├── proteins ├── output │ └── README.md ├── README.md ├── parse_with_biopython.py ├── summarize.py └── parse_uniprot.py ├── slides ├── build.sh ├── images │ ├── fire.png │ ├── log.png │ ├── print.png │ ├── bisection.png │ ├── scimethod.png │ ├── thank_you.png │ ├── indentation.png │ ├── propagation.png │ ├── propythonbp.png │ ├── rubber_duck.jpg │ ├── verbosity_levels.png │ └── LICENSE.TXT └── reveal.js │ ├── lib │ ├── font │ │ ├── league-gothic │ │ │ ├── LICENSE │ │ │ ├── league-gothic.eot │ │ │ ├── league-gothic.ttf │ │ │ ├── league-gothic.woff │ │ │ └── league-gothic.css │ │ └── source-sans-pro │ │ │ ├── source-sans-pro-italic.eot │ │ │ ├── source-sans-pro-italic.ttf │ │ │ ├── source-sans-pro-italic.woff │ │ │ ├── source-sans-pro-regular.eot │ │ │ ├── source-sans-pro-regular.ttf │ │ │ ├── source-sans-pro-regular.woff │ │ │ ├── source-sans-pro-semibold.eot │ │ │ ├── source-sans-pro-semibold.ttf │ │ │ ├── source-sans-pro-semibold.woff │ │ │ ├── source-sans-pro-semibolditalic.eot │ │ │ ├── source-sans-pro-semibolditalic.ttf │ │ │ ├── source-sans-pro-semibolditalic.woff │ │ │ ├── source-sans-pro.css │ │ │ └── LICENSE │ ├── js │ │ ├── html5shiv.js │ │ └── classList.js │ └── css │ │ └── zenburn.css │ ├── test │ ├── examples │ │ ├── assets │ │ │ ├── image1.png │ │ │ └── image2.png │ │ ├── barebones.html │ │ ├── embedded-media.html │ │ ├── slide-transitions.html │ │ ├── slide-backgrounds.html │ │ └── math.html │ ├── test-markdown.js │ ├── test-pdf.js │ ├── test-markdown.html │ ├── test-pdf.html │ ├── test.html │ ├── test-markdown-element-attributes.js │ ├── test-markdown-slide-attributes.js │ ├── test-markdown-slide-attributes.html │ ├── test-markdown-element-attributes.html │ └── qunit-1.12.0.css │ ├── plugin │ ├── markdown │ │ ├── example.md │ │ └── example.html │ ├── multiplex │ │ ├── client.js │ │ ├── package.json │ │ ├── master.js │ │ └── index.js │ ├── print-pdf │ │ └── print-pdf.js │ ├── math │ │ └── math.js │ ├── notes-server │ │ ├── index.js │ │ └── client.js │ ├── notes │ │ └── notes.js │ └── search │ │ └── search.js │ ├── bower.json │ ├── css │ ├── theme │ │ ├── source │ │ │ ├── night.scss │ │ │ ├── serif.scss │ │ │ ├── league.scss │ │ │ ├── simple.scss │ │ │ ├── sky.scss │ │ │ ├── beige.scss │ │ │ ├── black.scss │ │ │ ├── white.scss │ │ │ ├── moon.scss │ │ │ ├── solarized.scss │ │ │ └── blood.scss │ │ ├── template │ │ │ ├── settings.scss │ │ │ ├── mixins.scss │ │ │ └── theme.scss │ │ ├── README.md │ │ ├── night.css │ │ ├── serif.css │ │ ├── moon.css │ │ ├── solarized.css │ │ ├── white.css │ │ ├── black.css │ │ └── simple.css │ └── print │ │ ├── pdf.css │ │ └── paper.css │ ├── LICENSE │ ├── CONTRIBUTING.md │ ├── package.json │ ├── index.html │ └── Gruntfile.js ├── twenty_questions ├── twenty_questions_easy.py └── twenty_questions.py ├── solutions ├── twenty_questions_easy.py ├── mini_input.fasta ├── delta_debug_animals.py ├── parse_with_biopython.py ├── create_json.py ├── summarize.py ├── parse_uniprot.py └── twenty_questions.py ├── nuke_door └── nuke_door.py └── README.md /proteins/output/README.md: -------------------------------------------------------------------------------- 1 | here output files will be stored. 2 | -------------------------------------------------------------------------------- /slides/build.sh: -------------------------------------------------------------------------------- 1 | jupyter nbconvert debugging.ipynb --to slides --post serve 2 | -------------------------------------------------------------------------------- /slides/images/fire.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/images/fire.png -------------------------------------------------------------------------------- /slides/images/log.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/images/log.png -------------------------------------------------------------------------------- /slides/images/print.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/images/print.png -------------------------------------------------------------------------------- /slides/images/bisection.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/images/bisection.png -------------------------------------------------------------------------------- /slides/images/scimethod.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/images/scimethod.png -------------------------------------------------------------------------------- /slides/images/thank_you.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/images/thank_you.png -------------------------------------------------------------------------------- /slides/images/indentation.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/images/indentation.png -------------------------------------------------------------------------------- /slides/images/propagation.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/images/propagation.png -------------------------------------------------------------------------------- /slides/images/propythonbp.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/images/propythonbp.png -------------------------------------------------------------------------------- /slides/images/rubber_duck.jpg: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/images/rubber_duck.jpg -------------------------------------------------------------------------------- /slides/images/verbosity_levels.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/images/verbosity_levels.png -------------------------------------------------------------------------------- /slides/reveal.js/lib/font/league-gothic/LICENSE: -------------------------------------------------------------------------------- 1 | SIL Open Font License (OFL) 2 | http://scripts.sil.org/cms/scripts/page.php?site_id=nrsi&id=OFL 3 | -------------------------------------------------------------------------------- /slides/reveal.js/test/examples/assets/image1.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/reveal.js/test/examples/assets/image1.png -------------------------------------------------------------------------------- /slides/reveal.js/test/examples/assets/image2.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/reveal.js/test/examples/assets/image2.png -------------------------------------------------------------------------------- /slides/reveal.js/lib/font/league-gothic/league-gothic.eot: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/reveal.js/lib/font/league-gothic/league-gothic.eot -------------------------------------------------------------------------------- /slides/reveal.js/lib/font/league-gothic/league-gothic.ttf: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/reveal.js/lib/font/league-gothic/league-gothic.ttf -------------------------------------------------------------------------------- /slides/reveal.js/lib/font/league-gothic/league-gothic.woff: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/reveal.js/lib/font/league-gothic/league-gothic.woff -------------------------------------------------------------------------------- /slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-italic.eot: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-italic.eot -------------------------------------------------------------------------------- /slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-italic.ttf: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-italic.ttf -------------------------------------------------------------------------------- /slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-italic.woff: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-italic.woff -------------------------------------------------------------------------------- /slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-regular.eot: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-regular.eot -------------------------------------------------------------------------------- /slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-regular.ttf: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-regular.ttf -------------------------------------------------------------------------------- /slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-regular.woff: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-regular.woff -------------------------------------------------------------------------------- /slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-semibold.eot: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-semibold.eot -------------------------------------------------------------------------------- /slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-semibold.ttf: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-semibold.ttf -------------------------------------------------------------------------------- /slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-semibold.woff: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-semibold.woff -------------------------------------------------------------------------------- /slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-semibolditalic.eot: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-semibolditalic.eot -------------------------------------------------------------------------------- /slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-semibolditalic.ttf: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-semibolditalic.ttf -------------------------------------------------------------------------------- /slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-semibolditalic.woff: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/krother/debugging_tutorial/HEAD/slides/reveal.js/lib/font/source-sans-pro/source-sans-pro-semibolditalic.woff -------------------------------------------------------------------------------- /slides/reveal.js/lib/js/html5shiv.js: -------------------------------------------------------------------------------- 1 | document.createElement('header'); 2 | document.createElement('nav'); 3 | document.createElement('section'); 4 | document.createElement('article'); 5 | document.createElement('aside'); 6 | document.createElement('footer'); 7 | document.createElement('hgroup'); -------------------------------------------------------------------------------- /slides/images/LICENSE.TXT: -------------------------------------------------------------------------------- 1 | 2 | 3 | monkey face by Oksana Latysheva from the Noun Project, CC-BY 3.0 4 | 5 | Bananas by Vladimir Belochkin from the Noun Project, CC-BY 3.0 6 | 7 | Protein S100A8 PDB 1mr8 by Emw - Own work, CC BY-SA 3.0, https://commons.wikimedia.org/w/index.php?curid=8821449 8 | 9 | Rubber Duck by Florentijn Hofman in Hong Kong, CC-BY-SA 3.0 10 | -------------------------------------------------------------------------------- /slides/reveal.js/test/test-markdown.js: -------------------------------------------------------------------------------- 1 | 2 | 3 | Reveal.addEventListener( 'ready', function() { 4 | 5 | QUnit.module( 'Markdown' ); 6 | 7 | test( 'Vertical separator', function() { 8 | strictEqual( document.querySelectorAll( '.reveal .slides>section>section' ).length, 2, 'found two slides' ); 9 | }); 10 | 11 | 12 | } ); 13 | 14 | Reveal.initialize(); 15 | 16 | -------------------------------------------------------------------------------- /slides/reveal.js/lib/font/league-gothic/league-gothic.css: -------------------------------------------------------------------------------- 1 | @font-face { 2 | font-family: 'League Gothic'; 3 | src: url('league-gothic.eot'); 4 | src: url('league-gothic.eot?#iefix') format('embedded-opentype'), 5 | url('league-gothic.woff') format('woff'), 6 | url('league-gothic.ttf') format('truetype'); 7 | 8 | font-weight: normal; 9 | font-style: normal; 10 | } -------------------------------------------------------------------------------- /slides/reveal.js/test/test-pdf.js: -------------------------------------------------------------------------------- 1 | 2 | Reveal.addEventListener( 'ready', function() { 3 | 4 | // Only one test for now, we're mainly ensuring that there 5 | // are no execution errors when running PDF mode 6 | 7 | test( 'Reveal.isReady', function() { 8 | strictEqual( Reveal.isReady(), true, 'returns true' ); 9 | }); 10 | 11 | 12 | } ); 13 | 14 | Reveal.initialize({ pdf: true }); 15 | 16 | -------------------------------------------------------------------------------- /slides/reveal.js/plugin/markdown/example.md: -------------------------------------------------------------------------------- 1 | # Markdown Demo 2 | 3 | 4 | 5 | ## External 1.1 6 | 7 | Content 1.1 8 | 9 | Note: This will only appear in the speaker notes window. 10 | 11 | 12 | ## External 1.2 13 | 14 | Content 1.2 15 | 16 | 17 | 18 | ## External 2 19 | 20 | Content 2.1 21 | 22 | 23 | 24 | ## External 3.1 25 | 26 | Content 3.1 27 | 28 | 29 | ## External 3.2 30 | 31 | Content 3.2 32 | -------------------------------------------------------------------------------- /slides/reveal.js/plugin/multiplex/client.js: -------------------------------------------------------------------------------- 1 | (function() { 2 | var multiplex = Reveal.getConfig().multiplex; 3 | var socketId = multiplex.id; 4 | var socket = io.connect(multiplex.url); 5 | 6 | socket.on(multiplex.id, function(data) { 7 | // ignore data from sockets that aren't ours 8 | if (data.socketId !== socketId) { return; } 9 | if( window.location.host === 'localhost:1947' ) return; 10 | 11 | Reveal.setState(data.state); 12 | }); 13 | }()); 14 | -------------------------------------------------------------------------------- /slides/reveal.js/plugin/multiplex/package.json: -------------------------------------------------------------------------------- 1 | { 2 | "name": "reveal-js-multiplex", 3 | "version": "1.0.0", 4 | "description": "reveal.js multiplex server", 5 | "homepage": "http://lab.hakim.se/reveal-js", 6 | "scripts": { 7 | "start": "node index.js" 8 | }, 9 | "engines": { 10 | "node": "~4.1.1" 11 | }, 12 | "dependencies": { 13 | "express": "~4.13.3", 14 | "grunt-cli": "~0.1.13", 15 | "mustache": "~2.2.1", 16 | "socket.io": "~1.3.7" 17 | }, 18 | "license": "MIT" 19 | } 20 | -------------------------------------------------------------------------------- /twenty_questions/twenty_questions_easy.py: -------------------------------------------------------------------------------- 1 | """ 2 | Twenty Questions 3 | 4 | EASY VERSION 5 | 6 | Data from: https://github.com/knkeniston/TwentyQuestions/ 7 | """ 8 | import json 9 | 10 | def is_answer(node): 11 | return len(node) == 1 12 | 13 | 14 | f = open('quetions.json') 15 | content = f.read 16 | node = json.reads(content) 17 | 18 | finished = False 19 | 20 | while not finished 21 | print(node['text'] 22 | 23 | if is_answer_node(node): 24 | finished = True 25 | else: 26 | answer == input() 27 | if answer.upper() in ['yes', 'y']: 28 | node = node['no'] 29 | else: 30 | node = node['yes'] 31 | -------------------------------------------------------------------------------- /solutions/twenty_questions_easy.py: -------------------------------------------------------------------------------- 1 | """ 2 | Twenty Questions 3 | 4 | Data from: https://github.com/knkeniston/TwentyQuestions/ 5 | """ 6 | import json 7 | 8 | def is_answer(node): 9 | return len(node) == 1 10 | 11 | 12 | f = open('../twenty_questions/questions.json') 13 | content = f.read() 14 | node = json.loads(content) 15 | 16 | finished = False 17 | while not finished: 18 | print(node['text']) 19 | if is_answer(node): 20 | finished = True 21 | else: 22 | answer = input() 23 | if answer.lower() in ['yes', 'y']: 24 | node = node['yes'] 25 | else: 26 | node = node['no'] 27 | -------------------------------------------------------------------------------- /slides/reveal.js/bower.json: -------------------------------------------------------------------------------- 1 | { 2 | "name": "reveal.js", 3 | "version": "3.3.0", 4 | "main": [ 5 | "js/reveal.js", 6 | "css/reveal.css" 7 | ], 8 | "homepage": "http://lab.hakim.se/reveal-js/", 9 | "license": "MIT", 10 | "description": "The HTML Presentation Framework", 11 | "authors": [ 12 | "Hakim El Hattab " 13 | ], 14 | "dependencies": { 15 | "headjs": "~1.0.3" 16 | }, 17 | "repository": { 18 | "type": "git", 19 | "url": "git://github.com/hakimel/reveal.js.git" 20 | }, 21 | "ignore": [ 22 | "**/.*", 23 | "node_modules", 24 | "bower_components", 25 | "test" 26 | ] 27 | } -------------------------------------------------------------------------------- /solutions/mini_input.fasta: -------------------------------------------------------------------------------- 1 | >tr|A0A024R161|A0A024R161_HUMAN Guanine nucleotide-binding protein subunit gamma OS=Homo sapiens GN=DNAJC25-GNG10 PE=3 SV=1 2 | MGAPLLSPGWGAGAAGRRWWMLLAPLLPALLLVRPAGALVEGLYCGTRDCYEVLGVSRSA 3 | GKAEIARAYRQLARRYHPDRYRPQPGDEGPGRTPQSAEEAFLLVATAYETLKVSQAAAEL 4 | QQYCMQNACKDALLVGVPAGSNPFREPRSCALL 5 | >tr|A0A075B6F4|A0A075B6F4_HUMAN T cell receptor beta variable 21/OR9-2 (pseudogene) (Fragment) OS=Homo sapiens GN=TRBV21OR9-2 PE=4 SV=1 6 | XRFLSEPTRCLRLLCCVALSFWGAASMDTKVTQRPRFLVKANEQKAKMDCVPIKRHSYVY 7 | WYHKTLEEELKFFIYFQNEEIIQKAEIINERFSAQCPQNSPCTLEIQSTESGDTARYFCA 8 | NSK 9 | >tr|A0A075B6H5|A0A075B6H5_HUMAN T cell receptor beta variable 20/OR9-2 (non-functional) (Fragment) OS=Homo sapiens GN=TRBV20OR9-2 PE=4 SV=1 10 | METVVTTLPREGGVGPSRKMLLLLLLLGPGSGLSAVVSQHPSRVICKSGTSVNIECRSLD 11 | -------------------------------------------------------------------------------- /proteins/README.md: -------------------------------------------------------------------------------- 1 | 2 | # Analyzing Protein Data 3 | 4 | ## Question 5 | 6 | Are monkeys genetically similar to bananas? 7 | 8 | ## Description 9 | 10 | Compare monkey, banana and human proteins by counting how frequently their amino acids occur. This essentially means counting characters in strings, but some biological background is helpful to interpret the results (and bugs!). 11 | 12 | The directories: 13 | 14 | * `data/` - place to store donwloaded data. 15 | * `output/` - place to store files generated by the program. 16 | 17 | ## Preparations 18 | 19 | * Download *proteomes for **human, chimp and banana** as FASTA files* from the [UniProt database](http://www.uniprot.org/proteomes/). 20 | * Store them in the `data/` folder. 21 | 22 | ## Task 23 | 24 | Debug `parse_uniprot.py`. 25 | 26 | -------------------------------------------------------------------------------- /solutions/delta_debug_animals.py: -------------------------------------------------------------------------------- 1 | """ 2 | Sample solution to the Delta Debugging exercise 3 | """ 4 | 5 | from ddebug import delta_debug 6 | 7 | class AnimalError(Exception): pass 8 | 9 | def print_animals(names): 10 | """Prints animals but only if they get along well""" 11 | if 'cat' in names and 'dog' in names: raise(AnimalError()) 12 | if 'wolf' in names and 'pig' in names: raise(AnimalError()) 13 | if 'anteater' in names and 'ant' in names: raise(AnimalError()) 14 | print(';'.join(names)) 15 | 16 | 17 | def test_animals(names): 18 | try: 19 | print_animals(names) 20 | return 'PASS' 21 | except AnimalError: 22 | return 'FAIL' 23 | 24 | 25 | if __name__ == '__main__': 26 | data = ['pig', 'chicken', 'dog', 'anteater', 'wolf', 'piranha'] 27 | result = delta_debug(data, test_animals) 28 | print("minimal failing set: ", result) 29 | -------------------------------------------------------------------------------- /slides/reveal.js/test/examples/barebones.html: -------------------------------------------------------------------------------- 1 | 2 | 3 | 4 | 5 | 6 | 7 | reveal.js - Barebones 8 | 9 | 10 | 11 | 12 | 13 | 14 |
15 | 16 |
17 | 18 |
19 |

Barebones Presentation

20 |

This example contains the bare minimum includes and markup required to run a reveal.js presentation.

21 |
22 | 23 |
24 |

No Theme

25 |

There's no theme included, so it will fall back on browser defaults.

26 |
27 | 28 |
29 | 30 |
31 | 32 | 33 | 34 | 39 | 40 | 41 | 42 | -------------------------------------------------------------------------------- /slides/reveal.js/plugin/multiplex/master.js: -------------------------------------------------------------------------------- 1 | (function() { 2 | 3 | // Don't emit events from inside of notes windows 4 | if ( window.location.search.match( /receiver/gi ) ) { return; } 5 | 6 | var multiplex = Reveal.getConfig().multiplex; 7 | 8 | var socket = io.connect( multiplex.url ); 9 | 10 | function post() { 11 | 12 | var messageData = { 13 | state: Reveal.getState(), 14 | secret: multiplex.secret, 15 | socketId: multiplex.id 16 | }; 17 | 18 | socket.emit( 'multiplex-statechanged', messageData ); 19 | 20 | }; 21 | 22 | // Monitor events that trigger a change in state 23 | Reveal.addEventListener( 'slidechanged', post ); 24 | Reveal.addEventListener( 'fragmentshown', post ); 25 | Reveal.addEventListener( 'fragmenthidden', post ); 26 | Reveal.addEventListener( 'overviewhidden', post ); 27 | Reveal.addEventListener( 'overviewshown', post ); 28 | Reveal.addEventListener( 'paused', post ); 29 | Reveal.addEventListener( 'resumed', post ); 30 | 31 | }()); -------------------------------------------------------------------------------- /slides/reveal.js/css/theme/source/night.scss: -------------------------------------------------------------------------------- 1 | /** 2 | * Black theme for reveal.js. 3 | * 4 | * Copyright (C) 2011-2012 Hakim El Hattab, http://hakim.se 5 | */ 6 | 7 | 8 | // Default mixins and settings ----------------- 9 | @import "../template/mixins"; 10 | @import "../template/settings"; 11 | // --------------------------------------------- 12 | 13 | 14 | // Include theme-specific fonts 15 | @import url(https://fonts.googleapis.com/css?family=Montserrat:700); 16 | @import url(https://fonts.googleapis.com/css?family=Open+Sans:400,700,400italic,700italic); 17 | 18 | 19 | // Override theme settings (see ../template/settings.scss) 20 | $backgroundColor: #111; 21 | 22 | $mainFont: 'Open Sans', sans-serif; 23 | $linkColor: #e7ad52; 24 | $linkColorHover: lighten( $linkColor, 20% ); 25 | $headingFont: 'Montserrat', Impact, sans-serif; 26 | $headingTextShadow: none; 27 | $headingLetterSpacing: -0.03em; 28 | $headingTextTransform: none; 29 | $selectionBackgroundColor: #e7ad52; 30 | $mainFontSize: 30px; 31 | 32 | 33 | // Theme template ------------------------------ 34 | @import "../template/theme"; 35 | // --------------------------------------------- -------------------------------------------------------------------------------- /slides/reveal.js/LICENSE: -------------------------------------------------------------------------------- 1 | Copyright (C) 2016 Hakim El Hattab, http://hakim.se 2 | 3 | Permission is hereby granted, free of charge, to any person obtaining a copy 4 | of this software and associated documentation files (the "Software"), to deal 5 | in the Software without restriction, including without limitation the rights 6 | to use, copy, modify, merge, publish, distribute, sublicense, and/or sell 7 | copies of the Software, and to permit persons to whom the Software is 8 | furnished to do so, subject to the following conditions: 9 | 10 | The above copyright notice and this permission notice shall be included in 11 | all copies or substantial portions of the Software. 12 | 13 | THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR 14 | IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, 15 | FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE 16 | AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER 17 | LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, 18 | OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN 19 | THE SOFTWARE. -------------------------------------------------------------------------------- /slides/reveal.js/test/examples/embedded-media.html: -------------------------------------------------------------------------------- 1 | 2 | 3 | 4 | 5 | 6 | 7 | reveal.js - Embedded Media 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 |
18 | 19 |
20 | 21 |
22 |

