├── .envrc ├── .github ├── actions │ └── gateway-tests │ │ └── action.yml ├── pull_request_template.md ├── scripts │ └── free-disk-space.sh └── workflows │ ├── ci.yml │ ├── containers.yml │ ├── deploy.yml │ ├── docker.yml │ ├── releaser.yml │ ├── tools-manifest.yml │ └── tools.yml ├── .gitignore ├── Dockerfile ├── LICENSE.md ├── LabBio_whitetext_transparent.png ├── LabDAO_Logo_Teal.png ├── README.md ├── checkpoint_0_event.csv ├── cmd ├── root.go ├── upgrade.go └── web.go ├── contracts ├── README.md ├── artifacts │ ├── @openzeppelin │ │ └── contracts │ │ │ ├── token │ │ │ └── ERC1155 │ │ │ │ ├── ERC1155.sol │ │ │ │ ├── ERC1155.dbg.json │ │ │ │ └── ERC1155.json │ │ │ │ ├── IERC1155.sol │ │ │ │ ├── IERC1155.dbg.json │ │ │ │ └── IERC1155.json │ │ │ │ ├── IERC1155Receiver.sol │ │ │ │ ├── IERC1155Receiver.dbg.json │ │ │ │ └── IERC1155Receiver.json │ │ │ │ └── extensions │ │ │ │ └── IERC1155MetadataURI.sol │ │ │ │ ├── IERC1155MetadataURI.dbg.json │ │ │ │ └── IERC1155MetadataURI.json │ │ │ └── utils │ │ │ ├── Context.sol │ │ │ ├── Context.dbg.json │ │ │ └── Context.json │ │ │ └── introspection │ │ │ ├── ERC165.sol │ │ │ ├── ERC165.dbg.json │ │ │ └── ERC165.json │ │ │ └── IERC165.sol │ │ │ ├── IERC165.dbg.json │ │ │ └── IERC165.json │ └── contracts │ │ └── ProofOfScience.sol │ │ ├── ProofOfScience.dbg.json │ │ └── ProofOfScience.json ├── contracts │ └── ProofOfScience.sol ├── hardhat.config.js ├── ignition │ └── modules │ │ └── ProofOfScience.js ├── package-lock.json ├── package.json └── test │ └── ProofOfScience.js ├── docker-compose-gpu.yml ├── docker-compose.private.yml ├── docker-compose.tunnel.yml ├── docker-compose.yml ├── docker ├── images │ ├── bacalhau │ │ └── Dockerfile │ └── ipfs │ │ ├── Dockerfile │ │ ├── README.md │ │ └── container-init.d │ │ ├── 001-custom-config.sh │ │ ├── 002-s3-keyTransformation.sh │ │ ├── 003-bootstrap-rm.sh │ │ ├── 004-swarm-base64-key.sh │ │ ├── 005-gateway-port.sh │ │ ├── 006-datastore.sh │ │ ├── 007-remote-pinning-service.sh │ │ └── 999-debug-config.sh └── ipfs_data │ ├── config │ ├── datastore_spec │ └── swarm.key ├── docs ├── README.md ├── babel.config.js ├── docs │ ├── reference │ │ ├── api.md │ │ └── python.md │ └── tutorials │ │ └── tutorials.md ├── docusaurus.config.js ├── package-lock.json ├── package.json ├── scripts │ ├── ascicast-commands.txt │ ├── create_ascicast.sh │ └── find_unused_images.py ├── sidebars.js ├── src │ ├── components │ │ ├── AsciinemaPlayer.js │ │ └── OpenInColab.js │ └── css │ │ └── custom.css ├── static │ ├── .nojekyll │ └── img │ │ ├── LabDAO_Favicon_Teal.png │ │ ├── favicon.ico │ │ ├── labdao-icon.png │ │ ├── labdaologo_brandmark_Teal.png │ │ ├── logo.svg │ │ ├── protein-folding-graphic.png │ │ └── small-molecule-binding-graphic.png ├── tsconfig.json └── yarn.lock ├── frontend ├── .dockerignore ├── .eslintrc.json ├── .gitignore ├── Dockerfile ├── README.md ├── app │ ├── (auth) │ │ └── login │ │ │ └── page.tsx │ ├── (resources) │ │ ├── infrastructure │ │ │ └── page.tsx │ │ └── philosophy │ │ │ └── page.tsx │ ├── api │ │ ├── identity-count │ │ │ └── route.ts │ │ └── page.tsx │ ├── data │ │ ├── AddFileForm.tsx │ │ └── page.tsx │ ├── experiments │ │ ├── (experiment) │ │ │ ├── (forms) │ │ │ │ ├── ContinuousSwitch.tsx │ │ │ │ ├── DynamicArrayField.tsx │ │ │ │ ├── ExperimentRenameForm.tsx │ │ │ │ ├── NewExperimentForm.tsx │ │ │ │ ├── RerunExperimentForm.tsx │ │ │ │ ├── formGenerator.ts │ │ │ │ └── formUtils.ts │ │ │ ├── (results) │ │ │ │ ├── ExperimentResults.tsx │ │ │ │ ├── JobDetail.tsx │ │ │ │ ├── JobsAccordion.tsx │ │ │ │ ├── LogViewer.tsx │ │ │ │ └── MetricsVisualizer.tsx │ │ │ ├── ExperimentStatus.tsx │ │ │ ├── ExperimentSummary.tsx │ │ │ ├── ExperimentUIContext.tsx │ │ │ ├── ModelPanel │ │ │ │ ├── ModelGuide.tsx │ │ │ │ ├── ModelInfo.tsx │ │ │ │ └── index.tsx │ │ │ ├── [experimentID] │ │ │ │ ├── ExperimentDetail.tsx │ │ │ │ ├── ExperimentShare.tsx │ │ │ │ └── page.tsx │ │ │ ├── layout.tsx │ │ │ └── new │ │ │ │ └── [taskSlug] │ │ │ │ └── [[...toolCID]] │ │ │ │ └── page.tsx │ │ └── page.tsx │ ├── layout.tsx │ ├── models │ │ ├── @add │ │ │ └── page.tsx │ │ ├── @list │ │ │ └── page.tsx │ │ ├── default.tsx │ │ └── layout.tsx │ ├── not-found.tsx │ ├── page.tsx │ ├── subscribe │ │ └── page.tsx │ ├── subscription │ │ └── manage │ │ │ └── page.tsx │ └── tasks │ │ ├── TaskCard.tsx │ │ ├── TasksMenu.tsx │ │ ├── page.tsx │ │ └── taskList.ts ├── components.json ├── components │ ├── auth │ │ ├── PrivyLoginButton.tsx │ │ └── ProtectedComponent.tsx │ ├── global │ │ ├── Breadcrumbs.tsx │ │ ├── Logo.tsx │ │ ├── Nav.tsx │ │ ├── NavItem.tsx │ │ ├── PoweredByLogo.tsx │ │ └── UserMenu.tsx │ ├── payment │ │ ├── StripeCheckoutButton.tsx │ │ └── TransactionSummaryInfo.tsx │ ├── shared │ │ ├── CopyToClipboard.tsx │ │ ├── FileSelect.tsx │ │ ├── ModelSelect.tsx │ │ ├── PageLoader.tsx │ │ ├── TruncatedString.tsx │ │ └── ViewportWarning.tsx │ ├── ui │ │ ├── accordion.tsx │ │ ├── alert-dialog.tsx │ │ ├── alert.tsx │ │ ├── badge.tsx │ │ ├── boolean-input.tsx │ │ ├── button.tsx │ │ ├── card.tsx │ │ ├── collapsible.tsx │ │ ├── command.tsx │ │ ├── data-pagination.tsx │ │ ├── data-table-column-header.tsx │ │ ├── data-table.tsx │ │ ├── dialog.tsx │ │ ├── dropdown-menu.tsx │ │ ├── form.tsx │ │ ├── inline-edit-experiment.tsx │ │ ├── input.tsx │ │ ├── label.tsx │ │ ├── popover.tsx │ │ ├── scroll-area.tsx │ │ ├── select.tsx │ │ ├── separator.tsx │ │ ├── sonner.tsx │ │ ├── switch.tsx │ │ ├── table.tsx │ │ ├── tabs.tsx │ │ ├── textarea.tsx │ │ └── tooltip.tsx │ └── visualization │ │ └── Molstar │ │ ├── index.tsx │ │ └── skin.scss ├── fonts │ ├── FKRasterRomanCompact-Blended.woff2 │ ├── PPFraktionMono-Bold.woff2 │ ├── PPFraktionMono-BoldItalic.woff2 │ ├── PPFraktionMono-Regular.woff2 │ ├── PPFraktionMono-RegularItalic.woff2 │ ├── PPNeueMontreal-Bold.woff2 │ ├── PPNeueMontreal-BoldItalic.woff2 │ ├── PPNeueMontreal-Italic.woff2 │ └── PPNeueMontreal-Regular.woff2 ├── lib │ ├── PrivyContext.tsx │ ├── PrivyProviderWrapper.tsx │ ├── backendUrl.ts │ ├── planTemplate.ts │ ├── providers.tsx │ ├── redux │ │ ├── createAppAsyncThunk.ts │ │ ├── index.ts │ │ ├── middleware.ts │ │ ├── rootReducer.ts │ │ ├── slices │ │ │ ├── apiKeyAddSlice │ │ │ │ ├── asyncActions.ts │ │ │ │ ├── index.ts │ │ │ │ ├── selectors.ts │ │ │ │ ├── slice.ts │ │ │ │ └── thunks.ts │ │ │ ├── apiKeyListSlice │ │ │ │ ├── asyncActions.ts │ │ │ │ ├── index.ts │ │ │ │ ├── selectors.ts │ │ │ │ ├── slice.ts │ │ │ │ └── thunks.ts │ │ │ ├── experimentAddSlice │ │ │ │ ├── asyncActions.ts │ │ │ │ ├── index.ts │ │ │ │ ├── selectors.ts │ │ │ │ ├── slice.ts │ │ │ │ └── thunks.ts │ │ │ ├── experimentDetailSlice │ │ │ │ ├── asyncActions.ts │ │ │ │ ├── index.ts │ │ │ │ ├── selectors.ts │ │ │ │ ├── slice.ts │ │ │ │ └── thunks.ts │ │ │ ├── experimentListSlice │ │ │ │ ├── asyncActions.ts │ │ │ │ ├── index.ts │ │ │ │ ├── selectors.ts │ │ │ │ ├── slice.ts │ │ │ │ └── thunks.ts │ │ │ ├── experimentNamesSlice │ │ │ │ ├── asyncActions.ts │ │ │ │ ├── index.ts │ │ │ │ ├── selectors.ts │ │ │ │ ├── slice.ts │ │ │ │ └── thunks.ts │ │ │ ├── experimentUpdateSlice │ │ │ │ ├── asyncActions.ts │ │ │ │ ├── index.ts │ │ │ │ ├── selectors.ts │ │ │ │ ├── slice.ts │ │ │ │ └── thunks.ts │ │ │ ├── fileAddSlice │ │ │ │ ├── actions.ts │ │ │ │ ├── dataSlice.ts │ │ │ │ ├── index.ts │ │ │ │ ├── selectors.ts │ │ │ │ └── thunks.ts │ │ │ ├── fileListSlice │ │ │ │ ├── asyncActions.ts │ │ │ │ ├── index.ts │ │ │ │ ├── selectors.ts │ │ │ │ ├── slice.ts │ │ │ │ └── thunks.ts │ │ │ ├── index.ts │ │ │ ├── jobDetailSlice │ │ │ │ ├── asyncActions.ts │ │ │ │ ├── index.ts │ │ │ │ ├── selectors.ts │ │ │ │ ├── slice.ts │ │ │ │ └── thunks.ts │ │ │ ├── modelAddSlice │ │ │ │ ├── asyncActions.ts │ │ │ │ ├── index.ts │ │ │ │ ├── selectors.ts │ │ │ │ ├── slice.ts │ │ │ │ └── thunks.ts │ │ │ ├── modelDetailSlice │ │ │ │ ├── asyncActions.ts │ │ │ │ ├── index.ts │ │ │ │ ├── selectors.ts │ │ │ │ ├── slice.ts │ │ │ │ └── thunks.ts │ │ │ ├── modelListSlice │ │ │ │ ├── asyncActions.ts │ │ │ │ ├── index.ts │ │ │ │ ├── selectors.ts │ │ │ │ ├── slice.ts │ │ │ │ └── thunks.ts │ │ │ ├── stripeCheckoutSlice │ │ │ │ ├── asyncActions.ts │ │ │ │ ├── index.ts │ │ │ │ ├── selectors.ts │ │ │ │ ├── slice.ts │ │ │ │ └── thunks.ts │ │ │ ├── transactionsSummarySlice │ │ │ │ ├── asyncActions.ts │ │ │ │ ├── index.ts │ │ │ │ ├── selectors.ts │ │ │ │ ├── slice.ts │ │ │ │ └── thunks.ts │ │ │ └── userSlice │ │ │ │ ├── actions.ts │ │ │ │ ├── index.ts │ │ │ │ ├── selectors.ts │ │ │ │ ├── thunks.ts │ │ │ │ └── userSlice.ts │ │ └── store.ts │ └── utils.ts ├── next.config.mjs ├── package-lock.json ├── package.json ├── postcss.config.js ├── public │ ├── browserconfig.xml │ ├── icons │ │ ├── android-chrome-192x192.png │ │ ├── android-chrome-512x512.png │ │ ├── apple-touch-icon.png │ │ ├── favicon-16x16.png │ │ ├── favicon-32x32.png │ │ ├── favicon.ico │ │ ├── mstile-144x144.png │ │ ├── mstile-150x150.png │ │ ├── mstile-310x150.png │ │ ├── mstile-310x310.png │ │ ├── mstile-70x70.png │ │ └── safari-pinned-tab.svg │ ├── images │ │ ├── bg-brand-pattern.svg │ │ ├── task-community-models.png │ │ ├── task-protein-binder-design.png │ │ ├── task-protein-docking.png │ │ ├── task-protein-folding.png │ │ └── task-small-molecule-docking.png │ └── site.webmanifest ├── run.sh ├── styles │ └── globals.css ├── tailwind.config.js └── tsconfig.json ├── gateway ├── README.md ├── app.go ├── handlers │ ├── api.go │ ├── checkpoints.go │ ├── experiments.go │ ├── files.go │ ├── healthcheck.go │ ├── jobs.go │ ├── models.go │ ├── stripe.go │ ├── tags.go │ ├── transactions.go │ └── users.go ├── lab-bio-api-spec.json ├── middleware │ └── auth.go ├── migrations │ ├── 10_update_other_to_community_models.up.sql │ ├── 11_add_s3_info_to_jobs.down.sql │ ├── 11_add_s3_info_to_jobs.up.sql │ ├── 12_populate_generated_datafile_wallet_address.up.sql │ ├── 13_add_user_admins.down.sql │ ├── 13_add_user_admins.up.sql │ ├── 14_add_datafile_public_attribute.down.sql │ ├── 14_add_datafile_public_attribute.up.sql │ ├── 15_create_user_data_file_table.up.sql │ ├── 16_add_flow_public_attribute.down.sql │ ├── 16_add_flow_public_attribute.up.sql │ ├── 17_add_job_public_attribute.down.sql │ ├── 17_add_job_public_attribute.up.sql │ ├── 18_add_exp_uuid.down.sql │ ├── 18_add_exp_uuid.up.sql │ ├── 19_add_flow_record_cid_attribute.down.sql │ ├── 19_add_flow_record_cid_attribute.up.sql │ ├── 1_initial_schema.down.sql │ ├── 1_initial_schema.up.sql │ ├── 20_add_job_retry_max_runtime.down.sql │ ├── 20_add_job_retry_max_runtime.up.sql │ ├── 21_jobs_job_type.down.sql │ ├── 21_jobs_job_type.up.sql │ ├── 22_add_job_result_json_column.down.sql │ ├── 22_add_job_result_json_column.up.sql │ ├── 23_datafile_s3_location_columns.down.sql │ ├── 23_datafile_s3_location_columns.up.sql │ ├── 24_tool_ray_service_endpoint_rename.down.sql │ ├── 24_tool_ray_service_endpoint_rename.up.sql │ ├── 25_s3_uri_in_datafile_table.down.sql │ ├── 25_s3_uri_in_datafile_table.up.sql │ ├── 26_tool_s3_uri_column.down.sql │ ├── 26_tool_s3_uri_column.up.sql │ ├── 27_flow_drop_cid.down.sql │ ├── 27_flow_drop_cid.up.sql │ ├── 28_job_id_updates.up copy.sql │ ├── 28_job_id_updates.up.sql │ ├── 29_add_tier_and_compute_tally.down.sql │ ├── 29_add_tier_and_compute_tally.up.sql │ ├── 2_add_tags_schema.down.sql │ ├── 2_add_tags_schema.up.sql │ ├── 30_add_compute_cost.down.sql │ ├── 30_add_compute_cost.up.sql │ ├── 31_add_stripe_user_id.down.sql │ ├── 31_add_stripe_user_id.up.sql │ ├── 32_flow_to_experiment_rename.down.sql │ ├── 32_flow_to_experiment_rename.up.sql │ ├── 33_datafile_to_file_rename.down.sql │ ├── 33_datafile_to_file_rename.up.sql │ ├── 34_tool_to_model_rename.down.sql │ ├── 34_tool_to_model_rename.up.sql │ ├── 35_update_DB_schema.up.sql │ ├── 36_user_subscriptions.down.sql │ ├── 36_user_subscriptions.up.sql │ ├── 37_filehash_nullable.down.sql │ ├── 37_filehash_nullable.up.sql │ ├── 38_job_type_column.down.sql │ ├── 38_job_type_column.up.sql │ ├── 39_inference_event_filename_column.down.sql │ ├── 39_inference_event_filename_column.up.sql │ ├── 3_seed_tags_table.down.sql │ ├── 3_seed_tags_table.up.sql │ ├── 4_add_timestamps.down.sql │ ├── 4_add_timestamps.up.sql │ ├── 5_change_for_queue_support.up.sql │ ├── 6_add_tool_flags.down.sql │ ├── 6_add_tool_flags.up.sql │ ├── 7_add_api_keys_table.down.sql │ ├── 7_add_api_keys_table.up.sql │ ├── 8_add_api_keys_to_users.down.sql │ ├── 8_add_api_keys_to_users.up.sql │ ├── 9_add_transaction_table.down.sql │ └── 9_add_transaction_table.up.sql ├── models │ ├── design.go │ ├── experiment.go │ ├── file.go │ ├── fileevent.go │ ├── inferenceevent.go │ ├── job.go │ ├── key.go │ ├── model.go │ ├── organization.go │ ├── rayjobresponse.go │ ├── scatterplotdata.go │ ├── tag.go │ ├── transaction.go │ ├── user.go │ └── userevent.go ├── server │ └── server.go ├── test_api.sh └── utils │ ├── api.go │ ├── queue.go │ ├── stripe.go │ ├── utils.go │ └── web3.go ├── go.mod ├── go.sum ├── infrastructure └── ansible │ ├── README.md │ ├── ansible.cfg │ ├── files │ ├── bacalhau.service │ ├── compute.service │ ├── compute.yaml │ ├── environment.py │ ├── instance-terminator.j2 │ ├── ipfs.service │ ├── ipfs │ │ └── 0001-bucket-config.sh │ ├── jupyter_notebook_config.py │ ├── receptor-config │ ├── receptor.service │ ├── requester.service │ └── requester.yaml │ ├── install_requirements.yaml │ ├── inventory.aws_ec2.yaml │ ├── jupyter_deploy_plex.yaml │ ├── jupyter_set_users.yaml │ ├── provision_compute_instance.yaml │ ├── provision_compute_only.yaml │ ├── provision_ipfs.yaml │ ├── provision_jupyter.yaml │ ├── provision_receptor.yaml │ ├── provision_requester.yaml │ ├── requirements.yaml │ ├── tasks │ ├── common_tasks.yaml │ ├── install_bacalhau_tasks.yaml │ ├── install_docker_tasks.yaml │ ├── install_gpu_tasks.yaml │ ├── install_ipfs_docker_tasks.yaml │ ├── install_plex_tasks.yaml │ ├── jupyter_team_setup_tasks.yaml │ └── pull_common_containers.yaml │ └── vars │ └── teams.yaml ├── internal ├── ipfs │ ├── ipfs.go │ └── ipfs_test.go ├── ipwl │ ├── initialize_io.go │ ├── io.go │ ├── io_test.go │ ├── model.go │ ├── model_test.go │ └── testdata │ │ ├── binding │ │ └── abl │ │ │ ├── 7n9g.pdb │ │ │ ├── ZINC000003986735.sdf │ │ │ └── ZINC000019632618.sdf │ │ ├── example_equibind_io.json │ │ ├── example_initial_io.json │ │ ├── example_io.json │ │ └── example_tool.json ├── ray │ └── ray.go ├── s3 │ ├── minio.go │ └── s3.go └── web3 │ ├── name_factory.go │ ├── nft.go │ └── wallet.go ├── jobs └── .gitkeep ├── main.go ├── models ├── colabdesign │ ├── CHANGELOG.md │ ├── Dockerfile │ ├── base_classes.py │ ├── colabdesign.json │ ├── conf │ │ ├── config.yaml │ │ ├── inputs │ │ │ └── container.yaml │ │ └── outputs │ │ │ ├── container.yaml │ │ │ └── local.yaml │ ├── main.py │ ├── requirements.txt │ ├── test.sh │ ├── testdata │ │ ├── inputs │ │ │ └── target_protein │ │ │ │ └── pdc_upar_1_target.pdb │ │ └── viz-input │ │ │ └── Condition_52_Design_0.pdb │ ├── visualisers.py │ └── viz-requirements.txt ├── labsay │ ├── CHANGELOG.md │ ├── Dockerfile │ ├── README.md │ ├── labsay_a.json │ ├── labsay_b.json │ ├── main.py │ ├── test.sh │ ├── testdata │ │ └── inputs │ │ │ ├── BioCD202b18_aa_7fd4f_unrelaxed_rank_003_alphafold2_multimer_v3_model_2_seed_000.pdb │ │ │ ├── design_1.pdb │ │ │ ├── example.pdb │ │ │ ├── file_example │ │ │ └── message.txt │ │ │ └── pdb_checkpoints │ │ │ ├── BioCD202b18_aa_7fd4f_unrelaxed_rank_003_alphafold2_multimer_v3_model_2_seed_000.pdb │ │ │ ├── design_1.pdb │ │ │ └── example.pdb │ └── user_input.json └── ray │ ├── colabdesign_ray_job.json │ ├── colabfold_demo_ray_job.json │ ├── design_with_colabdesign.json │ ├── generate_protein_binder_backbone.json │ ├── sample_rfdiffusion.json │ └── simulate-protein-complex.json ├── pkg └── README.md ├── receptor ├── Dockerfile ├── go.mod ├── go.sum ├── main.go └── models │ ├── job.go │ └── setup.go ├── run_plex_multiple.sh ├── scripts ├── asciicast │ ├── asciicast-commands.txt │ └── create-asciicast.sh └── build-containers.sh ├── testdata ├── binding │ ├── abl │ │ ├── 7n9g.pdb │ │ ├── ZINC000003986735.sdf │ │ └── ZINC000019632618.sdf │ ├── pdbbind_processed_size1 │ │ └── 6d08 │ │ │ ├── 6d08_ligand.sdf │ │ │ └── 6d08_protein_processed.pdb │ └── pdbbind_processed_size2 │ │ ├── 6d08 │ │ ├── 6d08_ligand.sdf │ │ └── 6d08_protein_processed.pdb │ │ └── 6qqu │ │ ├── 6qqu_ligand.mol2 │ │ └── 6qqu_protein_processed.pdb ├── design │ └── insulin_target.pdb └── ipfs_test │ ├── haiku2.txt │ ├── test.csv │ └── testset_csv.csv └── uploaded └── 96942c2c5f73f89849f3ff183dafd864e350dbeaa899a7ba4fcce3c7fcaaf50d └── a1bf7360-5f8f-46e2-8461-850d68e15d00_unrelaxed_rank_001_alphafold2_multimer_v3_model_3_seed_000 (1).pdb /.envrc: -------------------------------------------------------------------------------- 1 | dotenv 2 | -------------------------------------------------------------------------------- /.github/pull_request_template.md: -------------------------------------------------------------------------------- 1 | ## What type of PR is this? 2 | _Remove the categories that do not apply_ 3 | 4 | - 🎮 Feature 5 | - 🐛 Bug Fix 6 | - 🍧 Refactor 7 | - 🔋 Optimization 8 | - 📓 Documentation Update 9 | 10 | ## Description 11 | 12 | _Please provide a brief description of the changes here. Include why they are needed, if applicable._ 13 | 14 | _Any demonstrations of the changes (Loom, gif, etc.) may also go here._ 15 | 16 | ## Related Tickets & Documents 17 | 18 | _Reference as needed._ 19 | 20 | ## Steps to Test 21 | 22 | _A list of steps a reviewer can walk through to test the changes._ 23 | 24 | ## Relevant GIF 25 | 26 | _Required 🐔_ 27 | -------------------------------------------------------------------------------- /LICENSE.md: -------------------------------------------------------------------------------- 1 | MIT License 2 | 3 | Copyright (c) 2023 LabDAO 4 | 5 | Permission is hereby granted, free of charge, to any person obtaining a copy 6 | of this software and associated documentation files (the "Software"), to deal 7 | in the Software without restriction, including without limitation the rights 8 | to use, copy, modify, merge, publish, distribute, sublicense, and/or sell 9 | copies of the Software, and to permit persons to whom the Software is 10 | furnished to do so, subject to the following conditions: 11 | 12 | The above copyright notice and this permission notice shall be included in all 13 | copies or substantial portions of the Software. 