | -------------------------------------------------------------------------------- /includes/win8-md.md: -------------------------------------------------------------------------------- 1 | Windows 8 2 | -------------------------------------------------------------------------------- /includes/win81-md.md: -------------------------------------------------------------------------------- 1 | Windows 8.1 2 | -------------------------------------------------------------------------------- /includes/winblue-server-2-md.md: -------------------------------------------------------------------------------- 1 | Windows Server 2012 R2 2 | -------------------------------------------------------------------------------- /includes/windowsver-md.md: -------------------------------------------------------------------------------- 1 | Windows Vista 2 | -------------------------------------------------------------------------------- /includes/winserver8-md.md: -------------------------------------------------------------------------------- 1 | Windows Server 2012 2 | -------------------------------------------------------------------------------- /includes/winxp-md.md: -------------------------------------------------------------------------------- 1 | Windows XP 2 | -------------------------------------------------------------------------------- /includes/winxpsvr-md.md: -------------------------------------------------------------------------------- 1 | Windows Server 2003 2 | -------------------------------------------------------------------------------- /includes/ws2003-md.md: -------------------------------------------------------------------------------- 1 | Windows Server 2003 2 | -------------------------------------------------------------------------------- /includes/ws2003sp1-md.md: -------------------------------------------------------------------------------- 1 | Windows Server 2003 SP1 2 | -------------------------------------------------------------------------------- /includes/wv-md.md: -------------------------------------------------------------------------------- 1 | Windows Vista 2 | -------------------------------------------------------------------------------- /includes/wxp-md.md: -------------------------------------------------------------------------------- 1 | Windows XP 2 | -------------------------------------------------------------------------------- /includes/wxpsp2-md.md: -------------------------------------------------------------------------------- 1 | Windows XP SP2 2 | -------------------------------------------------------------------------------- /index.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/index.md -------------------------------------------------------------------------------- /issues-policy.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/issues-policy.md -------------------------------------------------------------------------------- /styleguide/template.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/styleguide/template.md -------------------------------------------------------------------------------- /styleguide/voice-tone.md: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/dotnet-architecture/docs/HEAD/styleguide/voice-tone.md --------------------------------------------------------------------------------