Embedded Media Test

23 |
24 | 25 |
26 | 27 |
28 | 29 |
30 |

Empty Slide

31 |
32 | 33 |
34 | 35 |
36 | 37 | 38 | 39 | 40 | 47 | 48 | 49 | 50 | -------------------------------------------------------------------------------- /slides/reveal.js/CONTRIBUTING.md: -------------------------------------------------------------------------------- 1 | ## Contributing 2 | 3 | Please keep the [issue tracker](http://github.com/hakimel/reveal.js/issues) limited to **bug reports**, **feature requests** and **pull requests**. 4 | 5 | 6 | ### Personal Support 7 | If you have personal support or setup questions the best place to ask those are [StackOverflow](http://stackoverflow.com/questions/tagged/reveal.js). 8 | 9 | 10 | ### Bug Reports 11 | When reporting a bug make sure to include information about which browser and operating system you are on as well as the necessary steps to reproduce the issue. If possible please include a link to a sample presentation where the bug can be tested. 12 | 13 | 14 | ### Pull Requests 15 | - Should follow the coding style of the file you work in, most importantly: 16 | - Tabs to indent 17 | - Single-quoted strings 18 | - Should be made towards the **dev branch** 19 | - Should be submitted from a feature/topic branch (not your master) 20 | 21 | 22 | ### Plugins 23 | Please do not submit plugins as pull requests. They should be maintained in their own separate repository. More information here: https://github.com/hakimel/reveal.js/wiki/Plugin-Guidelines 24 | -------------------------------------------------------------------------------- /slides/reveal.js/css/theme/source/serif.scss: -------------------------------------------------------------------------------- 1 | /** 2 | * A simple theme for reveal.js presentations, similar 3 | * to the default theme. The accent color is brown. 4 | * 5 | * This theme is Copyright (C) 2012-2013 Owen Versteeg, http://owenversteeg.com - it is MIT licensed. 6 | */ 7 | 8 | 9 | // Default mixins and settings ----------------- 10 | @import "../template/mixins"; 11 | @import "../template/settings"; 12 | // --------------------------------------------- 13 | 14 | 15 | 16 | // Override theme settings (see ../template/settings.scss) 17 | $mainFont: 'Palatino Linotype', 'Book Antiqua', Palatino, FreeSerif, serif; 18 | $mainColor: #000; 19 | $headingFont: 'Palatino Linotype', 'Book Antiqua', Palatino, FreeSerif, serif; 20 | $headingColor: #383D3D; 21 | $headingTextShadow: none; 22 | $headingTextTransform: none; 23 | $backgroundColor: #F0F1EB; 24 | $linkColor: #51483D; 25 | $linkColorHover: lighten( $linkColor, 20% ); 26 | $selectionBackgroundColor: #26351C; 27 | 28 | .reveal a { 29 | line-height: 1.3em; 30 | } 31 | 32 | 33 | // Theme template ------------------------------ 34 | @import "../template/theme"; 35 | // --------------------------------------------- 36 | -------------------------------------------------------------------------------- /proteins/parse_with_biopython.py: -------------------------------------------------------------------------------- 1 | """ 2 | Read the human proteome from a FASTA file, 3 | extract some properties from the description 4 | and count the amino acids. 5 | 6 | Save all info as a comma-separated table. 7 | 8 | Data downloaded via http://www.uniprot.org/help/human_proteome 9 | 10 | YOUR TASK: 11 | The program contains five bugs. 12 | Identify and fix them. 13 | """ 14 | 15 | import csv 16 | 17 | AMINO_ACIDS = list("ACDEFGHIKLMNPQRSTVWY") 18 | 19 | LABELS = ['accession', 'name', 'length'] + AMINO_ACIDS 20 | 21 | outfile = open("human_proteome.csv") 22 | writer = csv.writer(outfile) 23 | writer.writerows([LABELS]) 24 | 25 | for rec in SeqIO.parse("UP000005640_9606.fasta", "fasta"): 26 | accession = rec.id.split('|')[1] 27 | 28 | # truncate name 29 | name = rec.description.lower() 30 | accession_end = name.find(' ') 31 | end = name.find('OS=Homo sapiens') 32 | name = name[accession_end:end].strip() 33 | 34 | # count amino acids 35 | aa_counts = [] 36 | for aa in AMINO_ACIDS 37 | aa_counts.append(rec.seq.count('aa')) 38 | 39 | # write output 40 | row = [accession, name, len(rec)] + aa_counts 41 | writer.writerows([row]) 42 | 43 | outfile.close() 44 | -------------------------------------------------------------------------------- /slides/reveal.js/css/theme/template/settings.scss: -------------------------------------------------------------------------------- 1 | // Base settings for all themes that can optionally be 2 | // overridden by the super-theme 3 | 4 | // Background of the presentation 5 | $backgroundColor: #2b2b2b; 6 | 7 | // Primary/body text 8 | $mainFont: 'Lato', sans-serif; 9 | $mainFontSize: 36px; 10 | $mainColor: #eee; 11 | 12 | // Vertical spacing between blocks of text 13 | $blockMargin: 20px; 14 | 15 | // Headings 16 | $headingMargin: 0 0 $blockMargin 0; 17 | $headingFont: 'League Gothic', Impact, sans-serif; 18 | $headingColor: #eee; 19 | $headingLineHeight: 1.2; 20 | $headingLetterSpacing: normal; 21 | $headingTextTransform: uppercase; 22 | $headingTextShadow: none; 23 | $headingFontWeight: normal; 24 | $heading1TextShadow: $headingTextShadow; 25 | 26 | $heading1Size: 3.77em; 27 | $heading2Size: 2.11em; 28 | $heading3Size: 1.55em; 29 | $heading4Size: 1.00em; 30 | 31 | // Links and actions 32 | $linkColor: #13DAEC; 33 | $linkColorHover: lighten( $linkColor, 20% ); 34 | 35 | // Text selection 36 | $selectionBackgroundColor: #FF5E99; 37 | $selectionColor: #fff; 38 | 39 | // Generates the presentation background, can be overridden 40 | // to return a background image or gradient 41 | @mixin bodyBackground() { 42 | background: $backgroundColor; 43 | } -------------------------------------------------------------------------------- /solutions/parse_with_biopython.py: -------------------------------------------------------------------------------- 1 | """ 2 | Read the human proteome from a FASTA file, 3 | extract some properties from the description 4 | and count the amino acids. 5 | 6 | Save all info as a comma-separated table. 7 | 8 | Data downloaded via http://www.uniprot.org/help/human_proteome 9 | """ 10 | 11 | from Bio import SeqIO 12 | import csv 13 | import re 14 | 15 | AMINO_ACIDS = list("ACDEFGHIKLMNPQRSTVWY") 16 | 17 | LABELS = ['accession', 'name', 'length', 'fragment'] + AMINO_ACIDS 18 | 19 | outfile = open("human_proteome.csv", "w") 20 | writer = csv.writer(outfile) 21 | writer.writerows([LABELS]) 22 | 23 | for rec in SeqIO.parse("UP000005640_9606.fasta", "fasta"): 24 | accession = rec.id.split('|')[1] 25 | name = rec.description 26 | name = name.lower() 27 | name = name[:] # cut off accession 28 | fragment = int(bool(re.search('\(fragment\)', name))) 29 | name = name.replace('(fragment)', '') 30 | 31 | accession_end = name.find(' ') + 1 32 | end = name.find('OS=Homo sapiens') 33 | name = name[accession_end:end].strip() 34 | 35 | aa_counts = [] 36 | for aa in AMINO_ACIDS: 37 | aa_counts.append(rec.seq.count(aa)) 38 | 39 | row = [accession, name, len(rec), fragment] + aa_counts 40 | writer.writerows([row]) 41 | -------------------------------------------------------------------------------- /slides/reveal.js/css/theme/source/league.scss: -------------------------------------------------------------------------------- 1 | /** 2 | * League theme for reveal.js. 3 | * 4 | * This was the default theme pre-3.0.0. 5 | * 6 | * Copyright (C) 2011-2012 Hakim El Hattab, http://hakim.se 7 | */ 8 | 9 | 10 | // Default mixins and settings ----------------- 11 | @import "../template/mixins"; 12 | @import "../template/settings"; 13 | // --------------------------------------------- 14 | 15 | 16 | 17 | // Include theme-specific fonts 18 | @import url(../../lib/font/league-gothic/league-gothic.css); 19 | @import url(https://fonts.googleapis.com/css?family=Lato:400,700,400italic,700italic); 20 | 21 | // Override theme settings (see ../template/settings.scss) 22 | $headingTextShadow: 0px 0px 6px rgba(0,0,0,0.2); 23 | $heading1TextShadow: 0 1px 0 #ccc, 0 2px 0 #c9c9c9, 0 3px 0 #bbb, 0 4px 0 #b9b9b9, 0 5px 0 #aaa, 0 6px 1px rgba(0,0,0,.1), 0 0 5px rgba(0,0,0,.1), 0 1px 3px rgba(0,0,0,.3), 0 3px 5px rgba(0,0,0,.2), 0 5px 10px rgba(0,0,0,.25), 0 20px 20px rgba(0,0,0,.15); 24 | 25 | // Background generator 26 | @mixin bodyBackground() { 27 | @include radial-gradient( rgba(28,30,32,1), rgba(85,90,95,1) ); 28 | } 29 | 30 | 31 | 32 | // Theme template ------------------------------ 33 | @import "../template/theme"; 34 | // --------------------------------------------- -------------------------------------------------------------------------------- /solutions/create_json.py: -------------------------------------------------------------------------------- 1 | """ 2 | Twenty Questions 3 | 4 | Data from: https://github.com/knkeniston/TwentyQuestions/ 5 | """ 6 | import json 7 | 8 | def read_question_tree(fn): 9 | """ 10 | Reads a question tree from a text file 11 | containing a series of lines like 12 | Q: first question 13 | Q: second question, asked if first answer is 'yes' 14 | A: you answered: yes, yes 15 | A: you answered: yes, no 16 | Q: asked if first answer no 17 | A: you answered: no, yes 18 | A: you answered: no, no 19 | """ 20 | tree = {} 21 | stack = [tree] 22 | 23 | with open(fn) as f: # BUG: hardcode filename here 24 | for line in f: # BUG: .read() 25 | head = stack.pop() 26 | head['text'] = line.strip()[2:] 27 | if line.startswith('Q:'): 28 | head['yes'] = {} 29 | head['no'] = {} 30 | stack.append(head['no']) 31 | stack.append(head['yes']) 32 | 33 | return tree 34 | 35 | 36 | if __name__ == '__main__': 37 | tree = read_question_tree('../twenty_questions/questions.txt') 38 | #tree = read_question_tree('mini.txt') 39 | with open('questions.json', 'w') as f: 40 | f.write(json.dumps(tree)) 41 | -------------------------------------------------------------------------------- /slides/reveal.js/package.json: -------------------------------------------------------------------------------- 1 | { 2 | "name": "reveal.js", 3 | "version": "3.3.0", 4 | "description": "The HTML Presentation Framework", 5 | "homepage": "http://lab.hakim.se/reveal-js", 6 | "subdomain": "revealjs", 7 | "main": "js/reveal.js", 8 | "scripts": { 9 | "test": "grunt test", 10 | "start": "grunt serve" 11 | }, 12 | "author": { 13 | "name": "Hakim El Hattab", 14 | "email": "hakim.elhattab@gmail.com", 15 | "web": "http://hakim.se" 16 | }, 17 | "repository": { 18 | "type": "git", 19 | "url": "git://github.com/hakimel/reveal.js.git" 20 | }, 21 | "engines": { 22 | "node": "~4.1.1" 23 | }, 24 | "dependencies": { 25 | "express": "~4.13.3", 26 | "grunt-cli": "~0.1.13", 27 | "mustache": "~2.2.1", 28 | "socket.io": "~1.3.7" 29 | }, 30 | "devDependencies": { 31 | "grunt": "~0.4.5", 32 | "grunt-autoprefixer": "~3.0.3", 33 | "grunt-contrib-connect": "~0.11.2", 34 | "grunt-contrib-cssmin": "~0.14.0", 35 | "grunt-contrib-jshint": "~0.11.3", 36 | "grunt-contrib-qunit": "~0.7.0", 37 | "grunt-contrib-uglify": "~0.9.2", 38 | "grunt-contrib-watch": "~0.6.1", 39 | "grunt-sass": "~1.1.0-beta", 40 | "grunt-zip": "~0.17.1", 41 | "node-sass": "~3.3.3" 42 | }, 43 | "license": "MIT" 44 | } 45 | -------------------------------------------------------------------------------- /slides/reveal.js/lib/css/zenburn.css: -------------------------------------------------------------------------------- 1 | /* 2 | 3 | Zenburn style from voldmar.ru (c) Vladimir Epifanov 4 | based on dark.css by Ivan Sagalaev 5 | 6 | */ 7 | 8 | .hljs { 9 | display: block; 10 | overflow-x: auto; 11 | padding: 0.5em; 12 | background: #3f3f3f; 13 | color: #dcdcdc; 14 | } 15 | 16 | .hljs-keyword, 17 | .hljs-selector-tag, 18 | .hljs-tag { 19 | color: #e3ceab; 20 | } 21 | 22 | .hljs-template-tag { 23 | color: #dcdcdc; 24 | } 25 | 26 | .hljs-number { 27 | color: #8cd0d3; 28 | } 29 | 30 | .hljs-variable, 31 | .hljs-template-variable, 32 | .hljs-attribute { 33 | color: #efdcbc; 34 | } 35 | 36 | .hljs-literal { 37 | color: #efefaf; 38 | } 39 | 40 | .hljs-subst { 41 | color: #8f8f8f; 42 | } 43 | 44 | .hljs-title, 45 | .hljs-name, 46 | .hljs-selector-id, 47 | .hljs-selector-class, 48 | .hljs-section, 49 | .hljs-type { 50 | color: #efef8f; 51 | } 52 | 53 | .hljs-symbol, 54 | .hljs-bullet, 55 | .hljs-link { 56 | color: #dca3a3; 57 | } 58 | 59 | .hljs-deletion, 60 | .hljs-string, 61 | .hljs-built_in, 62 | .hljs-builtin-name { 63 | color: #cc9393; 64 | } 65 | 66 | .hljs-addition, 67 | .hljs-comment, 68 | .hljs-quote, 69 | .hljs-meta { 70 | color: #7f9f7f; 71 | } 72 | 73 | 74 | .hljs-emphasis { 75 | font-style: italic; 76 | } 77 | 78 | .hljs-strong { 79 | font-weight: bold; 80 | } 81 | -------------------------------------------------------------------------------- /slides/reveal.js/css/theme/source/simple.scss: -------------------------------------------------------------------------------- 1 | /** 2 | * A simple theme for reveal.js presentations, similar 3 | * to the default theme. The accent color is darkblue. 4 | * 5 | * This theme is Copyright (C) 2012 Owen Versteeg, https://github.com/StereotypicalApps. It is MIT licensed. 6 | * reveal.js is Copyright (C) 2011-2012 Hakim El Hattab, http://hakim.se 7 | */ 8 | 9 | 10 | // Default mixins and settings ----------------- 11 | @import "../template/mixins"; 12 | @import "../template/settings"; 13 | // --------------------------------------------- 14 | 15 | 16 | 17 | // Include theme-specific fonts 18 | @import url(https://fonts.googleapis.com/css?family=News+Cycle:400,700); 19 | @import url(https://fonts.googleapis.com/css?family=Lato:400,700,400italic,700italic); 20 | 21 | 22 | // Override theme settings (see ../template/settings.scss) 23 | $mainFont: 'Lato', sans-serif; 24 | $mainColor: #000; 25 | $headingFont: 'News Cycle', Impact, sans-serif; 26 | $headingColor: #000; 27 | $headingTextShadow: none; 28 | $headingTextTransform: none; 29 | $backgroundColor: #fff; 30 | $linkColor: #00008B; 31 | $linkColorHover: lighten( $linkColor, 20% ); 32 | $selectionBackgroundColor: rgba(0, 0, 0, 0.99); 33 | 34 | 35 | 36 | // Theme template ------------------------------ 37 | @import "../template/theme"; 38 | // --------------------------------------------- -------------------------------------------------------------------------------- /slides/reveal.js/css/theme/source/sky.scss: -------------------------------------------------------------------------------- 1 | /** 2 | * Sky theme for reveal.js. 3 | * 4 | * Copyright (C) 2011-2012 Hakim El Hattab, http://hakim.se 5 | */ 6 | 7 | 8 | // Default mixins and settings ----------------- 9 | @import "../template/mixins"; 10 | @import "../template/settings"; 11 | // --------------------------------------------- 12 | 13 | 14 | 15 | // Include theme-specific fonts 16 | @import url(https://fonts.googleapis.com/css?family=Quicksand:400,700,400italic,700italic); 17 | @import url(https://fonts.googleapis.com/css?family=Open+Sans:400italic,700italic,400,700); 18 | 19 | 20 | // Override theme settings (see ../template/settings.scss) 21 | $mainFont: 'Open Sans', sans-serif; 22 | $mainColor: #333; 23 | $headingFont: 'Quicksand', sans-serif; 24 | $headingColor: #333; 25 | $headingLetterSpacing: -0.08em; 26 | $headingTextShadow: none; 27 | $backgroundColor: #f7fbfc; 28 | $linkColor: #3b759e; 29 | $linkColorHover: lighten( $linkColor, 20% ); 30 | $selectionBackgroundColor: #134674; 31 | 32 | // Fix links so they are not cut off 33 | .reveal a { 34 | line-height: 1.3em; 35 | } 36 | 37 | // Background generator 38 | @mixin bodyBackground() { 39 | @include radial-gradient( #add9e4, #f7fbfc ); 40 | } 41 | 42 | 43 | 44 | // Theme template ------------------------------ 45 | @import "../template/theme"; 46 | // --------------------------------------------- 47 | -------------------------------------------------------------------------------- /slides/reveal.js/css/theme/source/beige.scss: -------------------------------------------------------------------------------- 1 | /** 2 | * Beige theme for reveal.js. 3 | * 4 | * Copyright (C) 2011-2012 Hakim El Hattab, http://hakim.se 5 | */ 6 | 7 | 8 | // Default mixins and settings ----------------- 9 | @import "../template/mixins"; 10 | @import "../template/settings"; 11 | // --------------------------------------------- 12 | 13 | 14 | 15 | // Include theme-specific fonts 16 | @import url(../../lib/font/league-gothic/league-gothic.css); 17 | @import url(https://fonts.googleapis.com/css?family=Lato:400,700,400italic,700italic); 18 | 19 | 20 | // Override theme settings (see ../template/settings.scss) 21 | $mainColor: #333; 22 | $headingColor: #333; 23 | $headingTextShadow: none; 24 | $backgroundColor: #f7f3de; 25 | $linkColor: #8b743d; 26 | $linkColorHover: lighten( $linkColor, 20% ); 27 | $selectionBackgroundColor: rgba(79, 64, 28, 0.99); 28 | $heading1TextShadow: 0 1px 0 #ccc, 0 2px 0 #c9c9c9, 0 3px 0 #bbb, 0 4px 0 #b9b9b9, 0 5px 0 #aaa, 0 6px 1px rgba(0,0,0,.1), 0 0 5px rgba(0,0,0,.1), 0 1px 3px rgba(0,0,0,.3), 0 3px 5px rgba(0,0,0,.2), 0 5px 10px rgba(0,0,0,.25), 0 20px 20px rgba(0,0,0,.15); 29 | 30 | // Background generator 31 | @mixin bodyBackground() { 32 | @include radial-gradient( rgba(247,242,211,1), rgba(255,255,255,1) ); 33 | } 34 | 35 | 36 | 37 | // Theme template ------------------------------ 38 | @import "../template/theme"; 39 | // --------------------------------------------- -------------------------------------------------------------------------------- /slides/reveal.js/css/theme/source/black.scss: -------------------------------------------------------------------------------- 1 | /** 2 | * Black theme for reveal.js. This is the opposite of the 'white' theme. 3 | * 4 | * By Hakim El Hattab, http://hakim.se 5 | */ 6 | 7 | 8 | // Default mixins and settings ----------------- 9 | @import "../template/mixins"; 10 | @import "../template/settings"; 11 | // --------------------------------------------- 12 | 13 | 14 | // Include theme-specific fonts 15 | @import url(../../lib/font/source-sans-pro/source-sans-pro.css); 16 | 17 | 18 | // Override theme settings (see ../template/settings.scss) 19 | $backgroundColor: #222; 20 | 21 | $mainColor: #fff; 22 | $headingColor: #fff; 23 | 24 | $mainFontSize: 38px; 25 | $mainFont: 'Source Sans Pro', Helvetica, sans-serif; 26 | $headingFont: 'Source Sans Pro', Helvetica, sans-serif; 27 | $headingTextShadow: none; 28 | $headingLetterSpacing: normal; 29 | $headingTextTransform: uppercase; 30 | $headingFontWeight: 600; 31 | $linkColor: #42affa; 32 | $linkColorHover: lighten( $linkColor, 15% ); 33 | $selectionBackgroundColor: lighten( $linkColor, 25% ); 34 | 35 | $heading1Size: 2.5em; 36 | $heading2Size: 1.6em; 37 | $heading3Size: 1.3em; 38 | $heading4Size: 1.0em; 39 | 40 | section.has-light-background { 41 | &, h1, h2, h3, h4, h5, h6 { 42 | color: #222; 43 | } 44 | } 45 | 46 | 47 | // Theme template ------------------------------ 48 | @import "../template/theme"; 49 | // --------------------------------------------- -------------------------------------------------------------------------------- /slides/reveal.js/css/theme/source/white.scss: -------------------------------------------------------------------------------- 1 | /** 2 | * White theme for reveal.js. This is the opposite of the 'black' theme. 3 | * 4 | * By Hakim El Hattab, http://hakim.se 5 | */ 6 | 7 | 8 | // Default mixins and settings ----------------- 9 | @import "../template/mixins"; 10 | @import "../template/settings"; 11 | // --------------------------------------------- 12 | 13 | 14 | // Include theme-specific fonts 15 | @import url(../../lib/font/source-sans-pro/source-sans-pro.css); 16 | 17 | 18 | // Override theme settings (see ../template/settings.scss) 19 | $backgroundColor: #fff; 20 | 21 | $mainColor: #222; 22 | $headingColor: #222; 23 | 24 | $mainFontSize: 38px; 25 | $mainFont: 'Source Sans Pro', Helvetica, sans-serif; 26 | $headingFont: 'Source Sans Pro', Helvetica, sans-serif; 27 | $headingTextShadow: none; 28 | $headingLetterSpacing: normal; 29 | $headingTextTransform: uppercase; 30 | $headingFontWeight: 600; 31 | $linkColor: #2a76dd; 32 | $linkColorHover: lighten( $linkColor, 15% ); 33 | $selectionBackgroundColor: lighten( $linkColor, 25% ); 34 | 35 | $heading1Size: 2.5em; 36 | $heading2Size: 1.6em; 37 | $heading3Size: 1.3em; 38 | $heading4Size: 1.0em; 39 | 40 | section.has-dark-background { 41 | &, h1, h2, h3, h4, h5, h6 { 42 | color: #fff; 43 | } 44 | } 45 | 46 | 47 | // Theme template ------------------------------ 48 | @import "../template/theme"; 49 | // --------------------------------------------- -------------------------------------------------------------------------------- /slides/reveal.js/test/test-markdown.html: -------------------------------------------------------------------------------- 1 | 2 | 3 | 4 | 5 | 6 | 7 | reveal.js - Test Markdown 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 |
16 |
17 | 18 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | -------------------------------------------------------------------------------- /slides/reveal.js/plugin/print-pdf/print-pdf.js: -------------------------------------------------------------------------------- 1 | /** 2 | * phantomjs script for printing presentations to PDF. 3 | * 4 | * Example: 5 | * phantomjs print-pdf.js "http://lab.hakim.se/reveal-js?print-pdf" reveal-demo.pdf 6 | * 7 | * By Manuel Bieh (https://github.com/manuelbieh) 8 | */ 9 | 10 | // html2pdf.js 11 | var page = new WebPage(); 12 | var system = require( 'system' ); 13 | 14 | var slideWidth = system.args[3] ? system.args[3].split( 'x' )[0] : 960; 15 | var slideHeight = system.args[3] ? system.args[3].split( 'x' )[1] : 700; 16 | 17 | page.viewportSize = { 18 | width: slideWidth, 19 | height: slideHeight 20 | }; 21 | 22 | // TODO 23 | // Something is wrong with these config values. An input 24 | // paper width of 1920px actually results in a 756px wide 25 | // PDF. 26 | page.paperSize = { 27 | width: Math.round( slideWidth * 2 ), 28 | height: Math.round( slideHeight * 2 ), 29 | border: 0 30 | }; 31 | 32 | var inputFile = system.args[1] || 'index.html?print-pdf'; 33 | var outputFile = system.args[2] || 'slides.pdf'; 34 | 35 | if( outputFile.match( /\.pdf$/gi ) === null ) { 36 | outputFile += '.pdf'; 37 | } 38 | 39 | console.log( 'Printing PDF (Paper size: '+ page.paperSize.width + 'x' + page.paperSize.height +')' ); 40 | 41 | page.open( inputFile, function( status ) { 42 | window.setTimeout( function() { 43 | console.log( 'Printed successfully' ); 44 | page.render( outputFile ); 45 | phantom.exit(); 46 | }, 1000 ); 47 | } ); 48 | 49 | -------------------------------------------------------------------------------- /slides/reveal.js/css/theme/source/moon.scss: -------------------------------------------------------------------------------- 1 | /** 2 | * Solarized Dark theme for reveal.js. 3 | * Author: Achim Staebler 4 | */ 5 | 6 | 7 | // Default mixins and settings ----------------- 8 | @import "../template/mixins"; 9 | @import "../template/settings"; 10 | // --------------------------------------------- 11 | 12 | 13 | 14 | // Include theme-specific fonts 15 | @import url(../../lib/font/league-gothic/league-gothic.css); 16 | @import url(https://fonts.googleapis.com/css?family=Lato:400,700,400italic,700italic); 17 | 18 | /** 19 | * Solarized colors by Ethan Schoonover 20 | */ 21 | html * { 22 | color-profile: sRGB; 23 | rendering-intent: auto; 24 | } 25 | 26 | // Solarized colors 27 | $base03: #002b36; 28 | $base02: #073642; 29 | $base01: #586e75; 30 | $base00: #657b83; 31 | $base0: #839496; 32 | $base1: #93a1a1; 33 | $base2: #eee8d5; 34 | $base3: #fdf6e3; 35 | $yellow: #b58900; 36 | $orange: #cb4b16; 37 | $red: #dc322f; 38 | $magenta: #d33682; 39 | $violet: #6c71c4; 40 | $blue: #268bd2; 41 | $cyan: #2aa198; 42 | $green: #859900; 43 | 44 | // Override theme settings (see ../template/settings.scss) 45 | $mainColor: $base1; 46 | $headingColor: $base2; 47 | $headingTextShadow: none; 48 | $backgroundColor: $base03; 49 | $linkColor: $blue; 50 | $linkColorHover: lighten( $linkColor, 20% ); 51 | $selectionBackgroundColor: $magenta; 52 | 53 | 54 | 55 | // Theme template ------------------------------ 56 | @import "../template/theme"; 57 | // --------------------------------------------- 58 | -------------------------------------------------------------------------------- /nuke_door/nuke_door.py: -------------------------------------------------------------------------------- 1 | """ 2 | Review the following (fictional!) code for a nuclear vault door. 3 | 4 | Identify potential safety or correctness issues. 5 | (the record is 5) 6 | 7 | The control mechanism of the lock of a vault for nuclear waste 8 | has been designed for safe operation. It makes sure that it is 9 | only possible to access the vault, if the radiation shields 10 | are in place or the radiation level in the vault is below a 11 | threshold (DANGER_LEVEL). That means: 12 | 13 | * If the remote-controlled radiation shields are in place, the door may be opened by an authorized operator. 14 | * If the radiation level in the room is below the threshold, the door may be opened by an authorized operator. 15 | * An authorized operator may open the door by entering a code. 16 | 17 | The code below controls the door lock. Note that the safe state 18 | is that no entry is possible. Develop an argument for safety 19 | that shows that the code is potentially unsafe. 20 | 21 | (adopted from I.Sommerville, Software Engineering, 9th edition) 22 | """ 23 | 24 | entry_code = lock.get_entry_code() 25 | if entry_code == lock.authorised_code: 26 | shield_status = shield.get_status() 27 | radiation_level = rad_sensor.get() 28 | if radiation_level < DANGER_LEVEL: 29 | state = SAFE 30 | else: 31 | state = UNSAFE 32 | if shield_status == shield.in_place(): 33 | state = SAFE 34 | if state == SAFE: 35 | door.locked = False 36 | door.unlock() 37 | else: 38 | door.lock() 39 | door.locked = True 40 | -------------------------------------------------------------------------------- /slides/reveal.js/lib/js/classList.js: -------------------------------------------------------------------------------- 1 | /*! @source http://purl.eligrey.com/github/classList.js/blob/master/classList.js*/ 2 | if(typeof document!=="undefined"&&!("classList" in document.createElement("a"))){(function(j){var a="classList",f="prototype",m=(j.HTMLElement||j.Element)[f],b=Object,k=String[f].trim||function(){return this.replace(/^\s+|\s+$/g,"")},c=Array[f].indexOf||function(q){var p=0,o=this.length;for(;p 2 | 3 | 4 | 5 | 6 | 7 | reveal.js 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 23 | 24 | 25 |
26 |
27 |
Slide 1
28 |
Slide 2
29 |
30 |
31 | 32 | 33 | 34 | 35 | 49 | 50 | 51 | -------------------------------------------------------------------------------- /slides/reveal.js/css/theme/source/solarized.scss: -------------------------------------------------------------------------------- 1 | /** 2 | * Solarized Light theme for reveal.js. 3 | * Author: Achim Staebler 4 | */ 5 | 6 | 7 | // Default mixins and settings ----------------- 8 | @import "../template/mixins"; 9 | @import "../template/settings"; 10 | // --------------------------------------------- 11 | 12 | 13 | 14 | // Include theme-specific fonts 15 | @import url(../../lib/font/league-gothic/league-gothic.css); 16 | @import url(https://fonts.googleapis.com/css?family=Lato:400,700,400italic,700italic); 17 | 18 | 19 | /** 20 | * Solarized colors by Ethan Schoonover 21 | */ 22 | html * { 23 | color-profile: sRGB; 24 | rendering-intent: auto; 25 | } 26 | 27 | // Solarized colors 28 | $base03: #002b36; 29 | $base02: #073642; 30 | $base01: #586e75; 31 | $base00: #657b83; 32 | $base0: #839496; 33 | $base1: #93a1a1; 34 | $base2: #eee8d5; 35 | $base3: #fdf6e3; 36 | $yellow: #b58900; 37 | $orange: #cb4b16; 38 | $red: #dc322f; 39 | $magenta: #d33682; 40 | $violet: #6c71c4; 41 | $blue: #268bd2; 42 | $cyan: #2aa198; 43 | $green: #859900; 44 | 45 | // Override theme settings (see ../template/settings.scss) 46 | $mainColor: $base00; 47 | $headingColor: $base01; 48 | $headingTextShadow: none; 49 | $backgroundColor: $base3; 50 | $linkColor: $blue; 51 | $linkColorHover: lighten( $linkColor, 20% ); 52 | $selectionBackgroundColor: $magenta; 53 | 54 | // Background generator 55 | // @mixin bodyBackground() { 56 | // @include radial-gradient( rgba($base3,1), rgba(lighten($base3, 20%),1) ); 57 | // } 58 | 59 | 60 | 61 | // Theme template ------------------------------ 62 | @import "../template/theme"; 63 | // --------------------------------------------- 64 | -------------------------------------------------------------------------------- /slides/reveal.js/css/theme/template/mixins.scss: -------------------------------------------------------------------------------- 1 | @mixin vertical-gradient( $top, $bottom ) { 2 | background: $top; 3 | background: -moz-linear-gradient( top, $top 0%, $bottom 100% ); 4 | background: -webkit-gradient( linear, left top, left bottom, color-stop(0%,$top), color-stop(100%,$bottom) ); 5 | background: -webkit-linear-gradient( top, $top 0%, $bottom 100% ); 6 | background: -o-linear-gradient( top, $top 0%, $bottom 100% ); 7 | background: -ms-linear-gradient( top, $top 0%, $bottom 100% ); 8 | background: linear-gradient( top, $top 0%, $bottom 100% ); 9 | } 10 | 11 | @mixin horizontal-gradient( $top, $bottom ) { 12 | background: $top; 13 | background: -moz-linear-gradient( left, $top 0%, $bottom 100% ); 14 | background: -webkit-gradient( linear, left top, right top, color-stop(0%,$top), color-stop(100%,$bottom) ); 15 | background: -webkit-linear-gradient( left, $top 0%, $bottom 100% ); 16 | background: -o-linear-gradient( left, $top 0%, $bottom 100% ); 17 | background: -ms-linear-gradient( left, $top 0%, $bottom 100% ); 18 | background: linear-gradient( left, $top 0%, $bottom 100% ); 19 | } 20 | 21 | @mixin radial-gradient( $outer, $inner, $type: circle ) { 22 | background: $outer; 23 | background: -moz-radial-gradient( center, $type cover, $inner 0%, $outer 100% ); 24 | background: -webkit-gradient( radial, center center, 0px, center center, 100%, color-stop(0%,$inner), color-stop(100%,$outer) ); 25 | background: -webkit-radial-gradient( center, $type cover, $inner 0%, $outer 100% ); 26 | background: -o-radial-gradient( center, $type cover, $inner 0%, $outer 100% ); 27 | background: -ms-radial-gradient( center, $type cover, $inner 0%, $outer 100% ); 28 | background: radial-gradient( center, $type cover, $inner 0%, $outer 100% ); 29 | } -------------------------------------------------------------------------------- /slides/reveal.js/plugin/math/math.js: -------------------------------------------------------------------------------- 1 | /** 2 | * A plugin which enables rendering of math equations inside 3 | * of reveal.js slides. Essentially a thin wrapper for MathJax. 4 | * 5 | * @author Hakim El Hattab 6 | */ 7 | var RevealMath = window.RevealMath || (function(){ 8 | 9 | var options = Reveal.getConfig().math || {}; 10 | options.mathjax = options.mathjax || 'https://cdn.mathjax.org/mathjax/latest/MathJax.js'; 11 | options.config = options.config || 'TeX-AMS_HTML-full'; 12 | 13 | loadScript( options.mathjax + '?config=' + options.config, function() { 14 | 15 | MathJax.Hub.Config({ 16 | messageStyle: 'none', 17 | tex2jax: { 18 | inlineMath: [['$','$'],['\\(','\\)']] , 19 | skipTags: ['script','noscript','style','textarea','pre'] 20 | }, 21 | skipStartupTypeset: true 22 | }); 23 | 24 | // Typeset followed by an immediate reveal.js layout since 25 | // the typesetting process could affect slide height 26 | MathJax.Hub.Queue( [ 'Typeset', MathJax.Hub ] ); 27 | MathJax.Hub.Queue( Reveal.layout ); 28 | 29 | // Reprocess equations in slides when they turn visible 30 | Reveal.addEventListener( 'slidechanged', function( event ) { 31 | 32 | MathJax.Hub.Queue( [ 'Typeset', MathJax.Hub, event.currentSlide ] ); 33 | 34 | } ); 35 | 36 | } ); 37 | 38 | function loadScript( url, callback ) { 39 | 40 | var head = document.querySelector( 'head' ); 41 | var script = document.createElement( 'script' ); 42 | script.type = 'text/javascript'; 43 | script.src = url; 44 | 45 | // Wrapper for callback to make sure it only fires once 46 | var finish = function() { 47 | if( typeof callback === 'function' ) { 48 | callback.call(); 49 | callback = null; 50 | } 51 | } 52 | 53 | script.onload = finish; 54 | 55 | // IE 56 | script.onreadystatechange = function() { 57 | if ( this.readyState === 'loaded' ) { 58 | finish(); 59 | } 60 | } 61 | 62 | // Normal browsers 63 | head.appendChild( script ); 64 | 65 | } 66 | 67 | })(); 68 | -------------------------------------------------------------------------------- /slides/reveal.js/test/test-pdf.html: -------------------------------------------------------------------------------- 1 | 2 | 3 | 4 | 5 | 6 | 7 | reveal.js - Test PDF exports 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 |
17 |
18 | 19 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | -------------------------------------------------------------------------------- /slides/reveal.js/plugin/multiplex/index.js: -------------------------------------------------------------------------------- 1 | var http = require('http'); 2 | var express = require('express'); 3 | var fs = require('fs'); 4 | var io = require('socket.io'); 5 | var crypto = require('crypto'); 6 | 7 | var app = express(); 8 | var staticDir = express.static; 9 | var server = http.createServer(app); 10 | 11 | io = io(server); 12 | 13 | var opts = { 14 | port: process.env.PORT || 1948, 15 | baseDir : __dirname + '/../../' 16 | }; 17 | 18 | io.on( 'connection', function( socket ) { 19 | socket.on('multiplex-statechanged', function(data) { 20 | if (typeof data.secret == 'undefined' || data.secret == null || data.secret === '') return; 21 | if (createHash(data.secret) === data.socketId) { 22 | data.secret = null; 23 | socket.broadcast.emit(data.socketId, data); 24 | }; 25 | }); 26 | }); 27 | 28 | [ 'css', 'js', 'plugin', 'lib' ].forEach(function(dir) { 29 | app.use('/' + dir, staticDir(opts.baseDir + dir)); 30 | }); 31 | 32 | app.get("/", function(req, res) { 33 | res.writeHead(200, {'Content-Type': 'text/html'}); 34 | 35 | var stream = fs.createReadStream(opts.baseDir + '/index.html'); 36 | stream.on('error', function( error ) { 37 | res.write('