14 | 15 | THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR 16 | IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, 17 | FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE 18 | AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER 19 | LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, 20 | OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE 21 | SOFTWARE. 22 | -------------------------------------------------------------------------------- /LabBio_whitetext_transparent.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/LabBio_whitetext_transparent.png -------------------------------------------------------------------------------- /LabDAO_Logo_Teal.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/LabDAO_Logo_Teal.png -------------------------------------------------------------------------------- /checkpoint_0_event.csv: -------------------------------------------------------------------------------- 1 | cycle,proposal,factor1,factor2,dim1,dim2,pdbFileName 2 | 0,0,54.47722375392914,14.772933065891266,7.620224475860596,-13.13,design0_n0.pdb 3 | -------------------------------------------------------------------------------- /cmd/root.go: -------------------------------------------------------------------------------- 1 | package cmd 2 | 3 | import ( 4 | "fmt" 5 | "os" 6 | 7 | "github.com/spf13/cobra" 8 | ) 9 | 10 | var rootCmd = &cobra.Command{ 11 | Use: "plex", 12 | Short: "Plex is a CLI application for running scientific workflows on peer to peer compute", 13 | Long: `Plex is a CLI application for running scientific workflows on peer to peer compute. Complete documentation is available at https://docs.labdao.xyz/`, 14 | Run: func(cmd *cobra.Command, args []string) { 15 | dry := true 16 | upgradePlexVersion(dry) 17 | 18 | fmt.Println("Type ./plex --help to see commands") 19 | }, 20 | } 21 | 22 | func Execute() { 23 | if err := rootCmd.Execute(); err != nil { 24 | fmt.Println(err) 25 | os.Exit(1) 26 | } 27 | } 28 | -------------------------------------------------------------------------------- /cmd/web.go: -------------------------------------------------------------------------------- 1 | package cmd 2 | 3 | import ( 4 | "github.com/labdao/plex/gateway" 5 | "github.com/spf13/cobra" 6 | ) 7 | 8 | var webCmd = &cobra.Command{ 9 | Use: "web", 10 | Short: "Runs the Gateway web app", 11 | Long: `Runs the Gateway web app`, 12 | Run: func(cmd *cobra.Command, args []string) { 13 | dry := true 14 | upgradePlexVersion(dry) 15 | gateway.ServeWebApp() 16 | }, 17 | } 18 | 19 | func init() { 20 | rootCmd.AddCommand(webCmd) 21 | } 22 | -------------------------------------------------------------------------------- /contracts/README.md: -------------------------------------------------------------------------------- 1 | # LabDAO Contracts 2 | 3 | ProofOfScience contract on Optimism Sepolia: https://sepolia-optimism.etherscan.io/address/0x7336371ce024de5ba5fd80f53594fe518fb793ae -------------------------------------------------------------------------------- /contracts/artifacts/@openzeppelin/contracts/token/ERC1155/ERC1155.sol/ERC1155.dbg.json: -------------------------------------------------------------------------------- 1 | { 2 | "_format": "hh-sol-dbg-1", 3 | "buildInfo": "../../../../../build-info/d810985acf1840a84b239220ccd2e3e4.json" 4 | } 5 | -------------------------------------------------------------------------------- /contracts/artifacts/@openzeppelin/contracts/token/ERC1155/IERC1155.sol/IERC1155.dbg.json: -------------------------------------------------------------------------------- 1 | { 2 | "_format": "hh-sol-dbg-1", 3 | "buildInfo": "../../../../../build-info/d810985acf1840a84b239220ccd2e3e4.json" 4 | } 5 | -------------------------------------------------------------------------------- /contracts/artifacts/@openzeppelin/contracts/token/ERC1155/IERC1155Receiver.sol/IERC1155Receiver.dbg.json: -------------------------------------------------------------------------------- 1 | { 2 | "_format": "hh-sol-dbg-1", 3 | "buildInfo": "../../../../../build-info/d810985acf1840a84b239220ccd2e3e4.json" 4 | } 5 | -------------------------------------------------------------------------------- /contracts/artifacts/@openzeppelin/contracts/token/ERC1155/extensions/IERC1155MetadataURI.sol/IERC1155MetadataURI.dbg.json: -------------------------------------------------------------------------------- 1 | { 2 | "_format": "hh-sol-dbg-1", 3 | "buildInfo": "../../../../../../build-info/d810985acf1840a84b239220ccd2e3e4.json" 4 | } 5 | -------------------------------------------------------------------------------- /contracts/artifacts/@openzeppelin/contracts/utils/Context.sol/Context.dbg.json: -------------------------------------------------------------------------------- 1 | { 2 | "_format": "hh-sol-dbg-1", 3 | "buildInfo": "../../../../build-info/d810985acf1840a84b239220ccd2e3e4.json" 4 | } 5 | -------------------------------------------------------------------------------- /contracts/artifacts/@openzeppelin/contracts/utils/Context.sol/Context.json: -------------------------------------------------------------------------------- 1 | { 2 | "_format": "hh-sol-artifact-1", 3 | "contractName": "Context", 4 | "sourceName": "@openzeppelin/contracts/utils/Context.sol", 5 | "abi": [], 6 | "bytecode": "0x", 7 | "deployedBytecode": "0x", 8 | "linkReferences": {}, 9 | "deployedLinkReferences": {} 10 | } 11 | -------------------------------------------------------------------------------- /contracts/artifacts/@openzeppelin/contracts/utils/introspection/ERC165.sol/ERC165.dbg.json: -------------------------------------------------------------------------------- 1 | { 2 | "_format": "hh-sol-dbg-1", 3 | "buildInfo": "../../../../../build-info/d810985acf1840a84b239220ccd2e3e4.json" 4 | } 5 | -------------------------------------------------------------------------------- /contracts/artifacts/@openzeppelin/contracts/utils/introspection/ERC165.sol/ERC165.json: -------------------------------------------------------------------------------- 1 | { 2 | "_format": "hh-sol-artifact-1", 3 | "contractName": "ERC165", 4 | "sourceName": "@openzeppelin/contracts/utils/introspection/ERC165.sol", 5 | "abi": [ 6 | { 7 | "inputs": [ 8 | { 9 | "internalType": "bytes4", 10 | "name": "interfaceId", 11 | "type": "bytes4" 12 | } 13 | ], 14 | "name": "supportsInterface", 15 | "outputs": [ 16 | { 17 | "internalType": "bool", 18 | "name": "", 19 | "type": "bool" 20 | } 21 | ], 22 | "stateMutability": "view", 23 | "type": "function" 24 | } 25 | ], 26 | "bytecode": "0x", 27 | "deployedBytecode": "0x", 28 | "linkReferences": {}, 29 | "deployedLinkReferences": {} 30 | } 31 | -------------------------------------------------------------------------------- /contracts/artifacts/@openzeppelin/contracts/utils/introspection/IERC165.sol/IERC165.dbg.json: -------------------------------------------------------------------------------- 1 | { 2 | "_format": "hh-sol-dbg-1", 3 | "buildInfo": "../../../../../build-info/d810985acf1840a84b239220ccd2e3e4.json" 4 | } 5 | -------------------------------------------------------------------------------- /contracts/artifacts/@openzeppelin/contracts/utils/introspection/IERC165.sol/IERC165.json: -------------------------------------------------------------------------------- 1 | { 2 | "_format": "hh-sol-artifact-1", 3 | "contractName": "IERC165", 4 | "sourceName": "@openzeppelin/contracts/utils/introspection/IERC165.sol", 5 | "abi": [ 6 | { 7 | "inputs": [ 8 | { 9 | "internalType": "bytes4", 10 | "name": "interfaceId", 11 | "type": "bytes4" 12 | } 13 | ], 14 | "name": "supportsInterface", 15 | "outputs": [ 16 | { 17 | "internalType": "bool", 18 | "name": "", 19 | "type": "bool" 20 | } 21 | ], 22 | "stateMutability": "view", 23 | "type": "function" 24 | } 25 | ], 26 | "bytecode": "0x", 27 | "deployedBytecode": "0x", 28 | "linkReferences": {}, 29 | "deployedLinkReferences": {} 30 | } 31 | -------------------------------------------------------------------------------- /contracts/artifacts/contracts/ProofOfScience.sol/ProofOfScience.dbg.json: -------------------------------------------------------------------------------- 1 | { 2 | "_format": "hh-sol-dbg-1", 3 | "buildInfo": "../../build-info/d810985acf1840a84b239220ccd2e3e4.json" 4 | } 5 | -------------------------------------------------------------------------------- /contracts/hardhat.config.js: -------------------------------------------------------------------------------- 1 | require("@nomicfoundation/hardhat-toolbox"); 2 | require('dotenv').config(); 3 | 4 | /** @type import('hardhat/config').HardhatUserConfig */ 5 | 6 | const ALCHEMY_API_KEY = process.env.ALCHEMY_API_KEY; 7 | const WALLET_PRIVATE_KEY = process.env.WALLET_PRIVATE_KEY; 8 | const OPTIMISM_BLOCK_EXPLORER_API_KEY = process.env.OPTIMISM_BLOCK_EXPLORER_API_KEY; 9 | 10 | module.exports = { 11 | solidity: "0.8.20", 12 | networks: { 13 | 'optimism-sepolia': { 14 | url: `https://opt-sepolia.g.alchemy.com/v2/${ALCHEMY_API_KEY}`, 15 | accounts: [WALLET_PRIVATE_KEY], 16 | } 17 | }, 18 | etherscan: { 19 | apiKey: OPTIMISM_BLOCK_EXPLORER_API_KEY, 20 | customChains: [ 21 | { 22 | network: 'optimism-sepolia', 23 | chainId: 11155420, 24 | urls: { 25 | apiURL: 'https://api-sepolia-optimistic.etherscan.io/api', 26 | } 27 | } 28 | ] 29 | } 30 | }; 31 | -------------------------------------------------------------------------------- /contracts/ignition/modules/ProofOfScience.js: -------------------------------------------------------------------------------- 1 | const { buildModule } = require("@nomicfoundation/hardhat-ignition/modules"); 2 | 3 | module.exports = buildModule("ProofOfScience", (m) => { 4 | const proofOfScience = m.contract("ProofOfScience", []); 5 | return { proofOfScience }; 6 | }); -------------------------------------------------------------------------------- /contracts/package.json: -------------------------------------------------------------------------------- 1 | { 2 | "name": "hardhat-project", 3 | "devDependencies": { 4 | "@nomicfoundation/hardhat-toolbox": "^5.0.0", 5 | "hardhat": "^2.22.2" 6 | }, 7 | "dependencies": { 8 | "@a16z/contracts": "^0.0.9", 9 | "@openzeppelin/contracts": "^5.0.2", 10 | "dotenv": "^16.4.5" 11 | } 12 | } 13 | -------------------------------------------------------------------------------- /docker-compose-gpu.yml: -------------------------------------------------------------------------------- 1 | # Minimal compose for gpu setup 2 | # To bring up network in gpu mode use: 3 | # docker compose -f docker-compose.yml -f docker-compose-gpu.yml up -d --wait --build 4 | 5 | --- 6 | 7 | services: 8 | compute: 9 | deploy: 10 | resources: 11 | reservations: 12 | devices: 13 | - driver: nvidia 14 | count: 1 15 | capabilities: [gpu] 16 | -------------------------------------------------------------------------------- /docker-compose.private.yml: -------------------------------------------------------------------------------- 1 | # Minimal compose for private setup 2 | # To bring up network in private mode use: 3 | # docker-compose -f docker-compose.yml -f docker-compose-private.yml up -d 4 | 5 | --- 6 | 7 | services: 8 | ipfs: 9 | environment: 10 | IPFS_S3_ENABLED: "false" 11 | IPFS_SWARM_KEY_BASE64: "L2tleS9zd2FybS9wc2svMS4wLjAvCi9iYXNlMTYvCjk0Y2Y4ODFiMDZmZDI5YTgxNDVlMmY2MjNiMmRjNGMwNTU2Y2QxNTIwNWM4YjhjMzg0YWEzOThkY2U4YWFhMzYK" 12 | PRIVATE_IPFS: "true" 13 | LIBP2P_FORCE_PNET: "1" 14 | IPFS_DEBUG: "true" 15 | IPFS_LOGGING: "debug" 16 | IPFS_GATEWAY_PORT: "8888" 17 | volumes: 18 | - private-ipfs:/data/ipfs 19 | 20 | volumes: 21 | private-ipfs: 22 | -------------------------------------------------------------------------------- /docker/images/bacalhau/Dockerfile: -------------------------------------------------------------------------------- 1 | # syntax=docker/dockerfile:1.4 2 | # Pinned to 1.20 3 | FROM golang:1.20 as build 4 | 5 | # Release tag. Used to build the binary and tag the version. 6 | ARG BACALHAU_VERSION=v1.2.0 7 | ARG TAG 8 | 9 | RUN apt-get update && apt-get -y --no-install-recommends install nodejs npm 10 | 11 | RUN git clone https://github.com/bacalhau-project/bacalhau.git /work 12 | 13 | WORKDIR /work 14 | 15 | RUN git checkout ${BACALHAU_VERSION} 16 | RUN make build-bacalhau 17 | RUN find ./bin -name 'bacalhau' -exec mv -t ./bin {} + 18 | 19 | FROM cgr.dev/chainguard/nvidia-device-plugin 20 | COPY --from=build /work/bin/bacalhau /usr/local/bin/bacalhau 21 | ENV PATH="/usr/local/bin:/usr/bin" 22 | ENTRYPOINT ["bacalhau"] 23 | LABEL org.opencontainers.image.source https://github.com/bacalhau-project/bacalhau 24 | LABEL org.opencontainers.image.title "Bacalhau" 25 | LABEL org.opencontainers.image.description "The Bacalhau network provices decentralised compute for compute over data. See https://bacalhau.org for more info." 26 | LABEL org.opencontainers.image.licenses Apache-2.0 27 | LABEL org.opencontainers.image.url https://bacalhau.org 28 | -------------------------------------------------------------------------------- /docker/images/ipfs/README.md: -------------------------------------------------------------------------------- 1 | Copied mostly from https://github.com/ipfs/go-ds-s3/tree/master/docker 2 | -------------------------------------------------------------------------------- /docker/images/ipfs/container-init.d/001-custom-config.sh: -------------------------------------------------------------------------------- 1 | #!/bin/bash 2 | set -e 3 | 4 | if [ "${IPFS_DEBUG}" == "true" ]; then 5 | set -x 6 | fi 7 | 8 | ipfs config --json API.HTTPHeaders.Access-Control-Allow-Methods '["PUT", "POST", "GET"]' 9 | ipfs config Pinning.Recursive true 10 | ipfs config --json Swarm.RelayClient.Enabled false 11 | -------------------------------------------------------------------------------- /docker/images/ipfs/container-init.d/003-bootstrap-rm.sh: -------------------------------------------------------------------------------- 1 | #!/bin/bash 2 | set -e 3 | 4 | if [ "${IPFS_DEBUG}" == "true" ]; then 5 | set -x 6 | fi 7 | 8 | if [ "${PRIVATE_IPFS}" == "true" ]; then 9 | echo "Running in private mode, removing bootstrap" 10 | ipfs bootstrap rm --all 11 | fi 12 | -------------------------------------------------------------------------------- /docker/images/ipfs/container-init.d/004-swarm-base64-key.sh: -------------------------------------------------------------------------------- 1 | #!/bin/bash 2 | 3 | set -e 4 | user=ipfs 5 | repo="$IPFS_PATH" 6 | 7 | if [ "${IPFS_DEBUG}" == "true" ]; then 8 | set -x 9 | fi 10 | 11 | 12 | # Set up the swarm key, if provided 13 | SWARM_KEY_FILE="$repo/swarm.key" 14 | SWARM_KEY_PERM=0600 15 | 16 | # Create a swarm key from a given environment variable 17 | ls -ltra "$SWARM_KEY_FILE" || true 18 | 19 | if [ -n "$IPFS_SWARM_KEY_BASE64" ] && [ "${PRIVATE_IPFS}" == "true" ]; then 20 | echo "Copying swarm key from variable IPFS_SWARM_KEY_BASE64..." 21 | echo "$IPFS_SWARM_KEY_BASE64" | base64 -d >"$SWARM_KEY_FILE" || exit 1 22 | chmod $SWARM_KEY_PERM "$SWARM_KEY_FILE" 23 | fi 24 | -------------------------------------------------------------------------------- /docker/images/ipfs/container-init.d/005-gateway-port.sh: -------------------------------------------------------------------------------- 1 | #!/bin/bash 2 | set -e 3 | 4 | if [ "${IPFS_DEBUG}" == "true" ]; then 5 | set -x 6 | fi 7 | 8 | if [ -n "${IPFS_GATEWAY_PORT}" ]; then 9 | ipfs config Addresses.Gateway /ip4/0.0.0.0/tcp/"${IPFS_GATEWAY_PORT}" 10 | fi 11 | -------------------------------------------------------------------------------- /docker/images/ipfs/container-init.d/006-datastore.sh: -------------------------------------------------------------------------------- 1 | #!/bin/bash 2 | set -e 3 | 4 | if [ "${IPFS_DEBUG}" == "true" ]; then 5 | set -x 6 | fi 7 | 8 | if [ -n "${IPFS_DATASTORE_STORAGEMAX}" ]; then 9 | ipfs config Datastore.StorageMax "${IPFS_DATASTORE_STORAGEMAX}" 10 | fi 11 | 12 | if [ -n "${IPFS_DATASTORE_STORAGEGCWATERMARK}" ]; then 13 | ipfs config Datastore.StorageGCWatermark "${IPFS_DATASTORE_STORAGEGCWATERMARK}" 14 | fi 15 | 16 | if [ -n "${IPFS_DATASTORE_GCPERIOD}" ]; then 17 | ipfs config Datastore.GCPeriod "${IPFS_DATASTORE_GCPERIOD}" 18 | fi 19 | -------------------------------------------------------------------------------- /docker/images/ipfs/container-init.d/007-remote-pinning-service.sh: -------------------------------------------------------------------------------- 1 | #!/bin/bash 2 | # Script to add remote pinning service 3 | # required args: 4 | # IPFS_ADD_REMOTE_PINNING_SERVICE=true/false 5 | # IPFS_REMOTE_PINNING_SERVICE_NAME=userfiendlyname 6 | # IPFS_REMOTE_PINNING_SERVICE_ENDPOINT=endpointurl 7 | # IPFS_REMOTE_PINNING_SERVICE_ACCESS_TOKEN=accesstoken 8 | 9 | set -e 10 | 11 | if [ "${IPFS_DEBUG}" == "true" ]; then 12 | set -x 13 | fi 14 | 15 | if [ "${IPFS_ADD_REMOTE_PINNING_SERVICE}" == "true" ]; then 16 | ipfs pin remote service add ${IPFS_REMOTE_PINNING_SERVICE_NAME} ${IPFS_REMOTE_PINNING_SERVICE_ENDPOINT} ${IPFS_REMOTE_PINNING_SERVICE_ACCESS_TOKEN} 17 | fi 18 | -------------------------------------------------------------------------------- /docker/images/ipfs/container-init.d/999-debug-config.sh: -------------------------------------------------------------------------------- 1 | #!