reveal.js multiplex server.

Generate token'); 38 | res.end(); 39 | }); 40 | stream.on('readable', function() { 41 | stream.pipe(res); 42 | }); 43 | }); 44 | 45 | app.get("/token", function(req,res) { 46 | var ts = new Date().getTime(); 47 | var rand = Math.floor(Math.random()*9999999); 48 | var secret = ts.toString() + rand.toString(); 49 | res.send({secret: secret, socketId: createHash(secret)}); 50 | }); 51 | 52 | var createHash = function(secret) { 53 | var cipher = crypto.createCipher('blowfish', secret); 54 | return(cipher.final('hex')); 55 | }; 56 | 57 | // Actually listen 58 | server.listen( opts.port || null ); 59 | 60 | var brown = '\033[33m', 61 | green = '\033[32m', 62 | reset = '\033[0m'; 63 | 64 | console.log( brown + "reveal.js:" + reset + " Multiplex running on port " + green + opts.port + reset ); -------------------------------------------------------------------------------- /slides/reveal.js/plugin/notes-server/index.js: -------------------------------------------------------------------------------- 1 | var http = require('http'); 2 | var express = require('express'); 3 | var fs = require('fs'); 4 | var io = require('socket.io'); 5 | var Mustache = require('mustache'); 6 | 7 | var app = express(); 8 | var staticDir = express.static; 9 | var server = http.createServer(app); 10 | 11 | io = io(server); 12 | 13 | var opts = { 14 | port : 1947, 15 | baseDir : __dirname + '/../../' 16 | }; 17 | 18 | io.on( 'connection', function( socket ) { 19 | 20 | socket.on( 'new-subscriber', function( data ) { 21 | socket.broadcast.emit( 'new-subscriber', data ); 22 | }); 23 | 24 | socket.on( 'statechanged', function( data ) { 25 | delete data.state.overview; 26 | socket.broadcast.emit( 'statechanged', data ); 27 | }); 28 | 29 | socket.on( 'statechanged-speaker', function( data ) { 30 | delete data.state.overview; 31 | socket.broadcast.emit( 'statechanged-speaker', data ); 32 | }); 33 | 34 | }); 35 | 36 | [ 'css', 'js', 'images', 'plugin', 'lib' ].forEach( function( dir ) { 37 | app.use( '/' + dir, staticDir( opts.baseDir + dir ) ); 38 | }); 39 | 40 | app.get('/', function( req, res ) { 41 | 42 | res.writeHead( 200, { 'Content-Type': 'text/html' } ); 43 | fs.createReadStream( opts.baseDir + '/index.html' ).pipe( res ); 44 | 45 | }); 46 | 47 | app.get( '/notes/:socketId', function( req, res ) { 48 | 49 | fs.readFile( opts.baseDir + 'plugin/notes-server/notes.html', function( err, data ) { 50 | res.send( Mustache.to_html( data.toString(), { 51 | socketId : req.params.socketId 52 | })); 53 | }); 54 | 55 | }); 56 | 57 | // Actually listen 58 | server.listen( opts.port || null ); 59 | 60 | var brown = '\033[33m', 61 | green = '\033[32m', 62 | reset = '\033[0m'; 63 | 64 | var slidesLocation = 'http://localhost' + ( opts.port ? ( ':' + opts.port ) : '' ); 65 | 66 | console.log( brown + 'reveal.js - Speaker Notes' + reset ); 67 | console.log( '1. Open the slides at ' + green + slidesLocation + reset ); 68 | console.log( '2. Click on the link in your JS console to go to the notes page' ); 69 | console.log( '3. Advance through your slides and your notes will advance automatically' ); 70 | -------------------------------------------------------------------------------- /slides/reveal.js/plugin/notes-server/client.js: -------------------------------------------------------------------------------- 1 | (function() { 2 | 3 | // don't emit events from inside the previews themselves 4 | if( window.location.search.match( /receiver/gi ) ) { return; } 5 | 6 | var socket = io.connect( window.location.origin ), 7 | socketId = Math.random().toString().slice( 2 ); 8 | 9 | console.log( 'View slide notes at ' + window.location.origin + '/notes/' + socketId ); 10 | 11 | window.open( window.location.origin + '/notes/' + socketId, 'notes-' + socketId ); 12 | 13 | /** 14 | * Posts the current slide data to the notes window 15 | */ 16 | function post() { 17 | 18 | var slideElement = Reveal.getCurrentSlide(), 19 | notesElement = slideElement.querySelector( 'aside.notes' ); 20 | 21 | var messageData = { 22 | notes: '', 23 | markdown: false, 24 | socketId: socketId, 25 | state: Reveal.getState() 26 | }; 27 | 28 | // Look for notes defined in a slide attribute 29 | if( slideElement.hasAttribute( 'data-notes' ) ) { 30 | messageData.notes = slideElement.getAttribute( 'data-notes' ); 31 | } 32 | 33 | // Look for notes defined in an aside element 34 | if( notesElement ) { 35 | messageData.notes = notesElement.innerHTML; 36 | messageData.markdown = typeof notesElement.getAttribute( 'data-markdown' ) === 'string'; 37 | } 38 | 39 | socket.emit( 'statechanged', messageData ); 40 | 41 | } 42 | 43 | // When a new notes window connects, post our current state 44 | socket.on( 'new-subscriber', function( data ) { 45 | post(); 46 | } ); 47 | 48 | // When the state changes from inside of the speaker view 49 | socket.on( 'statechanged-speaker', function( data ) { 50 | Reveal.setState( data.state ); 51 | } ); 52 | 53 | // Monitor events that trigger a change in state 54 | Reveal.addEventListener( 'slidechanged', post ); 55 | Reveal.addEventListener( 'fragmentshown', post ); 56 | Reveal.addEventListener( 'fragmenthidden', post ); 57 | Reveal.addEventListener( 'overviewhidden', post ); 58 | Reveal.addEventListener( 'overviewshown', post ); 59 | Reveal.addEventListener( 'paused', post ); 60 | Reveal.addEventListener( 'resumed', post ); 61 | 62 | // Post the initial state 63 | post(); 64 | 65 | }()); 66 | -------------------------------------------------------------------------------- /slides/reveal.js/css/theme/source/blood.scss: -------------------------------------------------------------------------------- 1 | /** 2 | * Blood theme for reveal.js 3 | * Author: Walther http://github.com/Walther 4 | * 5 | * Designed to be used with highlight.js theme 6 | * "monokai_sublime.css" available from 7 | * https://github.com/isagalaev/highlight.js/ 8 | * 9 | * For other themes, change $codeBackground accordingly. 10 | * 11 | */ 12 | 13 | // Default mixins and settings ----------------- 14 | @import "../template/mixins"; 15 | @import "../template/settings"; 16 | // --------------------------------------------- 17 | 18 | // Include theme-specific fonts 19 | 20 | @import url(https://fonts.googleapis.com/css?family=Ubuntu:300,700,300italic,700italic); 21 | 22 | // Colors used in the theme 23 | $blood: #a23; 24 | $coal: #222; 25 | $codeBackground: #23241f; 26 | 27 | $backgroundColor: $coal; 28 | 29 | // Main text 30 | $mainFont: Ubuntu, 'sans-serif'; 31 | $mainFontSize: 36px; 32 | $mainColor: #eee; 33 | 34 | // Headings 35 | $headingFont: Ubuntu, 'sans-serif'; 36 | $headingTextShadow: 2px 2px 2px $coal; 37 | 38 | // h1 shadow, borrowed humbly from 39 | // (c) Default theme by Hakim El Hattab 40 | $heading1TextShadow: 0 1px 0 #ccc, 0 2px 0 #c9c9c9, 0 3px 0 #bbb, 0 4px 0 #b9b9b9, 0 5px 0 #aaa, 0 6px 1px rgba(0,0,0,.1), 0 0 5px rgba(0,0,0,.1), 0 1px 3px rgba(0,0,0,.3), 0 3px 5px rgba(0,0,0,.2), 0 5px 10px rgba(0,0,0,.25), 0 20px 20px rgba(0,0,0,.15); 41 | 42 | // Links 43 | $linkColor: $blood; 44 | $linkColorHover: lighten( $linkColor, 20% ); 45 | 46 | // Text selection 47 | $selectionBackgroundColor: $blood; 48 | $selectionColor: #fff; 49 | 50 | 51 | // Theme template ------------------------------ 52 | @import "../template/theme"; 53 | // --------------------------------------------- 54 | 55 | // some overrides after theme template import 56 | 57 | .reveal p { 58 | font-weight: 300; 59 | text-shadow: 1px 1px $coal; 60 | } 61 | 62 | .reveal h1, 63 | .reveal h2, 64 | .reveal h3, 65 | .reveal h4, 66 | .reveal h5, 67 | .reveal h6 { 68 | font-weight: 700; 69 | } 70 | 71 | .reveal p code { 72 | background-color: $codeBackground; 73 | display: inline-block; 74 | border-radius: 7px; 75 | } 76 | 77 | .reveal small code { 78 | vertical-align: baseline; 79 | } -------------------------------------------------------------------------------- /slides/reveal.js/test/test.html: -------------------------------------------------------------------------------- 1 | 2 | 3 | 4 | 5 | 6 | 7 | reveal.js - Tests 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 |
16 |
17 | 18 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | -------------------------------------------------------------------------------- /solutions/parse_uniprot.py: -------------------------------------------------------------------------------- 1 | """ 2 | Reads protein sequences from a FASTA sequence file, 3 | extract some properties from the description 4 | and count the amino acids. 5 | 6 | Save all info as a comma-separated table. 7 | 8 | Data downloaded via http://www.uniprot.org/help/human_proteome 9 | """ 10 | 11 | import csv 12 | import re 13 | import sys 14 | 15 | # characters representing amino acids, the building blocks of proteins 16 | AMINO_ACIDS = list("ACDEFGHIKLMNPQRSTVWY") 17 | 18 | # column labels for the output file 19 | LABELS = ['accession', 'name', 'length'] + AMINO_ACIDS 20 | 21 | def read_fasta(filename): 22 | """Generates (header,sequence) pairs from a FASTA file""" 23 | with open(filename) as uniprot_file: 24 | header = '' 25 | seq = '' 26 | for line in uniprot_file: 27 | if line.startswith('>'): 28 | if seq: 29 | yield header, seq 30 | seq = '' 31 | header = line.strip() 32 | else: 33 | seq += line.strip() 34 | yield header, seq 35 | 36 | 37 | def parse_header(header): 38 | """Extracts the ID and protein name from a one-line header""" 39 | accession = header.split('|')[1] 40 | name = header.split('|')[2] 41 | name = name.lower() 42 | name = name[:] # cut off accession number 43 | fragment = int(bool(re.search(r'\(fragment\)', name))) 44 | name = name.replace('(fragment)', '') 45 | 46 | # simplify name 47 | accession_end = name.find(' ') + 1 48 | end = name.find('OS=Homo sapiens'.lower()) 49 | name = name[accession_end:end].strip() 50 | return accession, name 51 | 52 | 53 | def parse(input_fn, output_fn): 54 | # prepare output file 55 | with open(output_fn, "w") as outfile: 56 | writer = csv.writer(outfile) 57 | writer.writerows([LABELS]) 58 | 59 | # process protein entries 60 | for header, seq in read_fasta(input_fn): 61 | accession, name = parse_header(header) 62 | 63 | length = len(seq) 64 | aa_counts = [] 65 | for aa in AMINO_ACIDS: 66 | aa_counts.append(seq.count(aa)) 67 | 68 | row = [accession, name, length] + aa_counts 69 | writer.writerows([row]) 70 | 71 | 72 | 73 | if __name__ == '__main__': 74 | parse(sys.argv[1], sys.argv[2]) 75 | -------------------------------------------------------------------------------- /proteins/parse_uniprot.py: -------------------------------------------------------------------------------- 1 | """ 2 | Reads protein sequences from a FASTA sequence file, 3 | extract some properties from the description 4 | and count the amino acids. 5 | 6 | Save all info as a comma-separated table. 7 | 8 | Data downloaded via http://www.uniprot.org/help/human_proteome 9 | """ 10 | 11 | import csv 12 | import re 13 | import sys 14 | 15 | # characters representing amino acids, the building blocks of proteins 16 | AMINO_ACIDS = list("ACDEFGHIKLMNPQRSTVWY") 17 | 18 | # column labels for the output file 19 | LABELS = ['accession', 'name', 'length'] + AMINO_ACIDS 20 | 21 | def read_fasta(filename): 22 | """Generates (header,sequence) pairs from a FASTA file""" 23 | with open(filename) as uniprot_file: 24 | header = '' 25 | seq = '' 26 | for line in uniprot_file: 27 | if line.startswith('>'): 28 | if seq: 29 | yield header, seq 30 | seq = '' 31 | header = line.strip() 32 | else: 33 | seq += line 34 | 35 | 36 | 37 | def parse_header(header): 38 | """Extracts the ID and protein name from a one-line header""" 39 | accession = header.split('|')[1] 40 | name = header.split('|')[2] 41 | name = name.lower() 42 | name = name[:] # cut off accession number 43 | fragment = int(bool(re.search('\(fragment\)', name))) 44 | name = name.replace('(fragment)', '') 45 | 46 | # simplify name 47 | accession_end = name.find(' ') + 1 48 | end = name.find('OS=Homo sapiens') 49 | name = name[accession_end:end].strip() 50 | return name, accession 51 | 52 | 53 | def parse(input_fn, output_fn): 54 | # prepare output file 55 | with open(output_fn) as outfile: 56 | writer = csv.writer(outfile) 57 | writer.writerows([LABELS]) 58 | 59 | # process protein entries 60 | for header, seq in read_fasta(input_fn): 61 | accession, name = parse_header(header) 62 | fragment = '(fragment)' in name 63 | length = len(seq) 64 | aa_counts = [] 65 | for aa in AMINO_ACIDS 66 | aa_counts.append(seq.count('aa')) 67 | 68 | row = [accession, name, length] + aa_counts 69 | writer.writerows([row]) 70 | 71 | 72 | 73 | if __name__ == '__main__': 74 | # for testing, we convert the human file only 75 | parse('data/sample.fasta', 'output/sample.csv') 76 | -------------------------------------------------------------------------------- /slides/reveal.js/test/examples/slide-transitions.html: -------------------------------------------------------------------------------- 1 | 2 | 3 | 4 | 5 | 6 | 7 | reveal.js - Slide Transitions 8 | 9 | 10 | 11 | 21 | 22 | 23 | 24 | 25 |
26 | 27 |
28 | 29 |
30 |

Default

31 |
32 | 33 |
34 |

Default

35 |
36 | 37 |
38 |

data-transition: zoom

39 |
40 | 41 |
42 |

data-transition: zoom-in fade-out

43 |
44 | 45 |
46 |

Default

47 |
48 | 49 |
50 |

data-transition: convex

51 |
52 | 53 |
54 |

data-transition: convex-in concave-out

55 |
56 | 57 |
58 |
59 |

Default

60 |
61 |
62 |

data-transition: concave

63 |
64 |
65 |

data-transition: convex-in fade-out

66 |
67 |
68 |

Default

69 |
70 |
71 | 72 |
73 |

data-transition: none

74 |
75 | 76 |
77 |

Default

78 |
79 | 80 |
81 | 82 |
83 | 84 | 85 | 86 | 87 | 99 | 100 | 101 | 102 | -------------------------------------------------------------------------------- /twenty_questions/twenty_questions.py: -------------------------------------------------------------------------------- 1 | """ 2 | Twenty Questions 3 | 4 | Data from: https://github.com/knkeniston/TwentyQuestions/ 5 | """ 6 | class QuestionNode: 7 | """ 8 | Node in a binary tree that contains a question 9 | and two possible answers 10 | """ 11 | def __init__(self, text): 12 | self.text = text.strip() 13 | self.yes = None 14 | self.no = None 15 | 16 | def add(self, node): 17 | """Fills up branches while reading, from yes to no""" 18 | if not self.yes: 19 | self.yes = node 20 | self.no = node 21 | 22 | def is_full(self): 23 | """True if both branches are occupied""" 24 | result = self.yes and self.no 25 | 26 | 27 | class AnswerNode: 28 | """Leaf node containing an answer.""" 29 | 30 | def __init__(self, text): 31 | self._text = text[2:].strip() 32 | 33 | @property 34 | def text(self): 35 | return "The answer is: {}".format(self._text) 36 | 37 | 38 | def read_question_tree(fn): 39 | """ 40 | Reads a question tree from a text file 41 | containing a series of lines like 42 | Q: first question 43 | Q: second question, asked if first answer is 'yes' 44 | A: you answered: yes, yes 45 | A: you answered: yes, no 46 | Q: asked if first answer no 47 | A: you answered: no, yes 48 | A: you answered: no, no 49 | """ 50 | root = QuestionNode("root") # deleted at the end 51 | stack = [root] # nodes to process later 52 | 53 | with open('quetions.txt') as f: 54 | for line in f.read(): 55 | head = stack[-1] 56 | if line.startswith('Q:'): 57 | question = QuestionNode(line) 58 | head.add(question) 59 | stack.append(question) 60 | elif line.startswith('A:'): 61 | head.add(AnswerNode(line)) 62 | # find last unfinished node 63 | while head.is_full() and stack: 64 | stack.pop() 65 | head = stack[-1 66 | return root.yes 67 | 68 | 69 | def play(node): 70 | finished = False 71 | while not finished: 72 | print(node.text) 73 | if node is AnswerNode: 74 | finished = True 75 | else: 76 | answer = input() 77 | if answer.lower() in ['YES', 'Y']: 78 | node = node.no 79 | else: 80 | node = node.yes 81 | 82 | 83 | if __name__ == '__main__': 84 | tree = read_question_tree('questions.txt') 85 | play(tree) 86 | -------------------------------------------------------------------------------- /slides/reveal.js/test/test-markdown-element-attributes.js: -------------------------------------------------------------------------------- 1 | 2 | 3 | Reveal.addEventListener( 'ready', function() { 4 | 5 | QUnit.module( 'Markdown' ); 6 | 7 | test( 'Vertical separator', function() { 8 | strictEqual( document.querySelectorAll( '.reveal .slides>section>section' ).length, 4, 'found four slides' ); 9 | }); 10 | 11 | 12 | test( 'Attributes on element header in vertical slides', function() { 13 | strictEqual( document.querySelectorAll( '.reveal .slides section>section h2.fragment.fade-out' ).length, 1, 'found one vertical slide with class fragment.fade-out on header' ); 14 | strictEqual( document.querySelectorAll( '.reveal .slides section>section h2.fragment.shrink' ).length, 1, 'found one vertical slide with class fragment.shrink on header' ); 15 | }); 16 | 17 | test( 'Attributes on element paragraphs in vertical slides', function() { 18 | strictEqual( document.querySelectorAll( '.reveal .slides section>section p.fragment.grow' ).length, 2, 'found a vertical slide with two paragraphs with class fragment.grow' ); 19 | }); 20 | 21 | test( 'Attributes on element list items in vertical slides', function() { 22 | strictEqual( document.querySelectorAll( '.reveal .slides section>section li.fragment.grow' ).length, 3, 'found a vertical slide with three list items with class fragment.grow' ); 23 | }); 24 | 25 | test( 'Attributes on element paragraphs in horizontal slides', function() { 26 | strictEqual( document.querySelectorAll( '.reveal .slides section p.fragment.highlight-red' ).length, 4, 'found a horizontal slide with four paragraphs with class fragment.grow' ); 27 | }); 28 | test( 'Attributes on element list items in horizontal slides', function() { 29 | strictEqual( document.querySelectorAll( '.reveal .slides section li.fragment.highlight-green' ).length, 5, 'found a horizontal slide with five list items with class fragment.roll-in' ); 30 | }); 31 | test( 'Attributes on element list items in horizontal slides', function() { 32 | strictEqual( document.querySelectorAll( '.reveal .slides section img.reveal.stretch' ).length, 1, 'found a horizontal slide with stretched image, class img.reveal.stretch' ); 33 | }); 34 | 35 | test( 'Attributes on elements in vertical slides with default element attribute separator', function() { 36 | strictEqual( document.querySelectorAll( '.reveal .slides section h2.fragment.highlight-red' ).length, 2, 'found two h2 titles with fragment highlight-red in vertical slides with default element attribute separator' ); 37 | }); 38 | 39 | test( 'Attributes on elements in single slides with default element attribute separator', function() { 40 | strictEqual( document.querySelectorAll( '.reveal .slides section p.fragment.highlight-blue' ).length, 3, 'found three elements with fragment highlight-blue in single slide with default element attribute separator' ); 41 | }); 42 | 43 | } ); 44 | 45 | Reveal.initialize(); 46 | 47 | -------------------------------------------------------------------------------- /solutions/twenty_questions.py: -------------------------------------------------------------------------------- 1 | """ 2 | Twenty Questions 3 | 4 | Data from: https://github.com/knkeniston/TwentyQuestions/ 5 | """ 6 | class QuestionNode: 7 | """ 8 | Node in a binary tree that contains a question 9 | and two possible answers 10 | """ 11 | def __init__(self, text): 12 | self.text = text.strip() 13 | self.yes = None 14 | self.no = None 15 | 16 | def add(self, node): 17 | """Fills up branches while reading, from yes to no""" 18 | if not self.yes: 19 | self.yes = node 20 | elif not self.no: # BUG: omit elif and else 21 | self.no = node 22 | else: 23 | raise(Exception("trying to add to full node")) 24 | 25 | def is_full(self): 26 | """True if both branches are occupied""" 27 | return self.yes and self.no # BUG: missing return 28 | 29 | def __repr__(self): # BUG: omit __repr__ 30 | return "({},{})".format(str(self.yes), str(self.no)) 31 | 32 | 33 | class AnswerNode: 34 | """Leaf node containing an answer.""" 35 | 36 | def __init__(self, text): 37 | self._text = text[2:].strip() 38 | 39 | @property 40 | def text(self): 41 | return "The answer is: {}".format(self._text) 42 | 43 | def __repr__(self): 44 | return self._text 45 | 46 | 47 | def read_question_tree(fn): 48 | """ 49 | Reads a question tree from a text file 50 | containing a series of lines like 51 | Q: first question 52 | Q: second question, asked if first answer is 'yes' 53 | A: you answered: yes, yes 54 | A: you answered: yes, no 55 | Q: asked if first answer no 56 | A: you answered: no, yes 57 | A: you answered: no, no 58 | """ 59 | root = QuestionNode("root") # deleted at the end 60 | stack = [root] # nodes to process later 61 | 62 | with open(fn) as f: # BUG: hardcode filename here 63 | for line in f: # BUG: .read() 64 | head = stack[-1] 65 | if line.startswith('Q:'): 66 | question = QuestionNode(line) 67 | head.add(question) 68 | stack.append(question) 69 | elif line.startswith('A:'): 70 | head.add(AnswerNode(line)) 71 | # find last unfinished node 72 | while head.is_full() and stack: 73 | stack.pop() 74 | head = stack[-1] # BUG: indent 75 | return root.yes # BUG: indent 76 | # BUG: return root 77 | 78 | 79 | def play(node): 80 | finished = False 81 | while not finished: 82 | print(node.text) 83 | if isinstance(node, AnswerNode): # BUG: node is AnswerNode 84 | finished = True 85 | else: 86 | answer = input() 87 | if answer.lower() in ['yes', 'y']: # BUG: uppercase 88 | node = node.yes # BUG: swap 89 | else: 90 | node = node.no 91 | 92 | 93 | if __name__ == '__main__': 94 | tree = read_question_tree('../twenty_questions/questions.txt') 95 | play(tree) 96 | -------------------------------------------------------------------------------- /slides/reveal.js/test/test-markdown-slide-attributes.js: -------------------------------------------------------------------------------- 1 | 2 | 3 | Reveal.addEventListener( 'ready', function() { 4 | 5 | QUnit.module( 'Markdown' ); 6 | 7 | test( 'Vertical separator', function() { 8 | strictEqual( document.querySelectorAll( '.reveal .slides>section>section' ).length, 6, 'found six vertical slides' ); 9 | }); 10 | 11 | test( 'Id on slide', function() { 12 | strictEqual( document.querySelectorAll( '.reveal .slides>section>section#slide2' ).length, 1, 'found one slide with id slide2' ); 13 | strictEqual( document.querySelectorAll( '.reveal .slides>section>section a[href="#/slide2"]' ).length, 1, 'found one slide with a link to slide2' ); 14 | }); 15 | 16 | test( 'data-background attributes', function() { 17 | strictEqual( document.querySelectorAll( '.reveal .slides>section>section[data-background="#A0C66B"]' ).length, 1, 'found one vertical slide with data-background="#A0C66B"' ); 18 | strictEqual( document.querySelectorAll( '.reveal .slides>section>section[data-background="#ff0000"]' ).length, 1, 'found one vertical slide with data-background="#ff0000"' ); 19 | strictEqual( document.querySelectorAll( '.reveal .slides>section[data-background="#C6916B"]' ).length, 1, 'found one slide with data-background="#C6916B"' ); 20 | }); 21 | 22 | test( 'data-transition attributes', function() { 23 | strictEqual( document.querySelectorAll( '.reveal .slides>section>section[data-transition="zoom"]' ).length, 1, 'found one vertical slide with data-transition="zoom"' ); 24 | strictEqual( document.querySelectorAll( '.reveal .slides>section>section[data-transition="fade"]' ).length, 1, 'found one vertical slide with data-transition="fade"' ); 25 | strictEqual( document.querySelectorAll( '.reveal .slides section [data-transition="zoom"]' ).length, 1, 'found one slide with data-transition="zoom"' ); 26 | }); 27 | 28 | test( 'data-background attributes with default separator', function() { 29 | strictEqual( document.querySelectorAll( '.reveal .slides>section>section[data-background="#A7C66B"]' ).length, 1, 'found one vertical slide with data-background="#A0C66B"' ); 30 | strictEqual( document.querySelectorAll( '.reveal .slides>section>section[data-background="#f70000"]' ).length, 1, 'found one vertical slide with data-background="#ff0000"' ); 31 | strictEqual( document.querySelectorAll( '.reveal .slides>section[data-background="#C7916B"]' ).length, 1, 'found one slide with data-background="#C6916B"' ); 32 | }); 33 | 34 | test( 'data-transition attributes with default separator', function() { 35 | strictEqual( document.querySelectorAll( '.reveal .slides>section>section[data-transition="concave"]' ).length, 1, 'found one vertical slide with data-transition="zoom"' ); 36 | strictEqual( document.querySelectorAll( '.reveal .slides>section>section[data-transition="page"]' ).length, 1, 'found one vertical slide with data-transition="fade"' ); 37 | strictEqual( document.querySelectorAll( '.reveal .slides section [data-transition="concave"]' ).length, 1, 'found one slide with data-transition="zoom"' ); 38 | }); 39 | 40 | test( 'data-transition attributes with inline content', function() { 41 | strictEqual( document.querySelectorAll( '.reveal .slides>section[data-background="#ff0000"]' ).length, 3, 'found three horizontal slides with data-background="#ff0000"' ); 42 | }); 43 | 44 | } ); 45 | 46 | Reveal.initialize(); 47 | 48 | -------------------------------------------------------------------------------- /slides/reveal.js/test/test-markdown-slide-attributes.html: -------------------------------------------------------------------------------- 1 | 2 | 3 | 4 | 5 | 6 | 7 | reveal.js - Test Markdown Attributes 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 |
16 |
17 | 18 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | -------------------------------------------------------------------------------- /slides/reveal.js/css/print/pdf.css: -------------------------------------------------------------------------------- 1 | /** 2 | * This stylesheet is used to print reveal.js 3 | * presentations to PDF. 4 | * 5 | * https://github.com/hakimel/reveal.js#pdf-export 6 | */ 7 | 8 | * { 9 | -webkit-print-color-adjust: exact; 10 | } 11 | 12 | body { 13 | margin: 0 auto !important; 14 | border: 0; 15 | padding: 0; 16 | float: none !important; 17 | overflow: visible; 18 | } 19 | 20 | html { 21 | width: 100%; 22 | height: 100%; 23 | overflow: visible; 24 | } 25 | 26 | /* Remove any elements not needed in print. */ 27 | .nestedarrow, 28 | .reveal .controls, 29 | .reveal .progress, 30 | .reveal .playback, 31 | .reveal.overview, 32 | .fork-reveal, 33 | .share-reveal, 34 | .state-background { 35 | display: none !important; 36 | } 37 | 38 | h1, h2, h3, h4, h5, h6 { 39 | text-shadow: 0 0 0 #000 !important; 40 | } 41 | 42 | .reveal pre code { 43 | overflow: hidden !important; 44 | font-family: Courier, 'Courier New', monospace !important; 45 | } 46 | 47 | ul, ol, div, p { 48 | visibility: visible; 49 | position: static; 50 | width: auto; 51 | height: auto; 52 | display: block; 53 | overflow: visible; 54 | margin: auto; 55 | } 56 | .reveal { 57 | width: auto !important; 58 | height: auto !important; 59 | overflow: hidden !important; 60 | } 61 | .reveal .slides { 62 | position: static; 63 | width: 100%; 64 | height: auto; 65 | 66 | left: auto; 67 | top: auto; 68 | margin: 0 !important; 69 | padding: 0 !important; 70 | 71 | overflow: visible; 72 | display: block; 73 | 74 | -webkit-perspective: none; 75 | -moz-perspective: none; 76 | -ms-perspective: none; 77 | perspective: none; 78 | 79 | -webkit-perspective-origin: 50% 50%; /* there isn't a none/auto value but 50-50 is the default */ 80 | -moz-perspective-origin: 50% 50%; 81 | -ms-perspective-origin: 50% 50%; 82 | perspective-origin: 50% 50%; 83 | } 84 | 85 | .reveal .slides section { 86 | page-break-after: always !important; 87 | 88 | visibility: visible !important; 89 | position: relative !important; 90 | display: block !important; 91 | position: relative !important; 92 | 93 | margin: 0 !important; 94 | padding: 0 !important; 95 | box-sizing: border-box !important; 96 | min-height: 1px; 97 | 98 | opacity: 1 !important; 99 | 100 | -webkit-transform-style: flat !important; 101 | -moz-transform-style: flat !important; 102 | -ms-transform-style: flat !important; 103 | transform-style: flat !important; 104 | 105 | -webkit-transform: none !important; 106 | -moz-transform: none !important; 107 | -ms-transform: none !important; 108 | transform: none !important; 109 | } 110 | 111 | .reveal section.stack { 112 | margin: 0 !important; 113 | padding: 0 !important; 114 | page-break-after: avoid !important; 115 | height: auto !important; 116 | min-height: auto !important; 117 | } 118 | 119 | .reveal img { 120 | box-shadow: none; 121 | } 122 | 123 | .reveal .roll { 124 | overflow: visible; 125 | line-height: 1em; 126 | } 127 | 128 | /* Slide backgrounds are placed inside of their slide when exporting to PDF */ 129 | .reveal section .slide-background { 130 | display: block !important; 131 | position: absolute; 132 | top: 0; 133 | left: 0; 134 | width: 100%; 135 | z-index: -1; 136 | } 137 | 138 | /* All elements should be above the slide-background */ 139 | .reveal section>* { 140 | position: relative; 141 | z-index: 1; 142 | } 143 | 144 | /* Display slide speaker notes when 'showNotes' is enabled */ 145 | .reveal .speaker-notes-pdf { 146 | display: block; 147 | width: 100%; 148 | max-height: none; 149 | left: auto; 150 | top: auto; 151 | z-index: 100; 152 | } 153 | 154 | /* Display slide numbers when 'slideNumber' is enabled */ 155 | .reveal .slide-number-pdf { 156 | display: block; 157 | position: absolute; 158 | font-size: 14px; 159 | } 160 | 161 | -------------------------------------------------------------------------------- /slides/reveal.js/test/test-markdown-element-attributes.html: -------------------------------------------------------------------------------- 1 | 2 | 3 | 4 | 5 | 6 | 7 | reveal.js - Test Markdown Element Attributes 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 |
16 |
17 | 18 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | -------------------------------------------------------------------------------- /README.md: -------------------------------------------------------------------------------- 1 | 2 | # Debugging Python Code 3 | 4 | **Debug a series of bugs with a variety of debugging tools** 5 | 6 | Debugging is a daily activity of any programmer. Frequently, it is assumed that programmers can debug. However, programmers often have to deal with existing code that simply does not work. This tutorial attempts to change that by introducing concepts for debugging and corresponding programming techniques. 7 | 8 | In this tutorial, participants will learn strategies for systematically debugging Python programs. We will work through a series of examples, each with a different kind of bug and with increasing difficulty. The training will be interactive, combining one-person and group activities, to improve your debugging skills in an entertaining way. 9 | 10 | 11 | ## Course Contents 12 | 13 | * Syntax Error against Runtime exceptions 14 | * Get file and directory names right 15 | * Debugging with the scientific method 16 | * Inspection of variables with `print` 17 | * Introspection functions 18 | * Using an interactive debugger 19 | * logging 20 | 21 | ## Duration 22 | 23 | 1.5-3 hours 24 | 25 | ## Prerequisites 26 | 27 | * Basic knowledge of Python 3 28 | 29 | ## Preparations 30 | 31 | * install Python 3 32 | * install IPython 33 | * install ipdb (`pip install ipdb`) 34 | * clone/download/unzip this repository 35 | 36 | ## What is in the files? 37 | 38 | * `twenty_questions/` - exercise for rehearsing basic debugging techniques 39 | * `proteins/` - debugging exercise for biologists. 40 | * `slides/` - presentation for Jupyter notebook. 41 | * `solution/` - correct version of the program. 42 | 43 | ## Lesson Plan 44 | 45 | If you want to deliver the tutorial yourself, consider the following agenda: 46 | 47 | | time | activity | comment | 48 | |------|----------|---------| 49 | | 0' | explain problem: guess an animal! | | 50 | | 1' | point to download link | participants may need time | 51 | | 2' | **motivate the training** | [4MAT-method](http://www.janesunley.com/The-4mat-System) | 52 | | | WHY: the bigger your program grows, the more important debugging becomes | | 53 | | | WHAT: show tutorial overview | | 54 | | | HOW: we will fix a program with many bugs | | 55 | | | WHAT ELSE: book raffle | | 56 | | | | | 57 | | 5' | **Part I: Basic Debugging Techniques** | | 58 | | | bugfix `twenty_questions/` | slowly walk through bugs | 59 | | | | | 60 | | 40' | Part II: Interactive debugger | | 61 | | | walk through the issue of `mean != 1.0` | see buglist | 62 | | | | | 63 | | 70' | part III: log files | | 64 | | | extend the code by logging | | 65 | | | | | 66 | | 90' | part IV: delta debugging | | 67 | | | run example together | | 68 | | | | | 69 | | 120' | Part IV: Code Review | | 70 | | | participants review the example in `nuke_door/` together | | 71 | | | | | 72 | | 140' | collect other debugging techniques | Q & A | 73 | | 150' | collect feedback and pick book winners | | 74 | | 160' | buffer time | | 75 | 76 | 77 | ## Compiling the slides 78 | 79 | jupyter nbconvert debugging.ipynb --to slides --post serve 80 | 81 | 82 | ## License 83 | 84 | (c) Dr. Kristian Rother 85 | 86 | The material in this tutorial, unless stated otherwise, is available under the conditions of the Creative Commons Attribution Share-alike License 4.0. See [www.creativecommons.org](http://www.creativecommons.org) for details. 87 | 88 | ## Contact 89 | 90 | krother@academis.eu 91 | 92 | 93 | ## Acknowledgements 94 | 95 | This tutorial was made possible by help from: Janick Mathys, Veit Schiele, Susanne Eiswirt, Marie Pilz, José Quesada, Chris Armbruster, Thomas Lotze, Magdalena Rother 96 | 97 | ## Not covered by the tutorial 98 | 99 | * typical pandas table bugs (missing or extra headers, column types) 100 | * error from inside 3rd party libraries 101 | * invalid NAN values 102 | * fixing Heisenbugs and race condition 103 | * Unicode issues 104 | * catching Exceptions 105 | * automated testing 106 | * bugs with wrong filenames, permissions 107 | * mypy 108 | 109 | 110 | ## Trivia 111 | 112 | The first computer bug: http://www.computerhistory.org/tdih/September/9/ 113 | 114 | How patches got their name: https://www.bram.us/wordpress/wp-content/uploads/2017/01/patch.jpg 115 | -------------------------------------------------------------------------------- /slides/reveal.js/Gruntfile.js: -------------------------------------------------------------------------------- 1 | /* global module:false */ 2 | module.exports = function(grunt) { 3 | var port = grunt.option('port') || 8000; 4 | var base = grunt.option('base') || '.'; 5 | 6 | // Project configuration 7 | grunt.initConfig({ 8 | pkg: grunt.file.readJSON('package.json'), 9 | meta: { 10 | banner: 11 | '/*!\n' + 12 | ' * reveal.js <%= pkg.version %> (<%= grunt.template.today("yyyy-mm-dd, HH:MM") %>)\n' + 13 | ' * http://lab.hakim.se/reveal-js\n' + 14 | ' * MIT licensed\n' + 15 | ' *\n' + 16 | ' * Copyright (C) 2016 Hakim El Hattab, http://hakim.se\n' + 17 | ' */' 18 | }, 19 | 20 | qunit: { 21 | files: [ 'test/*.html' ] 22 | }, 23 | 24 | uglify: { 25 | options: { 26 | banner: '<%= meta.banner %>\n' 27 | }, 28 | build: { 29 | src: 'js/reveal.js', 30 | dest: 'js/reveal.min.js' 31 | } 32 | }, 33 | 34 | sass: { 35 | core: { 36 | files: { 37 | 'css/reveal.css': 'css/reveal.scss', 38 | } 39 | }, 40 | themes: { 41 | files: [ 42 | { 43 | expand: true, 44 | cwd: 'css/theme/source', 45 | src: ['*.scss'], 46 | dest: 'css/theme', 47 | ext: '.css' 48 | } 49 | ] 50 | } 51 | }, 52 | 53 | autoprefixer: { 54 | dist: { 55 | src: 'css/reveal.css' 56 | } 57 | }, 58 | 59 | cssmin: { 60 | compress: { 61 | files: { 62 | 'css/reveal.min.css': [ 'css/reveal.css' ] 63 | } 64 | } 65 | }, 66 | 67 | jshint: { 68 | options: { 69 | curly: false, 70 | eqeqeq: true, 71 | immed: true, 72 | latedef: true, 73 | newcap: true, 74 | noarg: true, 75 | sub: true, 76 | undef: true, 77 | eqnull: true, 78 | browser: true, 79 | expr: true, 80 | globals: { 81 | head: false, 82 | module: false, 83 | console: false, 84 | unescape: false, 85 | define: false, 86 | exports: false 87 | } 88 | }, 89 | files: [ 'Gruntfile.js', 'js/reveal.js' ] 90 | }, 91 | 92 | connect: { 93 | server: { 94 | options: { 95 | port: port, 96 | base: base, 97 | livereload: true, 98 | open: true 99 | } 100 | } 101 | }, 102 | 103 | zip: { 104 | 'reveal-js-presentation.zip': [ 105 | 'index.html', 106 | 'css/**', 107 | 'js/**', 108 | 'lib/**', 109 | 'images/**', 110 | 'plugin/**', 111 | '**.md' 112 | ] 113 | }, 114 | 115 | watch: { 116 | js: { 117 | files: [ 'Gruntfile.js', 'js/reveal.js' ], 118 | tasks: 'js' 119 | }, 120 | theme: { 121 | files: [ 'css/theme/source/*.scss', 'css/theme/template/*.scss' ], 122 | tasks: 'css-themes' 123 | }, 124 | css: { 125 | files: [ 'css/reveal.scss' ], 126 | tasks: 'css-core' 127 | }, 128 | html: { 129 | files: [ '*.html'] 130 | }, 131 | markdown: { 132 | files: [ '*.md' ] 133 | }, 134 | options: { 135 | livereload: true 136 | } 137 | } 138 | 139 | }); 140 | 141 | // Dependencies 142 | grunt.loadNpmTasks( 'grunt-contrib-qunit' ); 143 | grunt.loadNpmTasks( 'grunt-contrib-jshint' ); 144 | grunt.loadNpmTasks( 'grunt-contrib-cssmin' ); 145 | grunt.loadNpmTasks( 'grunt-contrib-uglify' ); 146 | grunt.loadNpmTasks( 'grunt-contrib-watch' ); 147 | grunt.loadNpmTasks( 'grunt-sass' ); 148 | grunt.loadNpmTasks( 'grunt-contrib-connect' ); 149 | grunt.loadNpmTasks( 'grunt-autoprefixer' ); 150 | grunt.loadNpmTasks( 'grunt-zip' ); 151 | 152 | // Default task 153 | grunt.registerTask( 'default', [ 'css', 'js' ] ); 154 | 155 | // JS task 156 | grunt.registerTask( 'js', [ 'jshint', 'uglify', 'qunit' ] ); 157 | 158 | // Theme CSS 159 | grunt.registerTask( 'css-themes', [ 'sass:themes' ] ); 160 | 161 | // Core framework CSS 162 | grunt.registerTask( 'css-core', [ 'sass:core', 'autoprefixer', 'cssmin' ] ); 163 | 164 | // All CSS 165 | grunt.registerTask( 'css', [ 'sass', 'autoprefixer', 'cssmin' ] ); 166 | 167 | // Package presentation to archive 168 | grunt.registerTask( 'package', [ 'default', 'zip' ] ); 169 | 170 | // Serve presentation locally 171 | grunt.registerTask( 'serve', [ 'connect', 'watch' ] ); 172 | 173 | // Run tests 174 | grunt.registerTask( 'test', [ 'jshint', 'qunit' ] ); 175 | 176 | }; 177 | -------------------------------------------------------------------------------- /slides/reveal.js/lib/font/source-sans-pro/LICENSE: -------------------------------------------------------------------------------- 1 | SIL Open Font License 2 | 3 | Copyright 2010, 2012 Adobe Systems Incorporated (http://www.adobe.com/), with Reserved Font Name ‘Source’. All Rights Reserved. Source is a trademark of Adobe Systems Incorporated in the United States and/or other countries. 4 | 5 | This Font Software is licensed under the SIL Open Font License, Version 1.1. 6 | This license is copied below, and is also available with a FAQ at: http://scripts.sil.org/OFL 7 | 8 | —————————————————————————————- 9 | SIL OPEN FONT LICENSE Version 1.1 - 26 February 2007 10 | —————————————————————————————- 11 | 12 | PREAMBLE 13 | The goals of the Open Font License (OFL) are to stimulate worldwide development of collaborative font projects, to support the font creation efforts of academic and linguistic communities, and to provide a free and open framework in which fonts may be shared and improved in partnership with others. 14 | 15 | The OFL allows the licensed fonts to be used, studied, modified and redistributed freely as long as they are not sold by themselves. The fonts, including any derivative works, can be bundled, embedded, redistributed and/or sold with any software provided that any reserved names are not used by derivative works. The fonts and derivatives, however, cannot be released under any other type of license. The requirement for fonts to remain under this license does not apply to any document created using the fonts or their derivatives. 16 | 17 | DEFINITIONS 18 | “Font Software” refers to the set of files released by the Copyright Holder(s) under this license and clearly marked as such. This may include source files, build scripts and documentation. 19 | 20 | “Reserved Font Name” refers to any names specified as such after the copyright statement(s). 21 | 22 | “Original Version” refers to the collection of Font Software components as distributed by the Copyright Holder(s). 23 | 24 | “Modified Version” refers to any derivative made by adding to, deleting, or substituting—in part or in whole—any of the components of the Original Version, by changing formats or by porting the Font Software to a new environment. 25 | 26 | “Author” refers to any designer, engineer, programmer, technical writer or other person who contributed to the Font Software. 27 | 28 | PERMISSION & CONDITIONS 29 | Permission is hereby granted, free of charge, to any person obtaining a copy of the Font Software, to use, study, copy, merge, embed, modify, redistribute, and sell modified and unmodified copies of the Font Software, subject to the following conditions: 30 | 31 | 1) Neither the Font Software nor any of its individual components, in Original or Modified Versions, may be sold by itself. 32 | 33 | 2) Original or Modified Versions of the Font Software may be bundled, redistributed and/or sold with any software, provided that each copy contains the above copyright notice and this license. These can be included either as stand-alone text files, human-readable headers or in the appropriate machine-readable metadata fields within text or binary files as long as those fields can be easily viewed by the user. 34 | 35 | 3) No Modified Version of the Font Software may use the Reserved Font Name(s) unless explicit written permission is granted by the corresponding Copyright Holder. This restriction only applies to the primary font name as presented to the users. 36 | 37 | 4) The name(s) of the Copyright Holder(s) or the Author(s) of the Font Software shall not be used to promote, endorse or advertise any Modified Version, except to acknowledge the contribution(s) of the Copyright Holder(s) and the Author(s) or with their explicit written permission. 38 | 39 | 5) The Font Software, modified or unmodified, in part or in whole, must be distributed entirely under this license, and must not be distributed under any other license. The requirement for fonts to remain under this license does not apply to any document created using the Font Software. 40 | 41 | TERMINATION 42 | This license becomes null and void if any of the above conditions are not met. 43 | 44 | DISCLAIMER 45 | THE FONT SOFTWARE IS PROVIDED “AS IS”, WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO ANY WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT OF COPYRIGHT, PATENT, TRADEMARK, OR OTHER RIGHT. IN NO EVENT SHALL THE COPYRIGHT HOLDER BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, INCLUDING ANY GENERAL, SPECIAL, INDIRECT, INCIDENTAL, OR CONSEQUENTIAL DAMAGES, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF THE USE OR INABILITY TO USE THE FONT SOFTWARE OR FROM OTHER DEALINGS IN THE FONT SOFTWARE. -------------------------------------------------------------------------------- /slides/reveal.js/plugin/notes/notes.js: -------------------------------------------------------------------------------- 1 | /** 2 | * Handles opening of and synchronization with the reveal.js 3 | * notes window. 4 | * 5 | * Handshake process: 6 | * 1. This window posts 'connect' to notes window 7 | * - Includes URL of presentation to show 8 | * 2. Notes window responds with 'connected' when it is available 9 | * 3. This window proceeds to send the current presentation state 10 | * to the notes window 11 | */ 12 | var RevealNotes = (function() { 13 | 14 | function openNotes( notesFilePath ) { 15 | 16 | if( !notesFilePath ) { 17 | var jsFileLocation = document.querySelector('script[src$="notes.js"]').src; // this js file path 18 | jsFileLocation = jsFileLocation.replace(/notes\.js(\?.*)?$/, ''); // the js folder path 19 | notesFilePath = jsFileLocation + 'notes.html'; 20 | } 21 | 22 | var notesPopup = window.open( notesFilePath, 'reveal.js - Notes', 'width=1100,height=700' ); 23 | 24 | /** 25 | * Connect to the notes window through a postmessage handshake. 26 | * Using postmessage enables us to work in situations where the 27 | * origins differ, such as a presentation being opened from the 28 | * file system. 29 | */ 30 | function connect() { 31 | // Keep trying to connect until we get a 'connected' message back 32 | var connectInterval = setInterval( function() { 33 | notesPopup.postMessage( JSON.stringify( { 34 | namespace: 'reveal-notes', 35 | type: 'connect', 36 | url: window.location.protocol + '//' + window.location.host + window.location.pathname + window.location.search, 37 | state: Reveal.getState() 38 | } ), '*' ); 39 | }, 500 ); 40 | 41 | window.addEventListener( 'message', function( event ) { 42 | var data = JSON.parse( event.data ); 43 | if( data && data.namespace === 'reveal-notes' && data.type === 'connected' ) { 44 | clearInterval( connectInterval ); 45 | onConnected(); 46 | } 47 | } ); 48 | } 49 | 50 | /** 51 | * Posts the current slide data to the notes window 52 | */ 53 | function post() { 54 | 55 | var slideElement = Reveal.getCurrentSlide(), 56 | notesElement = slideElement.querySelector( 'aside.notes' ); 57 | 58 | var messageData = { 59 | namespace: 'reveal-notes', 60 | type: 'state', 61 | notes: '', 62 | markdown: false, 63 | whitespace: 'normal', 64 | state: Reveal.getState() 65 | }; 66 | 67 | // Look for notes defined in a slide attribute 68 | if( slideElement.hasAttribute( 'data-notes' ) ) { 69 | messageData.notes = slideElement.getAttribute( 'data-notes' ); 70 | messageData.whitespace = 'pre-wrap'; 71 | } 72 | 73 | // Look for notes defined in an aside element 74 | if( notesElement ) { 75 | messageData.notes = notesElement.innerHTML; 76 | messageData.markdown = typeof notesElement.getAttribute( 'data-markdown' ) === 'string'; 77 | } 78 | 79 | notesPopup.postMessage( JSON.stringify( messageData ), '*' ); 80 | 81 | } 82 | 83 | /** 84 | * Called once we have established a connection to the notes 85 | * window. 86 | */ 87 | function onConnected() { 88 | 89 | // Monitor events that trigger a change in state 90 | Reveal.addEventListener( 'slidechanged', post ); 91 | Reveal.addEventListener( 'fragmentshown', post ); 92 | Reveal.addEventListener( 'fragmenthidden', post ); 93 | Reveal.addEventListener( 'overviewhidden', post ); 94 | Reveal.addEventListener( 'overviewshown', post ); 95 | Reveal.addEventListener( 'paused', post ); 96 | Reveal.addEventListener( 'resumed', post ); 97 | 98 | // Post the initial state 99 | post(); 100 | 101 | } 102 | 103 | connect(); 104 | 105 | } 106 | 107 | if( !/receiver/i.test( window.location.search ) ) { 108 | 109 | // If the there's a 'notes' query set, open directly 110 | if( window.location.search.match( /(\?|\&)notes/gi ) !== null ) { 111 | openNotes(); 112 | } 113 | 114 | // Open the notes when the 's' key is hit 115 | document.addEventListener( 'keydown', function( event ) { 116 | // Disregard the event if the target is editable or a 117 | // modifier is present 118 | if ( document.querySelector( ':focus' ) !== null || event.shiftKey || event.altKey || event.ctrlKey || event.metaKey ) return; 119 | 120 | // Disregard the event if keyboard is disabled 121 | if ( Reveal.getConfig().keyboard === false ) return; 122 | 123 | if( event.keyCode === 83 ) { 124 | event.preventDefault(); 125 | openNotes(); 126 | } 127 | }, false ); 128 | 129 | // Show our keyboard shortcut in the reveal.js help overlay 130 | if( window.Reveal ) Reveal.registerKeyboardShortcut( 'S', 'Speaker notes view' ); 131 | 132 | } 133 | 134 | return { open: openNotes }; 135 | 136 | })(); 137 | -------------------------------------------------------------------------------- /slides/reveal.js/plugin/markdown/example.html: -------------------------------------------------------------------------------- 1 | 2 | 3 | 4 | 5 | 6 | 7 | reveal.js - Markdown Demo 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 |
18 | 19 |
20 | 21 | 22 |
23 | 24 | 25 |
26 | 36 |
37 | 38 | 39 |
40 | 54 |
55 | 56 | 57 |
58 | 69 |
70 | 71 | 72 |
73 | 77 |
78 | 79 | 80 |
81 | 86 |
87 | 88 | 89 |
90 | 100 |
101 | 102 |
103 |
104 | 105 | 106 | 107 | 108 | 127 | 128 | 129 | 130 | -------------------------------------------------------------------------------- /slides/reveal.js/test/examples/slide-backgrounds.html: -------------------------------------------------------------------------------- 1 | 2 | 3 | 4 | 5 | 6 | 7 | reveal.js - Slide Backgrounds 8 | 9 | 10 | 11 | 12 | 13 | 23 | 24 | 25 | 26 | 27 |
28 | 29 |
30 | 31 |
32 |