/bin/bash 2 | set -e 3 | 4 | if [ "${IPFS_DEBUG}" == "true" ]; then 5 | set -x 6 | echo "Dumping env" 7 | env 8 | cat /data/ipfs/config 9 | ls -ltra /data/ipfs/repo.lock || true 10 | fi 11 | -------------------------------------------------------------------------------- /docker/ipfs_data/datastore_spec: -------------------------------------------------------------------------------- 1 | {"mounts":[{"mountpoint":"/blocks","path":"blocks","shardFunc":"/repo/flatfs/shard/v1/next-to-last/2","type":"flatfs"},{"mountpoint":"/","path":"datastore","type":"levelds"}],"type":"mount"} -------------------------------------------------------------------------------- /docker/ipfs_data/swarm.key: -------------------------------------------------------------------------------- 1 | /key/swarm/psk/1.0.0/ 2 | /base16/ 3 | 94cf881b06fd29a8145e2f623b2dc4c0556cd15205c8b8c384aa398dce8aaa36 4 | -------------------------------------------------------------------------------- /docs/babel.config.js: -------------------------------------------------------------------------------- 1 | module.exports = { 2 | presets: [require.resolve('@docusaurus/core/lib/babel/preset')], 3 | }; 4 | -------------------------------------------------------------------------------- /docs/docs/reference/api.md: -------------------------------------------------------------------------------- 1 | --- 2 | title: API Reference 3 | description: API Reference 4 | sidebar_label: API 5 | sidebar_position: 1 6 | slug: /reference/api 7 | --- 8 | 9 | OpenAPI 3.0 documentation coming soon! -------------------------------------------------------------------------------- /docs/docs/reference/python.md: -------------------------------------------------------------------------------- 1 | --- 2 | title: Python Reference 3 | description: Python Reference 4 | sidebar_label: Python 5 | sidebar_position: 2 6 | slug: /reference/python 7 | --- 8 | 9 | Python library coming soon! -------------------------------------------------------------------------------- /docs/docs/tutorials/tutorials.md: -------------------------------------------------------------------------------- 1 | --- 2 | title: Drug Discovery Tutorials 3 | description: Lab.Bio Tutorials 4 | sidebar_label: Tutorials 5 | slug: / 6 | --- 7 | 8 | [Lab.Bio](https://lab.bio/) tutorials coming soon! 9 | 10 | For tutorial requests, please [open an issue](https://github.com/labdao/plex/issues/new?labels=tools&title=Tutorial+Request&body=%23%23+Tutorial+Request%0A%0A---%0A%0A%23%23%23+Describe+the+tutorial+you%27d+like%3A%0A%28Your+description+here%29%0A%0A---%0A%0A%23%23%23+Computational+biology+tools+involved%3A%0A%28List+any+specific+computational+biology+tools+that+are+involved+in+this+tutorial%29%0A%0A---%0A%0A%23%23%23+Additional+context+or+information%3A%0A%28Any+extra+information+here%29%0A) on GitHub. -------------------------------------------------------------------------------- /docs/package.json: -------------------------------------------------------------------------------- 1 | { 2 | "name": "labdao-docs", 3 | "version": "0.0.0", 4 | "private": true, 5 | "scripts": { 6 | "docusaurus": "docusaurus", 7 | "start": "docusaurus start", 8 | "build": "docusaurus build", 9 | "swizzle": "docusaurus swizzle", 10 | "deploy": "docusaurus deploy", 11 | "clear": "docusaurus clear", 12 | "serve": "docusaurus serve", 13 | "write-translations": "docusaurus write-translations", 14 | "write-heading-ids": "docusaurus write-heading-ids", 15 | "typecheck": "tsc" 16 | }, 17 | "dependencies": { 18 | "@docsearch/js": "3", 19 | "@docusaurus/core": "2.0.0-beta.18", 20 | "@docusaurus/preset-classic": "2.0.0-beta.18", 21 | "@mdx-js/react": "^1.6.22", 22 | "clsx": "^1.1.1", 23 | "lodash": "^4.17.21", 24 | "mdx-mermaid": "^v1.3.0", 25 | "mermaid": "^9.1.7", 26 | "prism-react-renderer": "^1.3.1", 27 | "react": "^17.0.2", 28 | "react-dom": "^17.0.2" 29 | }, 30 | "devDependencies": { 31 | "@docusaurus/module-type-aliases": "2.0.0-beta.18", 32 | "@tsconfig/docusaurus": "^1.0.5", 33 | "asciinema-player": "^3.0.0-rc.1", 34 | "typescript": "^4.6.3" 35 | }, 36 | "browserslist": { 37 | "production": [ 38 | ">0.5%", 39 | "not dead", 40 | "not op_mini all" 41 | ], 42 | "development": [ 43 | "last 1 chrome version", 44 | "last 1 firefox version", 45 | "last 1 safari version" 46 | ] 47 | } 48 | } 49 | -------------------------------------------------------------------------------- /docs/scripts/ascicast-commands.txt: -------------------------------------------------------------------------------- 1 | ls 2 | ./plex create -t tools/equibind.json -i testdata/binding/abl/ --autoRun=true 3 | ./plex -tool equibind -input-dir testdata/binding/pdbind_processed_size1 4 | ./plex -tool equibind -input-dir testdata/binding/pdbind_processed_size2 5 | ./plex -tool colabfold-mini -input-dir testdata/folding -gpu=true -network=true 6 | ./plex -tool oddt -input-dir testdata/scoring/abl -------------------------------------------------------------------------------- /docs/scripts/create_ascicast.sh: -------------------------------------------------------------------------------- 1 | #!