data-background: #00ffff

33 |
34 | 35 |
36 |

data-background: #bb00bb

37 |
38 | 39 |
40 |

data-background: lightblue

41 |
42 | 43 |
44 |
45 |

data-background: #ff0000

46 |
47 |
48 |

data-background: rgba(0, 0, 0, 0.2)

49 |
50 |
51 |

data-background: salmon

52 |
53 |
54 | 55 |
56 |
57 |

Background applied to stack

58 |
59 |
60 |

Background applied to stack

61 |
62 |
63 |

Background applied to slide inside of stack

64 |
65 |
66 | 67 |
68 |

Background image

69 |
70 | 71 |
72 |
73 |

Background image

74 |
75 |
76 |

Background image

77 |
78 |
79 | 80 |
81 |

Background image

82 | 
data-background-size="100px" data-background-repeat="repeat" data-background-color="#111"
83 |
84 | 85 |
86 |

Same background twice (1/2)

87 |
88 |
89 |

Same background twice (2/2)

90 |
91 | 92 |
93 |

Video background

94 |
95 | 96 |
97 |

Iframe background

98 |
99 | 100 |
101 |
102 |

Same background twice vertical (1/2)

103 |
104 |
105 |

Same background twice vertical (2/2)

106 |
107 |
108 | 109 |
110 |

Same background from horizontal to vertical (1/3)

111 |
112 |
113 |
114 |

Same background from horizontal to vertical (2/3)

115 |
116 |
117 |

Same background from horizontal to vertical (3/3)

118 |
119 |
120 | 121 |
122 | 123 |
124 | 125 | 126 | 127 | 128 | 142 | 143 | 144 | 145 | -------------------------------------------------------------------------------- /slides/reveal.js/css/print/paper.css: -------------------------------------------------------------------------------- 1 | /* Default Print Stylesheet Template 2 | by Rob Glazebrook of CSSnewbie.com 3 | Last Updated: June 4, 2008 4 | 5 | Feel free (nay, compelled) to edit, append, and 6 | manipulate this file as you see fit. */ 7 | 8 | 9 | @media print { 10 | 11 | /* SECTION 1: Set default width, margin, float, and 12 | background. This prevents elements from extending 13 | beyond the edge of the printed page, and prevents 14 | unnecessary background images from printing */ 15 | html { 16 | background: #fff; 17 | width: auto; 18 | height: auto; 19 | overflow: visible; 20 | } 21 | body { 22 | background: #fff; 23 | font-size: 20pt; 24 | width: auto; 25 | height: auto; 26 | border: 0; 27 | margin: 0 5%; 28 | padding: 0; 29 | overflow: visible; 30 | float: none !important; 31 | } 32 | 33 | /* SECTION 2: Remove any elements not needed in print. 34 | This would include navigation, ads, sidebars, etc. */ 35 | .nestedarrow, 36 | .controls, 37 | .fork-reveal, 38 | .share-reveal, 39 | .state-background, 40 | .reveal .progress, 41 | .reveal .backgrounds { 42 | display: none !important; 43 | } 44 | 45 | /* SECTION 3: Set body font face, size, and color. 46 | Consider using a serif font for readability. */ 47 | body, p, td, li, div { 48 | font-size: 20pt!important; 49 | font-family: Georgia, "Times New Roman", Times, serif !important; 50 | color: #000; 51 | } 52 | 53 | /* SECTION 4: Set heading font face, sizes, and color. 54 | Differentiate your headings from your body text. 55 | Perhaps use a large sans-serif for distinction. */ 56 | h1,h2,h3,h4,h5,h6 { 57 | color: #000!important; 58 | height: auto; 59 | line-height: normal; 60 | font-family: Georgia, "Times New Roman", Times, serif !important; 61 | text-shadow: 0 0 0 #000 !important; 62 | text-align: left; 63 | letter-spacing: normal; 64 | } 65 | /* Need to reduce the size of the fonts for printing */ 66 | h1 { font-size: 28pt !important; } 67 | h2 { font-size: 24pt !important; } 68 | h3 { font-size: 22pt !important; } 69 | h4 { font-size: 22pt !important; font-variant: small-caps; } 70 | h5 { font-size: 21pt !important; } 71 | h6 { font-size: 20pt !important; font-style: italic; } 72 | 73 | /* SECTION 5: Make hyperlinks more usable. 74 | Ensure links are underlined, and consider appending 75 | the URL to the end of the link for usability. */ 76 | a:link, 77 | a:visited { 78 | color: #000 !important; 79 | font-weight: bold; 80 | text-decoration: underline; 81 | } 82 | /* 83 | .reveal a:link:after, 84 | .reveal a:visited:after { 85 | content: " (" attr(href) ") "; 86 | color: #222 !important; 87 | font-size: 90%; 88 | } 89 | */ 90 | 91 | 92 | /* SECTION 6: more reveal.js specific additions by @skypanther */ 93 | ul, ol, div, p { 94 | visibility: visible; 95 | position: static; 96 | width: auto; 97 | height: auto; 98 | display: block; 99 | overflow: visible; 100 | margin: 0; 101 | text-align: left !important; 102 | } 103 | .reveal pre, 104 | .reveal table { 105 | margin-left: 0; 106 | margin-right: 0; 107 | } 108 | .reveal pre code { 109 | padding: 20px; 110 | border: 1px solid #ddd; 111 | } 112 | .reveal blockquote { 113 | margin: 20px 0; 114 | } 115 | .reveal .slides { 116 | position: static !important; 117 | width: auto !important; 118 | height: auto !important; 119 | 120 | left: 0 !important; 121 | top: 0 !important; 122 | margin-left: 0 !important; 123 | margin-top: 0 !important; 124 | padding: 0 !important; 125 | zoom: 1 !important; 126 | 127 | overflow: visible !important; 128 | display: block !important; 129 | 130 | text-align: left !important; 131 | -webkit-perspective: none; 132 | -moz-perspective: none; 133 | -ms-perspective: none; 134 | perspective: none; 135 | 136 | -webkit-perspective-origin: 50% 50%; 137 | -moz-perspective-origin: 50% 50%; 138 | -ms-perspective-origin: 50% 50%; 139 | perspective-origin: 50% 50%; 140 | } 141 | .reveal .slides section { 142 | visibility: visible !important; 143 | position: static !important; 144 | width: auto !important; 145 | height: auto !important; 146 | display: block !important; 147 | overflow: visible !important; 148 | 149 | left: 0 !important; 150 | top: 0 !important; 151 | margin-left: 0 !important; 152 | margin-top: 0 !important; 153 | padding: 60px 20px !important; 154 | z-index: auto !important; 155 | 156 | opacity: 1 !important; 157 | 158 | page-break-after: always !important; 159 | 160 | -webkit-transform-style: flat !important; 161 | -moz-transform-style: flat !important; 162 | -ms-transform-style: flat !important; 163 | transform-style: flat !important; 164 | 165 | -webkit-transform: none !important; 166 | -moz-transform: none !important; 167 | -ms-transform: none !important; 168 | transform: none !important; 169 | 170 | -webkit-transition: none !important; 171 | -moz-transition: none !important; 172 | -ms-transition: none !important; 173 | transition: none !important; 174 | } 175 | .reveal .slides section.stack { 176 | padding: 0 !important; 177 | } 178 | .reveal section:last-of-type { 179 | page-break-after: avoid !important; 180 | } 181 | .reveal section .fragment { 182 | opacity: 1 !important; 183 | visibility: visible !important; 184 | 185 | -webkit-transform: none !important; 186 | -moz-transform: none !important; 187 | -ms-transform: none !important; 188 | transform: none !important; 189 | } 190 | .reveal section img { 191 | display: block; 192 | margin: 15px 0px; 193 | background: rgba(255,255,255,1); 194 | border: 1px solid #666; 195 | box-shadow: none; 196 | } 197 | 198 | .reveal section small { 199 | font-size: 0.8em; 200 | } 201 | 202 | } -------------------------------------------------------------------------------- /slides/reveal.js/test/qunit-1.12.0.css: -------------------------------------------------------------------------------- 1 | /** 2 | * QUnit v1.12.0 - A JavaScript Unit Testing Framework 3 | * 4 | * http://qunitjs.com 5 | * 6 | * Copyright 2012 jQuery Foundation and other contributors 7 | * Released under the MIT license. 8 | * http://jquery.org/license 9 | */ 10 | 11 | /** Font Family and Sizes */ 12 | 13 | #qunit-tests, #qunit-header, #qunit-banner, #qunit-testrunner-toolbar, #qunit-userAgent, #qunit-testresult { 14 | font-family: "Helvetica Neue Light", "HelveticaNeue-Light", "Helvetica Neue", Calibri, Helvetica, Arial, sans-serif; 15 | } 16 | 17 | #qunit-testrunner-toolbar, #qunit-userAgent, #qunit-testresult, #qunit-tests li { font-size: small; } 18 | #qunit-tests { font-size: smaller; } 19 | 20 | 21 | /** Resets */ 22 | 23 | #qunit-tests, #qunit-header, #qunit-banner, #qunit-userAgent, #qunit-testresult, #qunit-modulefilter { 24 | margin: 0; 25 | padding: 0; 26 | } 27 | 28 | 29 | /** Header */ 30 | 31 | #qunit-header { 32 | padding: 0.5em 0 0.5em 1em; 33 | 34 | color: #8699a4; 35 | background-color: #0d3349; 36 | 37 | font-size: 1.5em; 38 | line-height: 1em; 39 | font-weight: normal; 40 | 41 | border-radius: 5px 5px 0 0; 42 | -moz-border-radius: 5px 5px 0 0; 43 | -webkit-border-top-right-radius: 5px; 44 | -webkit-border-top-left-radius: 5px; 45 | } 46 | 47 | #qunit-header a { 48 | text-decoration: none; 49 | color: #c2ccd1; 50 | } 51 | 52 | #qunit-header a:hover, 53 | #qunit-header a:focus { 54 | color: #fff; 55 | } 56 | 57 | #qunit-testrunner-toolbar label { 58 | display: inline-block; 59 | padding: 0 .5em 0 .1em; 60 | } 61 | 62 | #qunit-banner { 63 | height: 5px; 64 | } 65 | 66 | #qunit-testrunner-toolbar { 67 | padding: 0.5em 0 0.5em 2em; 68 | color: #5E740B; 69 | background-color: #eee; 70 | overflow: hidden; 71 | } 72 | 73 | #qunit-userAgent { 74 | padding: 0.5em 0 0.5em 2.5em; 75 | background-color: #2b81af; 76 | color: #fff; 77 | text-shadow: rgba(0, 0, 0, 0.5) 2px 2px 1px; 78 | } 79 | 80 | #qunit-modulefilter-container { 81 | float: right; 82 | } 83 | 84 | /** Tests: Pass/Fail */ 85 | 86 | #qunit-tests { 87 | list-style-position: inside; 88 | } 89 | 90 | #qunit-tests li { 91 | padding: 0.4em 0.5em 0.4em 2.5em; 92 | border-bottom: 1px solid #fff; 93 | list-style-position: inside; 94 | } 95 | 96 | #qunit-tests.hidepass li.pass, #qunit-tests.hidepass li.running { 97 | display: none; 98 | } 99 | 100 | #qunit-tests li strong { 101 | cursor: pointer; 102 | } 103 | 104 | #qunit-tests li a { 105 | padding: 0.5em; 106 | color: #c2ccd1; 107 | text-decoration: none; 108 | } 109 | #qunit-tests li a:hover, 110 | #qunit-tests li a:focus { 111 | color: #000; 112 | } 113 | 114 | #qunit-tests li .runtime { 115 | float: right; 116 | font-size: smaller; 117 | } 118 | 119 | .qunit-assert-list { 120 | margin-top: 0.5em; 121 | padding: 0.5em; 122 | 123 | background-color: #fff; 124 | 125 | border-radius: 5px; 126 | -moz-border-radius: 5px; 127 | -webkit-border-radius: 5px; 128 | } 129 | 130 | .qunit-collapsed { 131 | display: none; 132 | } 133 | 134 | #qunit-tests table { 135 | border-collapse: collapse; 136 | margin-top: .2em; 137 | } 138 | 139 | #qunit-tests th { 140 | text-align: right; 141 | vertical-align: top; 142 | padding: 0 .5em 0 0; 143 | } 144 | 145 | #qunit-tests td { 146 | vertical-align: top; 147 | } 148 | 149 | #qunit-tests pre { 150 | margin: 0; 151 | white-space: pre-wrap; 152 | word-wrap: break-word; 153 | } 154 | 155 | #qunit-tests del { 156 | background-color: #e0f2be; 157 | color: #374e0c; 158 | text-decoration: none; 159 | } 160 | 161 | #qunit-tests ins { 162 | background-color: #ffcaca; 163 | color: #500; 164 | text-decoration: none; 165 | } 166 | 167 | /*** Test Counts */ 168 | 169 | #qunit-tests b.counts { color: black; } 170 | #qunit-tests b.passed { color: #5E740B; } 171 | #qunit-tests b.failed { color: #710909; } 172 | 173 | #qunit-tests li li { 174 | padding: 5px; 175 | background-color: #fff; 176 | border-bottom: none; 177 | list-style-position: inside; 178 | } 179 | 180 | /*** Passing Styles */ 181 | 182 | #qunit-tests li li.pass { 183 | color: #3c510c; 184 | background-color: #fff; 185 | border-left: 10px solid #C6E746; 186 | } 187 | 188 | #qunit-tests .pass { color: #528CE0; background-color: #D2E0E6; } 189 | #qunit-tests .pass .test-name { color: #366097; } 190 | 191 | #qunit-tests .pass .test-actual, 192 | #qunit-tests .pass .test-expected { color: #999999; } 193 | 194 | #qunit-banner.qunit-pass { background-color: #C6E746; } 195 | 196 | /*** Failing Styles */ 197 | 198 | #qunit-tests li li.fail { 199 | color: #710909; 200 | background-color: #fff; 201 | border-left: 10px solid #EE5757; 202 | white-space: pre; 203 | } 204 | 205 | #qunit-tests > li:last-child { 206 | border-radius: 0 0 5px 5px; 207 | -moz-border-radius: 0 0 5px 5px; 208 | -webkit-border-bottom-right-radius: 5px; 209 | -webkit-border-bottom-left-radius: 5px; 210 | } 211 | 212 | #qunit-tests .fail { color: #000000; background-color: #EE5757; } 213 | #qunit-tests .fail .test-name, 214 | #qunit-tests .fail .module-name { color: #000000; } 215 | 216 | #qunit-tests .fail .test-actual { color: #EE5757; } 217 | #qunit-tests .fail .test-expected { color: green; } 218 | 219 | #qunit-banner.qunit-fail { background-color: #EE5757; } 220 | 221 | 222 | /** Result */ 223 | 224 | #qunit-testresult { 225 | padding: 0.5em 0.5em 0.5em 2.5em; 226 | 227 | color: #2b81af; 228 | background-color: #D2E0E6; 229 | 230 | border-bottom: 1px solid white; 231 | } 232 | #qunit-testresult .module-name { 233 | font-weight: bold; 234 | } 235 | 236 | /** Fixture */ 237 | 238 | #qunit-fixture { 239 | position: absolute; 240 | top: -10000px; 241 | left: -10000px; 242 | width: 1000px; 243 | height: 1000px; 244 | } -------------------------------------------------------------------------------- /slides/reveal.js/test/examples/math.html: -------------------------------------------------------------------------------- 1 | 2 | 3 | 4 | 5 | 6 | 7 | reveal.js - Math Plugin 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 |
18 | 19 |
20 | 21 |
22 |

reveal.js Math Plugin

23 |

A thin wrapper for MathJax

24 |
25 | 26 |
27 |

The Lorenz Equations

28 | 29 | \[\begin{aligned} 30 | \dot{x} & = \sigma(y-x) \\ 31 | \dot{y} & = \rho x - y - xz \\ 32 | \dot{z} & = -\beta z + xy 33 | \end{aligned} \] 34 |
35 | 36 |
37 |

The Cauchy-Schwarz Inequality

38 | 39 | 42 |
43 | 44 |
45 |

A Cross Product Formula

46 | 47 | \[\mathbf{V}_1 \times \mathbf{V}_2 = \begin{vmatrix} 48 | \mathbf{i} & \mathbf{j} & \mathbf{k} \\ 49 | \frac{\partial X}{\partial u} & \frac{\partial Y}{\partial u} & 0 \\ 50 | \frac{\partial X}{\partial v} & \frac{\partial Y}{\partial v} & 0 51 | \end{vmatrix} \] 52 |
53 | 54 |
55 |

The probability of getting \(k\) heads when flipping \(n\) coins is

56 | 57 | \[P(E) = {n \choose k} p^k (1-p)^{ n-k} \] 58 |
59 | 60 |
61 |

An Identity of Ramanujan

62 | 63 | \[ \frac{1}{\Bigl(\sqrt{\phi \sqrt{5}}-\phi\Bigr) e^{\frac25 \pi}} = 64 | 1+\frac{e^{-2\pi}} {1+\frac{e^{-4\pi}} {1+\frac{e^{-6\pi}} 65 | {1+\frac{e^{-8\pi}} {1+\ldots} } } } \] 66 |
67 | 68 |
69 |

A Rogers-Ramanujan Identity

70 | 71 | \[ 1 + \frac{q^2}{(1-q)}+\frac{q^6}{(1-q)(1-q^2)}+\cdots = 72 | \prod_{j=0}^{\infty}\frac{1}{(1-q^{5j+2})(1-q^{5j+3})}\] 73 |
74 | 75 |
76 |

Maxwell’s Equations

77 | 78 | \[ \begin{aligned} 79 | \nabla \times \vec{\mathbf{B}} -\, \frac1c\, \frac{\partial\vec{\mathbf{E}}}{\partial t} & = \frac{4\pi}{c}\vec{\mathbf{j}} \\ \nabla \cdot \vec{\mathbf{E}} & = 4 \pi \rho \\ 80 | \nabla \times \vec{\mathbf{E}}\, +\, \frac1c\, \frac{\partial\vec{\mathbf{B}}}{\partial t} & = \vec{\mathbf{0}} \\ 81 | \nabla \cdot \vec{\mathbf{B}} & = 0 \end{aligned} 82 | \] 83 |
84 | 85 |
86 |
87 |

The Lorenz Equations

88 | 89 |
90 | \[\begin{aligned} 91 | \dot{x} & = \sigma(y-x) \\ 92 | \dot{y} & = \rho x - y - xz \\ 93 | \dot{z} & = -\beta z + xy 94 | \end{aligned} \] 95 |
96 |
97 | 98 |
99 |

The Cauchy-Schwarz Inequality

100 | 101 |
102 | \[ \left( \sum_{k=1}^n a_k b_k \right)^2 \leq \left( \sum_{k=1}^n a_k^2 \right) \left( \sum_{k=1}^n b_k^2 \right) \] 103 |
104 |
105 | 106 |
107 |

A Cross Product Formula

108 | 109 |
110 | \[\mathbf{V}_1 \times \mathbf{V}_2 = \begin{vmatrix} 111 | \mathbf{i} & \mathbf{j} & \mathbf{k} \\ 112 | \frac{\partial X}{\partial u} & \frac{\partial Y}{\partial u} & 0 \\ 113 | \frac{\partial X}{\partial v} & \frac{\partial Y}{\partial v} & 0 114 | \end{vmatrix} \] 115 |
116 |
117 | 118 |
119 |

The probability of getting \(k\) heads when flipping \(n\) coins is

120 | 121 |
122 | \[P(E) = {n \choose k} p^k (1-p)^{ n-k} \] 123 |
124 |
125 | 126 |
127 |

An Identity of Ramanujan

128 | 129 |
130 | \[ \frac{1}{\Bigl(\sqrt{\phi \sqrt{5}}-\phi\Bigr) e^{\frac25 \pi}} = 131 | 1+\frac{e^{-2\pi}} {1+\frac{e^{-4\pi}} {1+\frac{e^{-6\pi}} 132 | {1+\frac{e^{-8\pi}} {1+\ldots} } } } \] 133 |
134 |
135 | 136 |
137 |

A Rogers-Ramanujan Identity

138 | 139 |
140 | \[ 1 + \frac{q^2}{(1-q)}+\frac{q^6}{(1-q)(1-q^2)}+\cdots = 141 | \prod_{j=0}^{\infty}\frac{1}{(1-q^{5j+2})(1-q^{5j+3})}\] 142 |
143 |
144 | 145 |
146 |

Maxwell’s Equations

147 | 148 |
149 | \[ \begin{aligned} 150 | \nabla \times \vec{\mathbf{B}} -\, \frac1c\, \frac{\partial\vec{\mathbf{E}}}{\partial t} & = \frac{4\pi}{c}\vec{\mathbf{j}} \\ \nabla \cdot \vec{\mathbf{E}} & = 4 \pi \rho \\ 151 | \nabla \times \vec{\mathbf{E}}\, +\, \frac1c\, \frac{\partial\vec{\mathbf{B}}}{\partial t} & = \vec{\mathbf{0}} \\ 152 | \nabla \cdot \vec{\mathbf{B}} & = 0 \end{aligned} 153 | \] 154 |
155 |
156 |
157 | 158 |
159 | 160 |
161 | 162 | 163 | 164 | 165 | 183 | 184 | 185 | 186 | -------------------------------------------------------------------------------- /slides/reveal.js/css/theme/night.css: -------------------------------------------------------------------------------- 1 | /** 2 | * Black theme for reveal.js. 3 | * 4 | * Copyright (C) 2011-2012 Hakim El Hattab, http://hakim.se 5 | */ 6 | @import url(https://fonts.googleapis.com/css?family=Montserrat:700); 7 | @import url(https://fonts.googleapis.com/css?family=Open+Sans:400,700,400italic,700italic); 8 | /********************************************* 9 | * GLOBAL STYLES 10 | *********************************************/ 11 | body { 12 | background: #111; 13 | background-color: #111; } 14 | 15 | .reveal { 16 | font-family: "Open Sans", sans-serif; 17 | font-size: 30px; 18 | font-weight: normal; 19 | color: #eee; } 20 | 21 | ::selection { 22 | color: #fff; 23 | background: #e7ad52; 24 | text-shadow: none; } 25 | 26 | .reveal .slides > section, 27 | .reveal .slides > section > section { 28 | line-height: 1.3; 29 | font-weight: inherit; } 30 | 31 | /********************************************* 32 | * HEADERS 33 | *********************************************/ 34 | .reveal h1, 35 | .reveal h2, 36 | .reveal h3, 37 | .reveal h4, 38 | .reveal h5, 39 | .reveal h6 { 40 | margin: 0 0 20px 0; 41 | color: #eee; 42 | font-family: "Montserrat", Impact, sans-serif; 43 | font-weight: normal; 44 | line-height: 1.2; 45 | letter-spacing: -0.03em; 46 | text-transform: none; 47 | text-shadow: none; 48 | word-wrap: break-word; } 49 | 50 | .reveal h1 { 51 | font-size: 3.77em; } 52 | 53 | .reveal h2 { 54 | font-size: 2.11em; } 55 | 56 | .reveal h3 { 57 | font-size: 1.55em; } 58 | 59 | .reveal h4 { 60 | font-size: 1em; } 61 | 62 | .reveal h1 { 63 | text-shadow: none; } 64 | 65 | /********************************************* 66 | * OTHER 67 | *********************************************/ 68 | .reveal p { 69 | margin: 20px 0; 70 | line-height: 1.3; } 71 | 72 | /* Ensure certain elements are never larger than the slide itself */ 73 | .reveal img, 74 | .reveal video, 75 | .reveal iframe { 76 | max-width: 95%; 77 | max-height: 95%; } 78 | 79 | .reveal strong, 80 | .reveal b { 81 | font-weight: bold; } 82 | 83 | .reveal em { 84 | font-style: italic; } 85 | 86 | .reveal ol, 87 | .reveal dl, 88 | .reveal ul { 89 | display: inline-block; 90 | text-align: left; 91 | margin: 0 0 0 1em; } 92 | 93 | .reveal ol { 94 | list-style-type: decimal; } 95 | 96 | .reveal ul { 97 | list-style-type: disc; } 98 | 99 | .reveal ul ul { 100 | list-style-type: square; } 101 | 102 | .reveal ul ul ul { 103 | list-style-type: circle; } 104 | 105 | .reveal ul ul, 106 | .reveal ul ol, 107 | .reveal ol ol, 108 | .reveal ol ul { 109 | display: block; 110 | margin-left: 40px; } 111 | 112 | .reveal dt { 113 | font-weight: bold; } 114 | 115 | .reveal dd { 116 | margin-left: 40px; } 117 | 118 | .reveal q, 119 | .reveal blockquote { 120 | quotes: none; } 121 | 122 | .reveal blockquote { 123 | display: block; 124 | position: relative; 125 | width: 70%; 126 | margin: 20px auto; 127 | padding: 5px; 128 | font-style: italic; 129 | background: rgba(255, 255, 255, 0.05); 130 | box-shadow: 0px 0px 2px rgba(0, 0, 0, 0.2); } 131 | 132 | .reveal blockquote p:first-child, 133 | .reveal blockquote p:last-child { 134 | display: inline-block; } 135 | 136 | .reveal q { 137 | font-style: italic; } 138 | 139 | .reveal pre { 140 | display: block; 141 | position: relative; 142 | width: 90%; 143 | margin: 20px auto; 144 | text-align: left; 145 | font-size: 0.55em; 146 | font-family: monospace; 147 | line-height: 1.2em; 148 | word-wrap: break-word; 149 | box-shadow: 0px 0px 6px rgba(0, 0, 0, 0.3); } 150 | 151 | .reveal code { 152 | font-family: monospace; } 153 | 154 | .reveal pre code { 155 | display: block; 156 | padding: 5px; 157 | overflow: auto; 158 | max-height: 400px; 159 | word-wrap: normal; } 160 | 161 | .reveal table { 162 | margin: auto; 163 | border-collapse: collapse; 164 | border-spacing: 0; } 165 | 166 | .reveal table th { 167 | font-weight: bold; } 168 | 169 | .reveal table th, 170 | .reveal table td { 171 | text-align: left; 172 | padding: 0.2em 0.5em 0.2em 0.5em; 173 | border-bottom: 1px solid; } 174 | 175 | .reveal table th[align="center"], 176 | .reveal table td[align="center"] { 177 | text-align: center; } 178 | 179 | .reveal table th[align="right"], 180 | .reveal table td[align="right"] { 181 | text-align: right; } 182 | 183 | .reveal table tbody tr:last-child th, 184 | .reveal table tbody tr:last-child td { 185 | border-bottom: none; } 186 | 187 | .reveal sup { 188 | vertical-align: super; } 189 | 190 | .reveal sub { 191 | vertical-align: sub; } 192 | 193 | .reveal small { 194 | display: inline-block; 195 | font-size: 0.6em; 196 | line-height: 1.2em; 197 | vertical-align: top; } 198 | 199 | .reveal small * { 200 | vertical-align: top; } 201 | 202 | /********************************************* 203 | * LINKS 204 | *********************************************/ 205 | .reveal a { 206 | color: #e7ad52; 207 | text-decoration: none; 208 | -webkit-transition: color .15s ease; 209 | -moz-transition: color .15s ease; 210 | transition: color .15s ease; } 211 | 212 | .reveal a:hover { 213 | color: #f3d7ac; 214 | text-shadow: none; 215 | border: none; } 216 | 217 | .reveal .roll span:after { 218 | color: #fff; 219 | background: #d08a1d; } 220 | 221 | /********************************************* 222 | * IMAGES 223 | *********************************************/ 224 | .reveal section img { 225 | margin: 15px 0px; 226 | background: rgba(255, 255, 255, 0.12); 227 | border: 4px solid #eee; 228 | box-shadow: 0 0 10px rgba(0, 0, 0, 0.15); } 229 | 230 | .reveal section img.plain { 231 | border: 0; 232 | box-shadow: none; } 233 | 234 | .reveal a img { 235 | -webkit-transition: all .15s linear; 236 | -moz-transition: all .15s linear; 237 | transition: all .15s linear; } 238 | 239 | .reveal a:hover img { 240 | background: rgba(255, 255, 255, 0.2); 241 | border-color: #e7ad52; 242 | box-shadow: 0 0 20px rgba(0, 0, 0, 0.55); } 243 | 244 | /********************************************* 245 | * NAVIGATION CONTROLS 246 | *********************************************/ 247 | .reveal .controls .navigate-left, 248 | .reveal .controls .navigate-left.enabled { 249 | border-right-color: #e7ad52; } 250 | 251 | .reveal .controls .navigate-right, 252 | .reveal .controls .navigate-right.enabled { 253 | border-left-color: #e7ad52; } 254 | 255 | .reveal .controls .navigate-up, 256 | .reveal .controls .navigate-up.enabled { 257 | border-bottom-color: #e7ad52; } 258 | 259 | .reveal .controls .navigate-down, 260 | .reveal .controls .navigate-down.enabled { 261 | border-top-color: #e7ad52; } 262 | 263 | .reveal .controls .navigate-left.enabled:hover { 264 | border-right-color: #f3d7ac; } 265 | 266 | .reveal .controls .navigate-right.enabled:hover { 267 | border-left-color: #f3d7ac; } 268 | 269 | .reveal .controls .navigate-up.enabled:hover { 270 | border-bottom-color: #f3d7ac; } 271 | 272 | .reveal .controls .navigate-down.enabled:hover { 273 | border-top-color: #f3d7ac; } 274 | 275 | /********************************************* 276 | * PROGRESS BAR 277 | *********************************************/ 278 | .reveal .progress { 279 | background: rgba(0, 0, 0, 0.2); } 280 | 281 | .reveal .progress span { 282 | background: #e7ad52; 283 | -webkit-transition: width 800ms cubic-bezier(0.26, 0.86, 0.44, 0.985); 284 | -moz-transition: width 800ms cubic-bezier(0.26, 0.86, 0.44, 0.985); 285 | transition: width 800ms cubic-bezier(0.26, 0.86, 0.44, 0.985); } 286 | -------------------------------------------------------------------------------- /slides/reveal.js/css/theme/serif.css: -------------------------------------------------------------------------------- 1 | /** 2 | * A simple theme for reveal.js presentations, similar 3 | * to the default theme. The accent color is brown. 4 | * 5 | * This theme is Copyright (C) 2012-2013 Owen Versteeg, http://owenversteeg.com - it is MIT licensed. 6 | */ 7 | .reveal a { 8 | line-height: 1.3em; } 9 | 10 | /********************************************* 11 | * GLOBAL STYLES 12 | *********************************************/ 13 | body { 14 | background: #F0F1EB; 15 | background-color: #F0F1EB; } 16 | 17 | .reveal { 18 | font-family: "Palatino Linotype", "Book Antiqua", Palatino, FreeSerif, serif; 19 | font-size: 36px; 20 | font-weight: normal; 21 | color: #000; } 22 | 23 | ::selection { 24 | color: #fff; 25 | background: #26351C; 26 | text-shadow: none; } 27 | 28 | .reveal .slides > section, 29 | .reveal .slides > section > section { 30 | line-height: 1.3; 31 | font-weight: inherit; } 32 | 33 | /********************************************* 34 | * HEADERS 35 | *********************************************/ 36 | .reveal h1, 37 | .reveal h2, 38 | .reveal h3, 39 | .reveal h4, 40 | .reveal h5, 41 | .reveal h6 { 42 | margin: 0 0 20px 0; 43 | color: #383D3D; 44 | font-family: "Palatino Linotype", "Book Antiqua", Palatino, FreeSerif, serif; 45 | font-weight: normal; 46 | line-height: 1.2; 47 | letter-spacing: normal; 48 | text-transform: none; 49 | text-shadow: none; 50 | word-wrap: break-word; } 51 | 52 | .reveal h1 { 53 | font-size: 3.77em; } 54 | 55 | .reveal h2 { 56 | font-size: 2.11em; } 57 | 58 | .reveal h3 { 59 | font-size: 1.55em; } 60 | 61 | .reveal h4 { 62 | font-size: 1em; } 63 | 64 | .reveal h1 { 65 | text-shadow: none; } 66 | 67 | /********************************************* 68 | * OTHER 69 | *********************************************/ 70 | .reveal p { 71 | margin: 20px 0; 72 | line-height: 1.3; } 73 | 74 | /* Ensure certain elements are never larger than the slide itself */ 75 | .reveal img, 76 | .reveal video, 77 | .reveal iframe { 78 | max-width: 95%; 79 | max-height: 95%; } 80 | 81 | .reveal strong, 82 | .reveal b { 83 | font-weight: bold; } 84 | 85 | .reveal em { 86 | font-style: italic; } 87 | 88 | .reveal ol, 89 | .reveal dl, 90 | .reveal ul { 91 | display: inline-block; 92 | text-align: left; 93 | margin: 0 0 0 1em; } 94 | 95 | .reveal ol { 96 | list-style-type: decimal; } 97 | 98 | .reveal ul { 99 | list-style-type: disc; } 100 | 101 | .reveal ul ul { 102 | list-style-type: square; } 103 | 104 | .reveal ul ul ul { 105 | list-style-type: circle; } 106 | 107 | .reveal ul ul, 108 | .reveal ul ol, 109 | .reveal ol ol, 110 | .reveal ol ul { 111 | display: block; 112 | margin-left: 40px; } 113 | 114 | .reveal dt { 115 | font-weight: bold; } 116 | 117 | .reveal dd { 118 | margin-left: 40px; } 119 | 120 | .reveal q, 121 | .reveal blockquote { 122 | quotes: none; } 123 | 124 | .reveal blockquote { 125 | display: block; 126 | position: relative; 127 | width: 70%; 128 | margin: 20px auto; 129 | padding: 5px; 130 | font-style: italic; 131 | background: rgba(255, 255, 255, 0.05); 132 | box-shadow: 0px 0px 2px rgba(0, 0, 0, 0.2); } 133 | 134 | .reveal blockquote p:first-child, 135 | .reveal blockquote p:last-child { 136 | display: inline-block; } 137 | 138 | .reveal q { 139 | font-style: italic; } 140 | 141 | .reveal pre { 142 | display: block; 143 | position: relative; 144 | width: 90%; 145 | margin: 20px auto; 146 | text-align: left; 147 | font-size: 0.55em; 148 | font-family: monospace; 149 | line-height: 1.2em; 150 | word-wrap: break-word; 151 | box-shadow: 0px 0px 6px rgba(0, 0, 0, 0.3); } 152 | 153 | .reveal code { 154 | font-family: monospace; } 155 | 156 | .reveal pre code { 157 | display: block; 158 | padding: 5px; 159 | overflow: auto; 160 | max-height: 400px; 161 | word-wrap: normal; } 162 | 163 | .reveal table { 164 | margin: auto; 165 | border-collapse: collapse; 166 | border-spacing: 0; } 167 | 168 | .reveal table th { 169 | font-weight: bold; } 170 | 171 | .reveal table th, 172 | .reveal table td { 173 | text-align: left; 174 | padding: 0.2em 0.5em 0.2em 0.5em; 175 | border-bottom: 1px solid; } 176 | 177 | .reveal table th[align="center"], 178 | .reveal table td[align="center"] { 179 | text-align: center; } 180 | 181 | .reveal table th[align="right"], 182 | .reveal table td[align="right"] { 183 | text-align: right; } 184 | 185 | .reveal table tbody tr:last-child th, 186 | .reveal table tbody tr:last-child td { 187 | border-bottom: none; } 188 | 189 | .reveal sup { 190 | vertical-align: super; } 191 | 192 | .reveal sub { 193 | vertical-align: sub; } 194 | 195 | .reveal small { 196 | display: inline-block; 197 | font-size: 0.6em; 198 | line-height: 1.2em; 199 | vertical-align: top; } 200 | 201 | .reveal small * { 202 | vertical-align: top; } 203 | 204 | /********************************************* 205 | * LINKS 206 | *********************************************/ 207 | .reveal a { 208 | color: #51483D; 209 | text-decoration: none; 210 | -webkit-transition: color .15s ease; 211 | -moz-transition: color .15s ease; 212 | transition: color .15s ease; } 213 | 214 | .reveal a:hover { 215 | color: #8b7c69; 216 | text-shadow: none; 217 | border: none; } 218 | 219 | .reveal .roll span:after { 220 | color: #fff; 221 | background: #25211c; } 222 | 223 | /********************************************* 224 | * IMAGES 225 | *********************************************/ 226 | .reveal section img { 227 | margin: 15px 0px; 228 | background: rgba(255, 255, 255, 0.12); 229 | border: 4px solid #000; 230 | box-shadow: 0 0 10px rgba(0, 0, 0, 0.15); } 231 | 232 | .reveal section img.plain { 233 | border: 0; 234 | box-shadow: none; } 235 | 236 | .reveal a img { 237 | -webkit-transition: all .15s linear; 238 | -moz-transition: all .15s linear; 239 | transition: all .15s linear; } 240 | 241 | .reveal a:hover img { 242 | background: rgba(255, 255, 255, 0.2); 243 | border-color: #51483D; 244 | box-shadow: 0 0 20px rgba(0, 0, 0, 0.55); } 245 | 246 | /********************************************* 247 | * NAVIGATION CONTROLS 248 | *********************************************/ 249 | .reveal .controls .navigate-left, 250 | .reveal .controls .navigate-left.enabled { 251 | border-right-color: #51483D; } 252 | 253 | .reveal .controls .navigate-right, 254 | .reveal .controls .navigate-right.enabled { 255 | border-left-color: #51483D; } 256 | 257 | .reveal .controls .navigate-up, 258 | .reveal .controls .navigate-up.enabled { 259 | border-bottom-color: #51483D; } 260 | 261 | .reveal .controls .navigate-down, 262 | .reveal .controls .navigate-down.enabled { 263 | border-top-color: #51483D; } 264 | 265 | .reveal .controls .navigate-left.enabled:hover { 266 | border-right-color: #8b7c69; } 267 | 268 | .reveal .controls .navigate-right.enabled:hover { 269 | border-left-color: #8b7c69; } 270 | 271 | .reveal .controls .navigate-up.enabled:hover { 272 | border-bottom-color: #8b7c69; } 273 | 274 | .reveal .controls .navigate-down.enabled:hover { 275 | border-top-color: #8b7c69; } 276 | 277 | /********************************************* 278 | * PROGRESS BAR 279 | *********************************************/ 280 | .reveal .progress { 281 | background: rgba(0, 0, 0, 0.2); } 282 | 283 | .reveal .progress span { 284 | background: #51483D; 285 | -webkit-transition: width 800ms cubic-bezier(0.26, 0.86, 0.44, 0.985); 286 | -moz-transition: width 800ms cubic-bezier(0.26, 0.86, 0.44, 0.985); 287 | transition: width 800ms cubic-bezier(0.26, 0.86, 0.44, 0.985); } 288 | -------------------------------------------------------------------------------- /slides/reveal.js/css/theme/moon.css: -------------------------------------------------------------------------------- 1 | /** 2 | * Solarized Dark theme for reveal.js. 3 | * Author: Achim Staebler 4 | */ 5 | @import url(../../lib/font/league-gothic/league-gothic.css); 6 | @import url(https://fonts.googleapis.com/css?family=Lato:400,700,400italic,700italic); 7 | /** 8 | * Solarized colors by Ethan Schoonover 9 | */ 10 | html * { 11 | color-profile: sRGB; 12 | rendering-intent: auto; } 13 | 14 | /********************************************* 15 | * GLOBAL STYLES 16 | *********************************************/ 17 | body { 18 | background: #002b36; 19 | background-color: #002b36; } 20 | 21 | .reveal { 22 | font-family: "Lato", sans-serif; 23 | font-size: 36px; 24 | font-weight: normal; 25 | color: #93a1a1; } 26 | 27 | ::selection { 28 | color: #fff; 29 | background: #d33682; 30 | text-shadow: none; } 31 | 32 | .reveal .slides > section, 33 | .reveal .slides > section > section { 34 | line-height: 1.3; 35 | font-weight: inherit; } 36 | 37 | /********************************************* 38 | * HEADERS 39 | *********************************************/ 40 | .reveal h1, 41 | .reveal h2, 42 | .reveal h3, 43 | .reveal h4, 44 | .reveal h5, 45 | .reveal h6 { 46 | margin: 0 0 20px 0; 47 | color: #eee8d5; 48 | font-family: "League Gothic", Impact, sans-serif; 49 | font-weight: normal; 50 | line-height: 1.2; 51 | letter-spacing: normal; 52 | text-transform: uppercase; 53 | text-shadow: none; 54 | word-wrap: break-word; } 55 | 56 | .reveal h1 { 57 | font-size: 3.77em; } 58 | 59 | .reveal h2 { 60 | font-size: 2.11em; } 61 | 62 | .reveal h3 { 63 | font-size: 1.55em; } 64 | 65 | .reveal h4 { 66 | font-size: 1em; } 67 | 68 | .reveal h1 { 69 | text-shadow: none; } 70 | 71 | /********************************************* 72 | * OTHER 73 | *********************************************/ 74 | .reveal p { 75 | margin: 20px 0; 76 | line-height: 1.3; } 77 | 78 | /* Ensure certain elements are never larger than the slide itself */ 79 | .reveal img, 80 | .reveal video, 81 | .reveal iframe { 82 | max-width: 95%; 83 | max-height: 95%; } 84 | 85 | .reveal strong, 86 | .reveal b { 87 | font-weight: bold; } 88 | 89 | .reveal em { 90 | font-style: italic; } 91 | 92 | .reveal ol, 93 | .reveal dl, 94 | .reveal ul { 95 | display: inline-block; 96 | text-align: left; 97 | margin: 0 0 0 1em; } 98 | 99 | .reveal ol { 100 | list-style-type: decimal; } 101 | 102 | .reveal ul { 103 | list-style-type: disc; } 104 | 105 | .reveal ul ul { 106 | list-style-type: square; } 107 | 108 | .reveal ul ul ul { 109 | list-style-type: circle; } 110 | 111 | .reveal ul ul, 112 | .reveal ul ol, 113 | .reveal ol ol, 114 | .reveal ol ul { 115 | display: block; 116 | margin-left: 40px; } 117 | 118 | .reveal dt { 119 | font-weight: bold; } 120 | 121 | .reveal dd { 122 | margin-left: 40px; } 123 | 124 | .reveal q, 125 | .reveal blockquote { 126 | quotes: none; } 127 | 128 | .reveal blockquote { 129 | display: block; 130 | position: relative; 131 | width: 70%; 132 | margin: 20px auto; 133 | padding: 5px; 134 | font-style: italic; 135 | background: rgba(255, 255, 255, 0.05); 136 | box-shadow: 0px 0px 2px rgba(0, 0, 0, 0.2); } 137 | 138 | .reveal blockquote p:first-child, 139 | .reveal blockquote p:last-child { 140 | display: inline-block; } 141 | 142 | .reveal q { 143 | font-style: italic; } 144 | 145 | .reveal pre { 146 | display: block; 147 | position: relative; 148 | width: 90%; 149 | margin: 20px auto; 150 | text-align: left; 151 | font-size: 0.55em; 152 | font-family: monospace; 153 | line-height: 1.2em; 154 | word-wrap: break-word; 155 | box-shadow: 0px 0px 6px rgba(0, 0, 0, 0.3); } 156 | 157 | .reveal code { 158 | font-family: monospace; } 159 | 160 | .reveal pre code { 161 | display: block; 162 | padding: 5px; 163 | overflow: auto; 164 | max-height: 400px; 165 | word-wrap: normal; } 166 | 167 | .reveal table { 168 | margin: auto; 169 | border-collapse: collapse; 170 | border-spacing: 0; } 171 | 172 | .reveal table th { 173 | font-weight: bold; } 174 | 175 | .reveal table th, 176 | .reveal table td { 177 | text-align: left; 178 | padding: 0.2em 0.5em 0.2em 0.5em; 179 | border-bottom: 1px solid; } 180 | 181 | .reveal table th[align="center"], 182 | .reveal table td[align="center"] { 183 | text-align: center; } 184 | 185 | .reveal table th[align="right"], 186 | .reveal table td[align="right"] { 187 | text-align: right; } 188 | 189 | .reveal table tbody tr:last-child th, 190 | .reveal table tbody tr:last-child td { 191 | border-bottom: none; } 192 | 193 | .reveal sup { 194 | vertical-align: super; } 195 | 196 | .reveal sub { 197 | vertical-align: sub; } 198 | 199 | .reveal small { 200 | display: inline-block; 201 | font-size: 0.6em; 202 | line-height: 1.2em; 203 | vertical-align: top; } 204 | 205 | .reveal small * { 206 | vertical-align: top; } 207 | 208 | /********************************************* 209 | * LINKS 210 | *********************************************/ 211 | .reveal a { 212 | color: #268bd2; 213 | text-decoration: none; 214 | -webkit-transition: color .15s ease; 215 | -moz-transition: color .15s ease; 216 | transition: color .15s ease; } 217 | 218 | .reveal a:hover { 219 | color: #78b9e6; 220 | text-shadow: none; 221 | border: none; } 222 | 223 | .reveal .roll span:after { 224 | color: #fff; 225 | background: #1a6091; } 226 | 227 | /********************************************* 228 | * IMAGES 229 | *********************************************/ 230 | .reveal section img { 231 | margin: 15px 0px; 232 | background: rgba(255, 255, 255, 0.12); 233 | border: 4px solid #93a1a1; 234 | box-shadow: 0 0 10px rgba(0, 0, 0, 0.15); } 235 | 236 | .reveal section img.plain { 237 | border: 0; 238 | box-shadow: none; } 239 | 240 | .reveal a img { 241 | -webkit-transition: all .15s linear; 242 | -moz-transition: all .15s linear; 243 | transition: all .15s linear; } 244 | 245 | .reveal a:hover img { 246 | background: rgba(255, 255, 255, 0.2); 247 | border-color: #268bd2; 248 | box-shadow: 0 0 20px rgba(0, 0, 0, 0.55); } 249 | 250 | /********************************************* 251 | * NAVIGATION CONTROLS 252 | *********************************************/ 253 | .reveal .controls .navigate-left, 254 | .reveal .controls .navigate-left.enabled { 255 | border-right-color: #268bd2; } 256 | 257 | .reveal .controls .navigate-right, 258 | .reveal .controls .navigate-right.enabled { 259 | border-left-color: #268bd2; } 260 | 261 | .reveal .controls .navigate-up, 262 | .reveal .controls .navigate-up.enabled { 263 | border-bottom-color: #268bd2; } 264 | 265 | .reveal .controls .navigate-down, 266 | .reveal .controls .navigate-down.enabled { 267 | border-top-color: #268bd2; } 268 | 269 | .reveal .controls .navigate-left.enabled:hover { 270 | border-right-color: #78b9e6; } 271 | 272 | .reveal .controls .navigate-right.enabled:hover { 273 | border-left-color: #78b9e6; } 274 | 275 | .reveal .controls .navigate-up.enabled:hover { 276 | border-bottom-color: #78b9e6; } 277 | 278 | .reveal .controls .navigate-down.enabled:hover { 279 | border-top-color: #78b9e6; } 280 | 281 | /********************************************* 282 | * PROGRESS BAR 283 | *********************************************/ 284 | .reveal .progress { 285 | background: rgba(0, 0, 0, 0.2); } 286 | 287 | .reveal .progress span { 288 | background: #268bd2; 289 | -webkit-transition: width 800ms cubic-bezier(0.26, 0.86, 0.44, 0.985); 290 | -moz-transition: width 800ms cubic-bezier(0.26, 0.86, 0.44, 0.985); 291 | transition: width 800ms cubic-bezier(0.26, 0.86, 0.44, 0.985); } 292 | -------------------------------------------------------------------------------- /slides/reveal.js/css/theme/solarized.css: -------------------------------------------------------------------------------- 1 | /** 2 | * Solarized Light theme for reveal.js. 3 | * Author: Achim Staebler 4 | */ 5 | @import url(../../lib/font/league-gothic/league-gothic.css); 6 | @import url(https://fonts.googleapis.com/css?family=Lato:400,700,400italic,700italic); 7 | /** 8 | * Solarized colors by Ethan Schoonover 9 | */ 10 | html * { 11 | color-profile: sRGB; 12 | rendering-intent: auto; } 13 | 14 | /********************************************* 15 | * GLOBAL STYLES 16 | *********************************************/ 17 | body { 18 | background: #fdf6e3; 19 | background-color: #fdf6e3; } 20 | 21 | .reveal { 22 | font-family: "Lato", sans-serif; 23 | font-size: 36px; 24 | font-weight: normal; 25 | color: #657b83; } 26 | 27 | ::selection { 28 | color: #fff; 29 | background: #d33682; 30 | text-shadow: none; } 31 | 32 | .reveal .slides > section, 33 | .reveal .slides > section > section { 34 | line-height: 1.3; 35 | font-weight: inherit; } 36 | 37 | /********************************************* 38 | * HEADERS 39 | *********************************************/ 40 | .reveal h1, 41 | .reveal h2, 42 | .reveal h3, 43 | .reveal h4, 44 | .reveal h5, 45 | .reveal h6 { 46 | margin: 0 0 20px 0; 47 | color: #586e75; 48 | font-family: "League Gothic", Impact, sans-serif; 49 | font-weight: normal; 50 | line-height: 1.2; 51 | letter-spacing: normal; 52 | text-transform: uppercase; 53 | text-shadow: none; 54 | word-wrap: break-word; } 55 | 56 | .reveal h1 { 57 | font-size: 3.77em; } 58 | 59 | .reveal h2 { 60 | font-size: 2.11em; } 61 | 62 | .reveal h3 { 63 | font-size: 1.55em; } 64 | 65 | .reveal h4 { 66 | font-size: 1em; } 67 | 68 | .reveal h1 { 69 | text-shadow: none; } 70 | 71 | /********************************************* 72 | * OTHER 73 | *********************************************/ 74 | .reveal p { 75 | margin: 20px 0; 76 | line-height: 1.3; } 77 | 78 | /* Ensure certain elements are never larger than the slide itself */ 79 | .reveal img, 80 | .reveal video, 81 | .reveal iframe { 82 | max-width: 95%; 83 | max-height: 95%; } 84 | 85 | .reveal strong, 86 | .reveal b { 87 | font-weight: bold; } 88 | 89 | .reveal em { 90 | font-style: italic; } 91 | 92 | .reveal ol, 93 | .reveal dl, 94 | .reveal ul { 95 | display: inline-block; 96 | text-align: left; 97 | margin: 0 0 0 1em; } 98 | 99 | .reveal ol { 100 | list-style-type: decimal; } 101 | 102 | .reveal ul { 103 | list-style-type: disc; } 104 | 105 | .reveal ul ul { 106 | list-style-type: square; } 107 | 108 | .reveal ul ul ul { 109 | list-style-type: circle; } 110 | 111 | .reveal ul ul, 112 | .reveal ul ol, 113 | .reveal ol ol, 114 | .reveal ol ul { 115 | display: block; 116 | margin-left: 40px; } 117 | 118 | .reveal dt { 119 | font-weight: bold; } 120 | 121 | .reveal dd { 122 | margin-left: 40px; } 123 | 124 | .reveal q, 125 | .reveal blockquote { 126 | quotes: none; } 127 | 128 | .reveal blockquote { 129 | display: block; 130 | position: relative; 131 | width: 70%; 132 | margin: 20px auto; 133 | padding: 5px; 134 | font-style: italic; 135 | background: rgba(255, 255, 255, 0.05); 136 | box-shadow: 0px 0px 2px rgba(0, 0, 0, 0.2); } 137 | 138 | .reveal blockquote p:first-child, 139 | .reveal blockquote p:last-child { 140 | display: inline-block; } 141 | 142 | .reveal q { 143 | font-style: italic; } 144 | 145 | .reveal pre { 146 | display: block; 147 | position: relative; 148 | width: 90%; 149 | margin: 20px auto; 150 | text-align: left; 151 | font-size: 0.55em; 152 | font-family: monospace; 153 | line-height: 1.2em; 154 | word-wrap: break-word; 155 | box-shadow: 0px 0px 6px rgba(0, 0, 0, 0.3); } 156 | 157 | .reveal code { 158 | font-family: monospace; } 159 | 160 | .reveal pre code { 161 | display: block; 162 | padding: 5px; 163 | overflow: auto; 164 | max-height: 400px; 165 | word-wrap: normal; } 166 | 167 | .reveal table { 168 | margin: auto; 169 | border-collapse: collapse; 170 | border-spacing: 0; } 171 | 172 | .reveal table th { 173 | font-weight: bold; } 174 | 175 | .reveal table th, 176 | .reveal table td { 177 | text-align: left; 178 | padding: 0.2em 0.5em 0.2em 0.5em; 179 | border-bottom: 1px solid; } 180 | 181 | .reveal table th[align="center"], 182 | .reveal table td[align="center"] { 183 | text-align: center; } 184 | 185 | .reveal table th[align="right"], 186 | .reveal table td[align="right"] { 187 | text-align: right; } 188 | 189 | .reveal table tbody tr:last-child th, 190 | .reveal table tbody tr:last-child td { 191 | border-bottom: none; } 192 | 193 | .reveal sup { 194 | vertical-align: super; } 195 | 196 | .reveal sub { 197 | vertical-align: sub; } 198 | 199 | .reveal small { 200 | display: inline-block; 201 | font-size: 0.6em; 202 | line-height: 1.2em; 203 | vertical-align: top; } 204 | 205 | .reveal small * { 206 | vertical-align: top; } 207 | 208 | /********************************************* 209 | * LINKS 210 | *********************************************/ 211 | .reveal a { 212 | color: #268bd2; 213 | text-decoration: none; 214 | -webkit-transition: color .15s ease; 215 | -moz-transition: color .15s ease; 216 | transition: color .15s ease; } 217 | 218 | .reveal a:hover { 219 | color: #78b9e6; 220 | text-shadow: none; 221 | border: none; } 222 | 223 | .reveal .roll span:after { 224 | color: #fff; 225 | background: #1a6091; } 226 | 227 | /********************************************* 228 | * IMAGES 229 | *********************************************/ 230 | .reveal section img { 231 | margin: 15px 0px; 232 | background: rgba(255, 255, 255, 0.12); 233 | border: 4px solid #657b83; 234 | box-shadow: 0 0 10px rgba(0, 0, 0, 0.15); } 235 | 236 | .reveal section img.plain { 237 | border: 0; 238 | box-shadow: none; } 239 | 240 | .reveal a img { 241 | -webkit-transition: all .15s linear; 242 | -moz-transition: all .15s linear; 243 | transition: all .15s linear; } 244 | 245 | .reveal a:hover img { 246 | background: rgba(255, 255, 255, 0.2); 247 | border-color: #268bd2; 248 | box-shadow: 0 0 20px rgba(0, 0, 0, 0.55); } 249 | 250 | /********************************************* 251 | * NAVIGATION CONTROLS 252 | *********************************************/ 253 | .reveal .controls .navigate-left, 254 | .reveal .controls .navigate-left.enabled { 255 | border-right-color: #268bd2; } 256 | 257 | .reveal .controls .navigate-right, 258 | .reveal .controls .navigate-right.enabled { 259 | border-left-color: #268bd2; } 260 | 261 | .reveal .controls .navigate-up, 262 | .reveal .controls .navigate-up.enabled { 263 | border-bottom-color: #268bd2; } 264 | 265 | .reveal .controls .navigate-down, 266 | .reveal .controls .navigate-down.enabled { 267 | border-top-color: #268bd2; } 268 | 269 | .reveal .controls .navigate-left.enabled:hover { 270 | border-right-color: #78b9e6; } 271 | 272 | .reveal .controls .navigate-right.enabled:hover { 273 | border-left-color: #78b9e6; } 274 | 275 | .reveal .controls .navigate-up.enabled:hover { 276 | border-bottom-color: #78b9e6; } 277 | 278 | .reveal .controls .navigate-down.enabled:hover { 279 | border-top-color: #78b9e6; } 280 | 281 | /********************************************* 282 | * PROGRESS BAR 283 | *********************************************/ 284 | .reveal .progress { 285 | background: rgba(0, 0, 0, 0.2); } 286 | 287 | .reveal .progress span { 288 | background: #268bd2; 289 | -webkit-transition: width 800ms cubic-bezier(0.26, 0.86, 0.44, 0.985); 290 | -moz-transition: width 800ms cubic-bezier(0.26, 0.86, 0.44, 0.985); 291 | transition: width 800ms cubic-bezier(0.26, 0.86, 0.44, 0.985); } 292 | -------------------------------------------------------------------------------- /slides/reveal.js/css/theme/white.css: -------------------------------------------------------------------------------- 1 | /** 2 | * White theme for reveal.js. This is the opposite of the 'black' theme. 3 | * 4 | * By Hakim El Hattab, http://hakim.se 5 | */ 6 | @import url(../../lib/font/source-sans-pro/source-sans-pro.css); 7 | section.has-dark-background, section.has-dark-background h1, section.has-dark-background h2, section.has-dark-background h3, section.has-dark-background h4, section.has-dark-background h5, section.has-dark-background h6 { 8 | color: #fff; } 9 | 10 | /********************************************* 11 | * GLOBAL STYLES 12 | *********************************************/ 13 | body { 14 | background: #fff; 15 | background-color: #fff; } 16 | 17 | .reveal { 18 | font-family: "Source Sans Pro", Helvetica, sans-serif; 19 | font-size: 38px; 20 | font-weight: normal; 21 | color: #222; } 22 | 23 | ::selection { 24 | color: #fff; 25 | background: #98bdef; 26 | text-shadow: none; } 27 | 28 | .reveal .slides > section, 29 | .reveal .slides > section > section { 30 | line-height: 1.3; 31 | font-weight: inherit; } 32 | 33 | /********************************************* 34 | * HEADERS 35 | *********************************************/ 36 | .reveal h1, 37 | .reveal h2, 38 | .reveal h3, 39 | .reveal h4, 40 | .reveal h5, 41 | .reveal h6 { 42 | margin: 0 0 20px 0; 43 | color: #222; 44 | font-family: "Source Sans Pro", Helvetica, sans-serif; 45 | font-weight: 600; 46 | line-height: 1.2; 47 | letter-spacing: normal; 48 | text-transform: uppercase; 49 | text-shadow: none; 50 | word-wrap: break-word; } 51 | 52 | .reveal h1 { 53 | font-size: 2.5em; } 54 | 55 | .reveal h2 { 56 | font-size: 1.6em; } 57 | 58 | .reveal h3 { 59 | font-size: 1.3em; } 60 | 61 | .reveal h4 { 62 | font-size: 1em; } 63 | 64 | .reveal h1 { 65 | text-shadow: none; } 66 | 67 | /********************************************* 68 | * OTHER 69 | *********************************************/ 70 | .reveal p { 71 | margin: 20px 0; 72 | line-height: 1.3; } 73 | 74 | /* Ensure certain elements are never larger than the slide itself */ 75 | .reveal img, 76 | .reveal video, 77 | .reveal iframe { 78 | max-width: 95%; 79 | max-height: 95%; } 80 | 81 | .reveal strong, 82 | .reveal b { 83 | font-weight: bold; } 84 | 85 | .reveal em { 86 | font-style: italic; } 87 | 88 | .reveal ol, 89 | .reveal dl, 90 | .reveal ul { 91 | display: inline-block; 92 | text-align: left; 93 | margin: 0 0 0 1em; } 94 | 95 | .reveal ol { 96 | list-style-type: decimal; } 97 | 98 | .reveal ul { 99 | list-style-type: disc; } 100 | 101 | .reveal ul ul { 102 | list-style-type: square; } 103 | 104 | .reveal ul ul ul { 105 | list-style-type: circle; } 106 | 107 | .reveal ul ul, 108 | .reveal ul ol, 109 | .reveal ol ol, 110 | .reveal ol ul { 111 | display: block; 112 | margin-left: 40px; } 113 | 114 | .reveal dt { 115 | font-weight: bold; } 116 | 117 | .reveal dd { 118 | margin-left: 40px; } 119 | 120 | .reveal q, 121 | .reveal blockquote { 122 | quotes: none; } 123 | 124 | .reveal blockquote { 125 | display: block; 126 | position: relative; 127 | width: 70%; 128 | margin: 20px auto; 129 | padding: 5px; 130 | font-style: italic; 131 | background: rgba(255, 255, 255, 0.05); 132 | box-shadow: 0px 0px 2px rgba(0, 0, 0, 0.2); } 133 | 134 | .reveal blockquote p:first-child, 135 | .reveal blockquote p:last-child { 136 | display: inline-block; } 137 | 138 | .reveal q { 139 | font-style: italic; } 140 | 141 | .reveal pre { 142 | display: block; 143 | position: relative; 144 | width: 90%; 145 | margin: 20px auto; 146 | text-align: left; 147 | font-size: 0.55em; 148 | font-family: monospace; 149 | line-height: 1.2em; 150 | word-wrap: break-word; 151 | box-shadow: 0px 0px 6px rgba(0, 0, 0, 0.3); } 152 | 153 | .reveal code { 154 | font-family: monospace; } 155 | 156 | .reveal pre code { 157 | display: block; 158 | padding: 5px; 159 | overflow: auto; 160 | max-height: 400px; 161 | word-wrap: normal; } 162 | 163 | .reveal table { 164 | margin: auto; 165 | border-collapse: collapse; 166 | border-spacing: 0; } 167 | 168 | .reveal table th { 169 | font-weight: bold; } 170 | 171 | .reveal table th, 172 | .reveal table td { 173 | text-align: left; 174 | padding: 0.2em 0.5em 0.2em 0.5em; 175 | border-bottom: 1px solid; } 176 | 177 | .reveal table th[align="center"], 178 | .reveal table td[align="center"] { 179 | text-align: center; } 180 | 181 | .reveal table th[align="right"], 182 | .reveal table td[align="right"] { 183 | text-align: right; } 184 | 185 | .reveal table tbody tr:last-child th, 186 | .reveal table tbody tr:last-child td { 187 | border-bottom: none; } 188 | 189 | .reveal sup { 190 | vertical-align: super; } 191 | 192 | .reveal sub { 193 | vertical-align: sub; } 194 | 195 | .reveal small { 196 | display: inline-block; 197 | font-size: 0.6em; 198 | line-height: 1.2em; 199 | vertical-align: top; } 200 | 201 | .reveal small * { 202 | vertical-align: top; } 203 | 204 | /********************************************* 205 | * LINKS 206 | *********************************************/ 207 | .reveal a { 208 | color: #2a76dd; 209 | text-decoration: none; 210 | -webkit-transition: color .15s ease; 211 | -moz-transition: color .15s ease; 212 | transition: color .15s ease; } 213 | 214 | .reveal a:hover { 215 | color: #6ca0e8; 216 | text-shadow: none; 217 | border: none; } 218 | 219 | .reveal .roll span:after { 220 | color: #fff; 221 | background: #1a53a1; } 222 | 223 | /********************************************* 224 | * IMAGES 225 | *********************************************/ 226 | .reveal section img { 227 | margin: 15px 0px; 228 | background: rgba(255, 255, 255, 0.12); 229 | border: 4px solid #222; 230 | box-shadow: 0 0 10px rgba(0, 0, 0, 0.15); } 231 | 232 | .reveal section img.plain { 233 | border: 0; 234 | box-shadow: none; } 235 | 236 | .reveal a img { 237 | -webkit-transition: all .15s linear; 238 | -moz-transition: all .15s linear; 239 | transition: all .15s linear; } 240 | 241 | .reveal a:hover img { 242 | background: rgba(255, 255, 255, 0.2); 243 | border-color: #2a76dd; 244 | box-shadow: 0 0 20px rgba(0, 0, 0, 0.55); } 245 | 246 | /********************************************* 247 | * NAVIGATION CONTROLS 248 | *********************************************/ 249 | .reveal .controls .navigate-left, 250 | .reveal .controls .navigate-left.enabled { 251 | border-right-color: #2a76dd; } 252 | 253 | .reveal .controls .navigate-right, 254 | .reveal .controls .navigate-right.enabled { 255 | border-left-color: #2a76dd; } 256 | 257 | .reveal .controls .navigate-up, 258 | .reveal .controls .navigate-up.enabled { 259 | border-bottom-color: #2a76dd; } 260 | 261 | .reveal .controls .navigate-down, 262 | .reveal .controls .navigate-down.enabled { 263 | border-top-color: #2a76dd; } 264 | 265 | .reveal .controls .navigate-left.enabled:hover { 266 | border-right-color: #6ca0e8; } 267 | 268 | .reveal .controls .navigate-right.enabled:hover { 269 | border-left-color: #6ca0e8; } 270 | 271 | .reveal .controls .navigate-up.enabled:hover { 272 | border-bottom-color: #6ca0e8; } 273 | 274 | .reveal .controls .navigate-down.enabled:hover { 275 | border-top-color: #6ca0e8; } 276 | 277 | /********************************************* 278 | * PROGRESS BAR 279 | *********************************************/ 280 | .reveal .progress { 281 | background: rgba(0, 0, 0, 0.2); } 282 | 283 | .reveal .progress span { 284 | background: #2a76dd; 285 | -webkit-transition: width 800ms cubic-bezier(0.26, 0.86, 0.44, 0.985); 286 | -moz-transition: width 800ms cubic-bezier(0.26, 0.86, 0.44, 0.985); 287 | transition: width 800ms cubic-bezier(0.26, 0.86, 0.44, 0.985); } 288 | -------------------------------------------------------------------------------- /slides/reveal.js/css/theme/black.css: -------------------------------------------------------------------------------- 1 | /** 2 | * Black theme for reveal.js. This is the opposite of the 'white' theme. 3 | * 4 | * By Hakim El Hattab, http://hakim.se 5 | */ 6 | @import url(../../lib/font/source-sans-pro/source-sans-pro.css); 7 | section.has-light-background, section.has-light-background h1, section.has-light-background h2, section.has-light-background h3, section.has-light-background h4, section.has-light-background h5, section.has-light-background h6 { 8 | color: #222; } 9 | 10 | /********************************************* 11 | * GLOBAL STYLES 12 | *********************************************/ 13 | body { 14 | background: #222; 15 | background-color: #222; } 16 | 17 | .reveal { 18 | font-family: "Source Sans Pro", Helvetica, sans-serif; 19 | font-size: 55px; 20 | font-weight: normal; 21 | color: #fff; } 22 | 23 | ::selection { 24 | color: #fff; 25 | background: #bee4fd; 26 | text-shadow: none; } 27 | 28 | .reveal .slides > section, 29 | .reveal .slides > section > section { 30 | line-height: 1.3; 31 | font-weight: inherit; } 32 | 33 | /********************************************* 34 | * HEADERS 35 | *********************************************/ 36 | .reveal h1, 37 | .reveal h2, 38 | .reveal h3, 39 | .reveal h4, 40 | .reveal h5, 41 | .reveal h6 { 42 | margin: 0 0 20px 0; 43 | color: #fff; 44 | font-family: "Source Sans Pro", Helvetica, sans-serif; 45 | font-weight: 600; 46 | line-height: 1.2; 47 | letter-spacing: normal; 48 | text-transform: uppercase; 49 | text-shadow: none; 50 | word-wrap: break-word; } 51 | 52 | .reveal h1 { 53 | font-size: 2.5em; } 54 | 55 | .reveal h2 { 56 | font-size: 1.6em; } 57 | 58 | .reveal h3 { 59 | font-size: 1.3em; } 60 | 61 | .reveal h4 { 62 | font-size: 1em; } 63 | 64 | .reveal h1 { 65 | text-shadow: none; } 66 | 67 | /********************************************* 68 | * OTHER 69 | *********************************************/ 70 | .reveal p { 71 | margin: 20px 0; 72 | line-height: 1.3; } 73 | 74 | /* Ensure certain elements are never larger than the slide itself */ 75 | .reveal img, 76 | .reveal video, 77 | .reveal iframe { 78 | max-width: 95%; 79 | max-height: 95%; } 80 | 81 | .reveal strong, 82 | .reveal b { 83 | font-weight: bold; } 84 | 85 | .reveal em { 86 | font-style: italic; } 87 | 88 | .reveal ol, 89 | .reveal dl, 90 | .reveal ul { 91 | display: inline-block; 92 | text-align: left; 93 | margin: 0 0 0 1em; } 94 | 95 | .reveal ol { 96 | list-style-type: decimal; } 97 | 98 | .reveal ul { 99 | list-style-type: disc; } 100 | 101 | .reveal ul ul { 102 | list-style-type: square; } 103 | 104 | .reveal ul ul ul { 105 | list-style-type: circle; } 106 | 107 | .reveal ul ul, 108 | .reveal ul ol, 109 | .reveal ol ol, 110 | .reveal ol ul { 111 | display: block; 112 | margin-left: 40px; } 113 | 114 | .reveal dt { 115 | font-weight: bold; } 116 | 117 | .reveal dd { 118 | margin-left: 40px; } 119 | 120 | .reveal q, 121 | .reveal blockquote { 122 | quotes: none; } 123 | 124 | .reveal blockquote { 125 | display: block; 126 | position: relative; 127 | width: 70%; 128 | margin: 20px auto; 129 | padding: 5px; 130 | font-style: italic; 131 | background: rgba(255, 255, 255, 0.05); 132 | box-shadow: 0px 0px 2px rgba(0, 0, 0, 0.2); } 133 | 134 | .reveal blockquote p:first-child, 135 | .reveal blockquote p:last-child { 136 | display: inline-block; } 137 | 138 | .reveal q { 139 | font-style: italic; } 140 | 141 | .reveal pre { 142 | display: block; 143 | position: relative; 144 | width: 90%; 145 | margin: 20px auto; 146 | text-align: left; 147 | font-size: 0.55em; 148 | font-family: monospace; 149 | line-height: 1.2em; 150 | word-wrap: break-word; 151 | box-shadow: 0px 0px 6px rgba(0, 0, 0, 0.3); } 152 | 153 | .reveal code { 154 | font-family: monospace; } 155 | 156 | .reveal pre code { 157 | display: block; 158 | padding: 5px; 159 | overflow: auto; 160 | max-height: 400px; 161 | word-wrap: normal; } 162 | 163 | .reveal table { 164 | margin: auto; 165 | border-collapse: collapse; 166 | border-spacing: 0; } 167 | 168 | .reveal table th { 169 | font-weight: bold; } 170 | 171 | .reveal table th, 172 | .reveal table td { 173 | text-align: left; 174 | padding: 0.2em 0.5em 0.2em 0.5em; 175 | border-bottom: 1px solid; } 176 | 177 | .reveal table th[align="center"], 178 | .reveal table td[align="center"] { 179 | text-align: center; } 180 | 181 | .reveal table th[align="right"], 182 | .reveal table td[align="right"] { 183 | text-align: right; } 184 | 185 | .reveal table tbody tr:last-child th, 186 | .reveal table tbody tr:last-child td { 187 | border-bottom: none; } 188 | 189 | .reveal sup { 190 | vertical-align: super; } 191 | 192 | .reveal sub { 193 | vertical-align: sub; } 194 | 195 | .reveal small { 196 | display: inline-block; 197 | font-size: 0.6em; 198 | line-height: 1.2em; 199 | vertical-align: top; } 200 | 201 | .reveal small * { 202 | vertical-align: top; } 203 | 204 | /********************************************* 205 | * LINKS 206 | *********************************************/ 207 | .reveal a { 208 | color: #42affa; 209 | text-decoration: none; 210 | -webkit-transition: color .15s ease; 211 | -moz-transition: color .15s ease; 212 | transition: color .15s ease; } 213 | 214 | .reveal a:hover { 215 | color: #8dcffc; 216 | text-shadow: none; 217 | border: none; } 218 | 219 | .reveal .roll span:after { 220 | color: #fff; 221 | background: #068de9; } 222 | 223 | /********************************************* 224 | * IMAGES 225 | *********************************************/ 226 | .reveal section img { 227 | margin: 15px 0px; 228 | background: rgba(255, 255, 255, 0.12); 229 | border: 4px solid #fff; 230 | box-shadow: 0 0 10px rgba(0, 0, 0, 0.15); } 231 | 232 | .reveal section img.plain { 233 | border: 0; 234 | box-shadow: none; } 235 | 236 | .reveal a img { 237 | -webkit-transition: all .15s linear; 238 | -moz-transition: all .15s linear; 239 | transition: all .15s linear; } 240 | 241 | .reveal a:hover img { 242 | background: rgba(255, 255, 255, 0.2); 243 | border-color: #42affa; 244 | box-shadow: 0 0 20px rgba(0, 0, 0, 0.55); } 245 | 246 | /********************************************* 247 | * NAVIGATION CONTROLS 248 | *********************************************/ 249 | .reveal .controls .navigate-left, 250 | .reveal .controls .navigate-left.enabled { 251 | border-right-color: #42affa; } 252 | 253 | .reveal .controls .navigate-right, 254 | .reveal .controls .navigate-right.enabled { 255 | border-left-color: #42affa; } 256 | 257 | .reveal .controls .navigate-up, 258 | .reveal .controls .navigate-up.enabled { 259 | border-bottom-color: #42affa; } 260 | 261 | .reveal .controls .navigate-down, 262 | .reveal .controls .navigate-down.enabled { 263 | border-top-color: #42affa; } 264 | 265 | .reveal .controls .navigate-left.enabled:hover { 266 | border-right-color: #8dcffc; } 267 | 268 | .reveal .controls .navigate-right.enabled:hover { 269 | border-left-color: #8dcffc; } 270 | 271 | .reveal .controls .navigate-up.enabled:hover { 272 | border-bottom-color: #8dcffc; } 273 | 274 | .reveal .controls .navigate-down.enabled:hover { 275 | border-top-color: #8dcffc; } 276 | 277 | /********************************************* 278 | * PROGRESS BAR 279 | *********************************************/ 280 | .reveal .progress { 281 | background: rgba(0, 0, 0, 0.2); } 282 | 283 | .reveal .progress span { 284 | background: #42affa; 285 | -webkit-transition: width 800ms cubic-bezier(0.26, 0.86, 0.44, 0.985); 286 | -moz-transition: width 800ms cubic-bezier(0.26, 0.86, 0.44, 0.985); 287 | transition: width 800ms cubic-bezier(0.26, 0.86, 0.44, 0.985); } 288 | -------------------------------------------------------------------------------- /slides/reveal.js/css/theme/simple.css: -------------------------------------------------------------------------------- 1 | /** 2 | * A simple theme for reveal.js presentations, similar 3 | * to the default theme. The accent color is darkblue. 4 | * 5 | * This theme is Copyright (C) 2012 Owen Versteeg, https://github.com/StereotypicalApps. It is MIT licensed. 6 | * reveal.js is Copyright (C) 2011-2012 Hakim El Hattab, http://hakim.se 7 | */ 8 | @import url(https://fonts.googleapis.com/css?family=News+Cycle:400,700); 9 | @import url(https://fonts.googleapis.com/css?family=Lato:400,700,400italic,700italic); 10 | /********************************************* 11 | * GLOBAL STYLES 12 | *********************************************/ 13 | body { 14 | background: #fff; 15 | background-color: #fff; } 16 | 17 | .reveal { 18 | font-family: "Lato", sans-serif; 19 | font-size: 36px; 20 | font-weight: normal; 21 | color: #000; } 22 | 23 | ::selection { 24 | color: #fff; 25 | background: rgba(0, 0, 0, 0.99); 26 | text-shadow: none; } 27 | 28 | .reveal .slides > section, 29 | .reveal .slides > section > section { 30 | line-height: 1.3; 31 | font-weight: inherit; } 32 | 33 | /********************************************* 34 | * HEADERS 35 | *********************************************/ 36 | .reveal h1, 37 | .reveal h2, 38 | .reveal h3, 39 | .reveal h4, 40 | .reveal h5, 41 | .reveal h6 { 42 | margin: 0 0 20px 0; 43 | color: #000; 44 | font-family: "News Cycle", Impact, sans-serif; 45 | font-weight: normal; 46 | line-height: 1.2; 47 | letter-spacing: normal; 48 | text-transform: none; 49 | text-shadow: none; 50 | word-wrap: break-word; } 51 | 52 | .reveal h1 { 53 | font-size: 3.77em; } 54 | 55 | .reveal h2 { 56 | font-size: 2.11em; } 57 | 58 | .reveal h3 { 59 | font-size: 1.55em; } 60 | 61 | .reveal h4 { 62 | font-size: 1em; } 63 | 64 | .reveal h1 { 65 | text-shadow: none; } 66 | 67 | /********************************************* 68 | * OTHER 69 | *********************************************/ 70 | .reveal p { 71 | margin: 20px 0; 72 | line-height: 1.3; } 73 | 74 | /* Ensure certain elements are never larger than the slide itself */ 75 | .reveal img, 76 | .reveal video, 77 | .reveal iframe { 78 | max-width: 95%; 79 | max-height: 95%; } 80 | 81 | .reveal strong, 82 | .reveal b { 83 | font-weight: bold; } 84 | 85 | .reveal em { 86 | font-style: italic; } 87 | 88 | .reveal ol, 89 | .reveal dl, 90 | .reveal ul { 91 | display: inline-block; 92 | text-align: left; 93 | margin: 0 0 0 1em; } 94 | 95 | .reveal ol { 96 | list-style-type: decimal; } 97 | 98 | .reveal ul { 99 | list-style-type: disc; } 100 | 101 | .reveal ul ul { 102 | list-style-type: square; } 103 | 104 | .reveal ul ul ul { 105 | list-style-type: circle; } 106 | 107 | .reveal ul ul, 108 | .reveal ul ol, 109 | .reveal ol ol, 110 | .reveal ol ul { 111 | display: block; 112 | margin-left: 40px; } 113 | 114 | .reveal dt { 115 | font-weight: bold; } 116 | 117 | .reveal dd { 118 | margin-left: 40px; } 119 | 120 | .reveal q, 121 | .reveal blockquote { 122 | quotes: none; } 123 | 124 | .reveal blockquote { 125 | display: block; 126 | position: relative; 127 | width: 70%; 128 | margin: 20px auto; 129 | padding: 5px; 130 | font-style: italic; 131 | background: rgba(255, 255, 255, 0.05); 132 | box-shadow: 0px 0px 2px rgba(0, 0, 0, 0.2); } 133 | 134 | .reveal blockquote p:first-child, 135 | .reveal blockquote p:last-child { 136 | display: inline-block; } 137 | 138 | .reveal q { 139 | font-style: italic; } 140 | 141 | .reveal pre { 142 | display: block; 143 | position: relative; 144 | width: 90%; 145 | margin: 20px auto; 146 | text-align: left; 147 | font-size: 0.55em; 148 | font-family: monospace; 149 | line-height: 1.2em; 150 | word-wrap: break-word; 151 | box-shadow: 0px 0px 6px rgba(0, 0, 0, 0.3); } 152 | 153 | .reveal code { 154 | font-family: monospace; } 155 | 156 | .reveal pre code { 157 | display: block; 158 | padding: 5px; 159 | overflow: auto; 160 | max-height: 400px; 161 | word-wrap: normal; } 162 | 163 | .reveal table { 164 | margin: auto; 165 | border-collapse: collapse; 166 | border-spacing: 0; } 167 | 168 | .reveal table th { 169 | font-weight: bold; } 170 | 171 | .reveal table th, 172 | .reveal table td { 173 | text-align: left; 174 | padding: 0.2em 0.5em 0.2em 0.5em; 175 | border-bottom: 1px solid; } 176 | 177 | .reveal table th[align="center"], 178 | .reveal table td[align="center"] { 179 | text-align: center; } 180 | 181 | .reveal table th[align="right"], 182 | .reveal table td[align="right"] { 183 | text-align: right; } 184 | 185 | .reveal table tbody tr:last-child th, 186 | .reveal table tbody tr:last-child td { 187 | border-bottom: none; } 188 | 189 | .reveal sup { 190 | vertical-align: super; } 191 | 192 | .reveal sub { 193 | vertical-align: sub; } 194 | 195 | .reveal small { 196 | display: inline-block; 197 | font-size: 0.6em; 198 | line-height: 1.2em; 199 | vertical-align: top; } 200 | 201 | .reveal small * { 202 | vertical-align: top; } 203 | 204 | /********************************************* 205 | * LINKS 206 | *********************************************/ 207 | .reveal a { 208 | color: #00008B; 209 | text-decoration: none; 210 | -webkit-transition: color .15s ease; 211 | -moz-transition: color .15s ease; 212 | transition: color .15s ease; } 213 | 214 | .reveal a:hover { 215 | color: #0000f1; 216 | text-shadow: none; 217 | border: none; } 218 | 219 | .reveal .roll span:after { 220 | color: #fff; 221 | background: #00003f; } 222 | 223 | /********************************************* 224 | * IMAGES 225 | *********************************************/ 226 | .reveal section img { 227 | margin: 15px 0px; 228 | background: rgba(255, 255, 255, 0.12); 229 | border: 4px solid #000; 230 | box-shadow: 0 0 10px rgba(0, 0, 0, 0.15); } 231 | 232 | .reveal section img.plain { 233 | border: 0; 234 | box-shadow: none; } 235 | 236 | .reveal a img { 237 | -webkit-transition: all .15s linear; 238 | -moz-transition: all .15s linear; 239 | transition: all .15s linear; } 240 | 241 | .reveal a:hover img { 242 | background: rgba(255, 255, 255, 0.2); 243 | border-color: #00008B; 244 | box-shadow: 0 0 20px rgba(0, 0, 0, 0.55); } 245 | 246 | /********************************************* 247 | * NAVIGATION CONTROLS 248 | *********************************************/ 249 | .reveal .controls .navigate-left, 250 | .reveal .controls .navigate-left.enabled { 251 | border-right-color: #00008B; } 252 | 253 | .reveal .controls .navigate-right, 254 | .reveal .controls .navigate-right.enabled { 255 | border-left-color: #00008B; } 256 | 257 | .reveal .controls .navigate-up, 258 | .reveal .controls .navigate-up.enabled { 259 | border-bottom-color: #00008B; } 260 | 261 | .reveal .controls .navigate-down, 262 | .reveal .controls .navigate-down.enabled { 263 | border-top-color: #00008B; } 264 | 265 | .reveal .controls .navigate-left.enabled:hover { 266 | border-right-color: #0000f1; } 267 | 268 | .reveal .controls .navigate-right.enabled:hover { 269 | border-left-color: #0000f1; } 270 | 271 | .reveal .controls .navigate-up.enabled:hover { 272 | border-bottom-color: #0000f1; } 273 | 274 | .reveal .controls .navigate-down.enabled:hover { 275 | border-top-color: #0000f1; } 276 | 277 | /********************************************* 278 | * PROGRESS BAR 279 | *********************************************/ 280 | .reveal .progress { 281 | background: rgba(0, 0, 0, 0.2); } 282 | 283 | .reveal .progress span { 284 | background: #00008B; 285 | -webkit-transition: width 800ms cubic-bezier(0.26, 0.86, 0.44, 0.985); 286 | -moz-transition: width 800ms cubic-bezier(0.26, 0.86, 0.44, 0.985); 287 | transition: width 800ms cubic-bezier(0.26, 0.86, 0.44, 0.985); } 288 | -------------------------------------------------------------------------------- /slides/reveal.js/css/theme/template/theme.scss: -------------------------------------------------------------------------------- 1 | // Base theme template for reveal.js 2 | 3 | /********************************************* 4 | * GLOBAL STYLES 5 | *********************************************/ 6 | 7 | body { 8 | @include bodyBackground(); 9 | background-color: $backgroundColor; 10 | } 11 | 12 | .reveal { 13 | font-family: $mainFont; 14 | font-size: $mainFontSize; 15 | font-weight: normal; 16 | color: $mainColor; 17 | } 18 | 19 | ::selection { 20 | color: $selectionColor; 21 | background: $selectionBackgroundColor; 22 | text-shadow: none; 23 | } 24 | 25 | .reveal .slides>section, 26 | .reveal .slides>section>section { 27 | line-height: 1.3; 28 | font-weight: inherit; 29 | } 30 | 31 | /********************************************* 32 | * HEADERS 33 | *********************************************/ 34 | 35 | .reveal h1, 36 | .reveal h2, 37 | .reveal h3, 38 | .reveal h4, 39 | .reveal h5, 40 | .reveal h6 { 41 | margin: $headingMargin; 42 | color: $headingColor; 43 | 44 | font-family: $headingFont; 45 | font-weight: $headingFontWeight; 46 | line-height: $headingLineHeight; 47 | letter-spacing: $headingLetterSpacing; 48 | 49 | text-transform: $headingTextTransform; 50 | text-shadow: $headingTextShadow; 51 | 52 | word-wrap: break-word; 53 | } 54 | 55 | .reveal h1 {font-size: $heading1Size; } 56 | .reveal h2 {font-size: $heading2Size; } 57 | .reveal h3 {font-size: $heading3Size; } 58 | .reveal h4 {font-size: $heading4Size; } 59 | 60 | .reveal h1 { 61 | text-shadow: $heading1TextShadow; 62 | } 63 | 64 | 65 | /********************************************* 66 | * OTHER 67 | *********************************************/ 68 | 69 | .reveal p { 70 | margin: $blockMargin 0; 71 | line-height: 1.3; 72 | } 73 | 74 | /* Ensure certain elements are never larger than the slide itself */ 75 | .reveal img, 76 | .reveal video, 77 | .reveal iframe { 78 | max-width: 95%; 79 | max-height: 95%; 80 | } 81 | .reveal strong, 82 | .reveal b { 83 | font-weight: bold; 84 | } 85 | 86 | .reveal em { 87 | font-style: italic; 88 | } 89 | 90 | .reveal ol, 91 | .reveal dl, 92 | .reveal ul { 93 | display: inline-block; 94 | 95 | text-align: left; 96 | margin: 0 0 0 1em; 97 | } 98 | 99 | .reveal ol { 100 | list-style-type: decimal; 101 | } 102 | 103 | .reveal ul { 104 | list-style-type: disc; 105 | } 106 | 107 | .reveal ul ul { 108 | list-style-type: square; 109 | } 110 | 111 | .reveal ul ul ul { 112 | list-style-type: circle; 113 | } 114 | 115 | .reveal ul ul, 116 | .reveal ul ol, 117 | .reveal ol ol, 118 | .reveal ol ul { 119 | display: block; 120 | margin-left: 40px; 121 | } 122 | 123 | .reveal dt { 124 | font-weight: bold; 125 | } 126 | 127 | .reveal dd { 128 | margin-left: 40px; 129 | } 130 | 131 | .reveal q, 132 | .reveal blockquote { 133 | quotes: none; 134 | } 135 | 136 | .reveal blockquote { 137 | display: block; 138 | position: relative; 139 | width: 70%; 140 | margin: $blockMargin auto; 141 | padding: 5px; 142 | 143 | font-style: italic; 144 | background: rgba(255, 255, 255, 0.05); 145 | box-shadow: 0px 0px 2px rgba(0,0,0,0.2); 146 | } 147 | .reveal blockquote p:first-child, 148 | .reveal blockquote p:last-child { 149 | display: inline-block; 150 | } 151 | 152 | .reveal q { 153 | font-style: italic; 154 | } 155 | 156 | .reveal pre { 157 | display: block; 158 | position: relative; 159 | width: 90%; 160 | margin: $blockMargin auto; 161 | 162 | text-align: left; 163 | font-size: 0.55em; 164 | font-family: monospace; 165 | line-height: 1.2em; 166 | 167 | word-wrap: break-word; 168 | 169 | box-shadow: 0px 0px 6px rgba(0,0,0,0.3); 170 | } 171 | .reveal code { 172 | font-family: monospace; 173 | } 174 | 175 | .reveal pre code { 176 | display: block; 177 | padding: 5px; 178 | overflow: auto; 179 | max-height: 400px; 180 | word-wrap: normal; 181 | } 182 | 183 | .reveal table { 184 | margin: auto; 185 | border-collapse: collapse; 186 | border-spacing: 0; 187 | } 188 | 189 | .reveal table th { 190 | font-weight: bold; 191 | } 192 | 193 | .reveal table th, 194 | .reveal table td { 195 | text-align: left; 196 | padding: 0.2em 0.5em 0.2em 0.5em; 197 | border-bottom: 1px solid; 198 | } 199 | 200 | .reveal table th[align="center"], 201 | .reveal table td[align="center"] { 202 | text-align: center; 203 | } 204 | 205 | .reveal table th[align="right"], 206 | .reveal table td[align="right"] { 207 | text-align: right; 208 | } 209 | 210 | .reveal table tbody tr:last-child th, 211 | .reveal table tbody tr:last-child td { 212 | border-bottom: none; 213 | } 214 | 215 | .reveal sup { 216 | vertical-align: super; 217 | } 218 | .reveal sub { 219 | vertical-align: sub; 220 | } 221 | 222 | .reveal small { 223 | display: inline-block; 224 | font-size: 0.6em; 225 | line-height: 1.2em; 226 | vertical-align: top; 227 | } 228 | 229 | .reveal small * { 230 | vertical-align: top; 231 | } 232 | 233 | 234 | /********************************************* 235 | * LINKS 236 | *********************************************/ 237 | 238 | .reveal a { 239 | color: $linkColor; 240 | text-decoration: none; 241 | 242 | -webkit-transition: color .15s ease; 243 | -moz-transition: color .15s ease; 244 | transition: color .15s ease; 245 | } 246 | .reveal a:hover { 247 | color: $linkColorHover; 248 | 249 | text-shadow: none; 250 | border: none; 251 | } 252 | 253 | .reveal .roll span:after { 254 | color: #fff; 255 | background: darken( $linkColor, 15% ); 256 | } 257 | 258 | 259 | /********************************************* 260 | * IMAGES 261 | *********************************************/ 262 | 263 | .reveal section img { 264 | margin: 15px 0px; 265 | background: rgba(255,255,255,0.12); 266 | border: 4px solid $mainColor; 267 | 268 | box-shadow: 0 0 10px rgba(0, 0, 0, 0.15); 269 | } 270 | 271 | .reveal section img.plain { 272 | border: 0; 273 | box-shadow: none; 274 | } 275 | 276 | .reveal a img { 277 | -webkit-transition: all .15s linear; 278 | -moz-transition: all .15s linear; 279 | transition: all .15s linear; 280 | } 281 | 282 | .reveal a:hover img { 283 | background: rgba(255,255,255,0.2); 284 | border-color: $linkColor; 285 | 286 | box-shadow: 0 0 20px rgba(0, 0, 0, 0.55); 287 | } 288 | 289 | 290 | /********************************************* 291 | * NAVIGATION CONTROLS 292 | *********************************************/ 293 | 294 | .reveal .controls .navigate-left, 295 | .reveal .controls .navigate-left.enabled { 296 | border-right-color: $linkColor; 297 | } 298 | 299 | .reveal .controls .navigate-right, 300 | .reveal .controls .navigate-right.enabled { 301 | border-left-color: $linkColor; 302 | } 303 | 304 | .reveal .controls .navigate-up, 305 | .reveal .controls .navigate-up.enabled { 306 | border-bottom-color: $linkColor; 307 | } 308 | 309 | .reveal .controls .navigate-down, 310 | .reveal .controls .navigate-down.enabled { 311 | border-top-color: $linkColor; 312 | } 313 | 314 | .reveal .controls .navigate-left.enabled:hover { 315 | border-right-color: $linkColorHover; 316 | } 317 | 318 | .reveal .controls .navigate-right.enabled:hover { 319 | border-left-color: $linkColorHover; 320 | } 321 | 322 | .reveal .controls .navigate-up.enabled:hover { 323 | border-bottom-color: $linkColorHover; 324 | } 325 | 326 | .reveal .controls .navigate-down.enabled:hover { 327 | border-top-color: $linkColorHover; 328 | } 329 | 330 | 331 | /********************************************* 332 | * PROGRESS BAR 333 | *********************************************/ 334 | 335 | .reveal .progress { 336 | background: rgba(0,0,0,0.2); 337 | } 338 | .reveal .progress span { 339 | background: $linkColor; 340 | 341 | -webkit-transition: width 800ms cubic-bezier(0.260, 0.860, 0.440, 0.985); 342 | -moz-transition: width 800ms cubic-bezier(0.260, 0.860, 0.440, 0.985); 343 | transition: width 800ms cubic-bezier(0.260, 0.860, 0.440, 0.985); 344 | } 345 | 346 | 347 | -------------------------------------------------------------------------------- /slides/reveal.js/plugin/search/search.js: -------------------------------------------------------------------------------- 1 | /* 2 | * Handles finding a text string anywhere in the slides and showing the next occurrence to the user 3 | * by navigatating to that slide and highlighting it. 4 | * 5 | * By Jon Snyder , February 2013 6 | */ 7 | 8 | var RevealSearch = (function() { 9 | 10 | var matchedSlides; 11 | var currentMatchedIndex; 12 | var searchboxDirty; 13 | var myHilitor; 14 | 15 | // Original JavaScript code by Chirp Internet: www.chirp.com.au 16 | // Please acknowledge use of this code by including this header. 17 | // 2/2013 jon: modified regex to display any match, not restricted to word boundaries. 18 | 19 | function Hilitor(id, tag) 20 | { 21 | 22 | var targetNode = document.getElementById(id) || document.body; 23 | var hiliteTag = tag || "EM"; 24 | var skipTags = new RegExp("^(?:" + hiliteTag + "|SCRIPT|FORM|SPAN)$"); 25 | var colors = ["#ff6", "#a0ffff", "#9f9", "#f99", "#f6f"]; 26 | var wordColor = []; 27 | var colorIdx = 0; 28 | var matchRegex = ""; 29 | var matchingSlides = []; 30 | 31 | this.setRegex = function(input) 32 | { 33 | input = input.replace(/^[^\w]+|[^\w]+$/g, "").replace(/[^\w'-]+/g, "|"); 34 | matchRegex = new RegExp("(" + input + ")","i"); 35 | } 36 | 37 | this.getRegex = function() 38 | { 39 | return matchRegex.toString().replace(/^\/\\b\(|\)\\b\/i$/g, "").replace(/\|/g, " "); 40 | } 41 | 42 | // recursively apply word highlighting 43 | this.hiliteWords = function(node) 44 | { 45 | if(node == undefined || !node) return; 46 | if(!matchRegex) return; 47 | if(skipTags.test(node.nodeName)) return; 48 | 49 | if(node.hasChildNodes()) { 50 | for(var i=0; i < node.childNodes.length; i++) 51 | this.hiliteWords(node.childNodes[i]); 52 | } 53 | if(node.nodeType == 3) { // NODE_TEXT 54 | if((nv = node.nodeValue) && (regs = matchRegex.exec(nv))) { 55 | //find the slide's section element and save it in our list of matching slides 56 | var secnode = node.parentNode; 57 | while (secnode.nodeName != 'SECTION') { 58 | secnode = secnode.parentNode; 59 | } 60 | 61 | var slideIndex = Reveal.getIndices(secnode); 62 | var slidelen = matchingSlides.length; 63 | var alreadyAdded = false; 64 | for (var i=0; i < slidelen; i++) { 65 | if ( (matchingSlides[i].h === slideIndex.h) && (matchingSlides[i].v === slideIndex.v) ) { 66 | alreadyAdded = true; 67 | } 68 | } 69 | if (! alreadyAdded) { 70 | matchingSlides.push(slideIndex); 71 | } 72 | 73 | if(!wordColor[regs[0].toLowerCase()]) { 74 | wordColor[regs[0].toLowerCase()] = colors[colorIdx++ % colors.length]; 75 | } 76 | 77 | var match = document.createElement(hiliteTag); 78 | match.appendChild(document.createTextNode(regs[0])); 79 | match.style.backgroundColor = wordColor[regs[0].toLowerCase()]; 80 | match.style.fontStyle = "inherit"; 81 | match.style.color = "#000"; 82 | 83 | var after = node.splitText(regs.index); 84 | after.nodeValue = after.nodeValue.substring(regs[0].length); 85 | node.parentNode.insertBefore(match, after); 86 | } 87 | } 88 | }; 89 | 90 | // remove highlighting 91 | this.remove = function() 92 | { 93 | var arr = document.getElementsByTagName(hiliteTag); 94 | while(arr.length && (el = arr[0])) { 95 | el.parentNode.replaceChild(el.firstChild, el); 96 | } 97 | }; 98 | 99 | // start highlighting at target node 100 | this.apply = function(input) 101 | { 102 | if(input == undefined || !input) return; 103 | this.remove(); 104 | this.setRegex(input); 105 | this.hiliteWords(targetNode); 106 | return matchingSlides; 107 | }; 108 | 109 | } 110 | 111 | function openSearch() { 112 | //ensure the search term input dialog is visible and has focus: 113 | var inputbox = document.getElementById("searchinput"); 114 | inputbox.style.display = "inline"; 115 | inputbox.focus(); 116 | inputbox.select(); 117 | } 118 | 119 | function toggleSearch() { 120 | var inputbox = document.getElementById("searchinput"); 121 | if (inputbox.style.display !== "inline") { 122 | openSearch(); 123 | } 124 | else { 125 | inputbox.style.display = "none"; 126 | myHilitor.remove(); 127 | } 128 | } 129 | 130 | function doSearch() { 131 | //if there's been a change in the search term, perform a new search: 132 | if (searchboxDirty) { 133 | var searchstring = document.getElementById("searchinput").value; 134 | 135 | //find the keyword amongst the slides 136 | myHilitor = new Hilitor("slidecontent"); 137 | matchedSlides = myHilitor.apply(searchstring); 138 | currentMatchedIndex = 0; 139 | } 140 | 141 | //navigate to the next slide that has the keyword, wrapping to the first if necessary 142 | if (matchedSlides.length && (matchedSlides.length <= currentMatchedIndex)) { 143 | currentMatchedIndex = 0; 144 | } 145 | if (matchedSlides.length > currentMatchedIndex) { 146 | Reveal.slide(matchedSlides[currentMatchedIndex].h, matchedSlides[currentMatchedIndex].v); 147 | currentMatchedIndex++; 148 | } 149 | } 150 | 151 | var dom = {}; 152 | dom.wrapper = document.querySelector( '.reveal' ); 153 | 154 | if( !dom.wrapper.querySelector( '.searchbox' ) ) { 155 | var searchElement = document.createElement( 'div' ); 156 | searchElement.id = "searchinputdiv"; 157 | searchElement.classList.add( 'searchdiv' ); 158 | searchElement.style.position = 'absolute'; 159 | searchElement.style.top = '10px'; 160 | searchElement.style.left = '10px'; 161 | //embedded base64 search icon Designed by Sketchdock - http://www.sketchdock.com/: 162 | searchElement.innerHTML = ''; 163 | dom.wrapper.appendChild( searchElement ); 164 | } 165 | 166 | document.getElementById("searchbutton").addEventListener( 'click', function(event) { 167 | doSearch(); 168 | }, false ); 169 | 170 | document.getElementById("searchinput").addEventListener( 'keyup', function( event ) { 171 | switch (event.keyCode) { 172 | case 13: 173 | event.preventDefault(); 174 | doSearch(); 175 | searchboxDirty = false; 176 | break; 177 | default: 178 | searchboxDirty = true; 179 | } 180 | }, false ); 181 | 182 | // Open the search when the 's' key is hit (yes, this conflicts with the notes plugin, disabling for now) 183 | /* 184 | document.addEventListener( 'keydown', function( event ) { 185 | // Disregard the event if the target is editable or a 186 | // modifier is present 187 | if ( document.querySelector( ':focus' ) !== null || event.shiftKey || event.altKey || event.ctrlKey || event.metaKey ) return; 188 | 189 | if( event.keyCode === 83 ) { 190 | event.preventDefault(); 191 | openSearch(); 192 | } 193 | }, false ); 194 | */ 195 | return { open: openSearch }; 196 | })(); 197 | --------------------------------------------------------------------------------