/bin/bash 2 | # run inside container image with asciinema installed 3 | 4 | # File containing the list of CLI commands to record 5 | commands_file="scripts/ascicast-commands.txt" 6 | 7 | # Display the commands in the file 8 | while IFS= read -r cmd; do 9 | echo "Command: $cmd" 10 | done < "$commands_file" 11 | 12 | # Read commands from the file into an array 13 | commands=() 14 | while IFS= read -r cmd; do 15 | commands+=("$cmd") 16 | done < "$commands_file" 17 | 18 | # Loop through the commands array and create a recording for each one 19 | for cmd in "${commands[@]}"; do 20 | # Create a unique filename for each recording 21 | filename="$(echo "$cmd" | tr -d '[:space:]/' | tr -cd '[:alnum:]._-').cast" 22 | 23 | # Create a script to simulate typing the command character by character 24 | typed_cmd_script="tmp.sh" 25 | echo "#!/bin/bash" > "$typed_cmd_script" 26 | for ((i=0; i<${#cmd}; i++)); do 27 | echo "printf '%s' '${cmd:$i:1}'" >> "$typed_cmd_script" 28 | echo "sleep 0.1" >> "$typed_cmd_script" 29 | done 30 | echo "printf '\n'" >> "$typed_cmd_script" 31 | echo "$cmd" >> "$typed_cmd_script" 32 | echo "exit" >> "$typed_cmd_script" 33 | chmod +x "$typed_cmd_script" 34 | 35 | # Start the recording, execute the command, and then exit the shell 36 | asciinema rec -c "bash $typed_cmd_script" $filename -y -i 2 --overwrite 37 | 38 | # Cleanup the temporary script 39 | rm -f "$typed_cmd_script" 40 | done -------------------------------------------------------------------------------- /docs/scripts/find_unused_images.py: -------------------------------------------------------------------------------- 1 | import os 2 | import re 3 | 4 | def main(): 5 | content_dirs = ['docs'] # Add other content directories if needed 6 | 7 | used_images = set() 8 | 9 | for content_dir in content_dirs: 10 | for root, _, files in os.walk(content_dir): 11 | md_files = [file for file in files if file.endswith(('.md', '.mdx'))] 12 | png_files = [file for file in files if file.endswith('.png')] 13 | 14 | if md_files: 15 | for md_file in md_files: 16 | with open(os.path.join(root, md_file), 'r') as content_file: 17 | content = content_file.read() 18 | used_images.update(re.findall(r'!\[.*?\]\((.*?)\)', content)) 19 | 20 | unused_images = [os.path.join(root, png) for png in png_files if png not in used_images] 21 | 22 | if unused_images: 23 | print(f'Unused images in {root}:') 24 | for img in unused_images: 25 | print(img) 26 | print() 27 | 28 | if not used_images: 29 | print('No unused images found.') 30 | 31 | if __name__ == '__main__': 32 | main() -------------------------------------------------------------------------------- /docs/sidebars.js: -------------------------------------------------------------------------------- 1 | // @ts-check 2 | 3 | const { readdirSync } = require('fs'); 4 | const capitalize = require('lodash/capitalize'); 5 | 6 | /** @type {import('@docusaurus/plugin-content-docs').SidebarsConfig} */ 7 | const sidebars = { 8 | tutorialSidebar: [ 9 | { 10 | type: 'doc', 11 | id: 'tutorials/tutorials', 12 | label: 'Tutorials', 13 | }, 14 | { 15 | type: 'category', 16 | label: 'Reference', 17 | collapsed: false, 18 | items: [ 19 | { 20 | type: 'autogenerated', 21 | dirName: 'reference', 22 | }, 23 | ], 24 | }, 25 | ], 26 | }; 27 | 28 | module.exports = sidebars; -------------------------------------------------------------------------------- /docs/src/components/AsciinemaPlayer.js: -------------------------------------------------------------------------------- 1 | import BrowserOnly from '@docusaurus/BrowserOnly'; 2 | import React, { useEffect, useRef } from 'react'; 3 | import 'asciinema-player/dist/bundle/asciinema-player.css'; 4 | 5 | const AsciinemaWidget = ({ src, ...asciinemaOptions}) => { 6 | return ( 7 | Loading asciinema cast...}> 8 | {() => { 9 | const AsciinemaPlayer = require('asciinema-player'); 10 | const ref = useRef(null); 11 | 12 | useEffect(() => { 13 | AsciinemaPlayer.create(src, ref.current, asciinemaOptions); 14 | }, [src]); 15 | 16 | return
; 17 | }} 18 | 19 | ); 20 | }; 21 | 22 | export default AsciinemaWidget; -------------------------------------------------------------------------------- /docs/src/components/OpenInColab.js: -------------------------------------------------------------------------------- 1 | import React from 'react'; 2 | 3 | const OpenInColab = ({ link }) => ( 4 | 5 | Open In Colab 6 | 7 | ); 8 | 9 | export default OpenInColab; -------------------------------------------------------------------------------- /docs/static/.nojekyll: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/docs/static/.nojekyll -------------------------------------------------------------------------------- /docs/static/img/LabDAO_Favicon_Teal.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/docs/static/img/LabDAO_Favicon_Teal.png -------------------------------------------------------------------------------- /docs/static/img/favicon.ico: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/docs/static/img/favicon.ico -------------------------------------------------------------------------------- /docs/static/img/labdao-icon.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/docs/static/img/labdao-icon.png -------------------------------------------------------------------------------- /docs/static/img/labdaologo_brandmark_Teal.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/docs/static/img/labdaologo_brandmark_Teal.png -------------------------------------------------------------------------------- /docs/static/img/protein-folding-graphic.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/docs/static/img/protein-folding-graphic.png -------------------------------------------------------------------------------- /docs/static/img/small-molecule-binding-graphic.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/docs/static/img/small-molecule-binding-graphic.png -------------------------------------------------------------------------------- /docs/tsconfig.json: -------------------------------------------------------------------------------- 1 | { 2 | // This file is not used in compilation. It is here just for a nice editor experience. 3 | "extends": "@tsconfig/docusaurus/tsconfig.json", 4 | "compilerOptions": { 5 | "baseUrl": "." 6 | } 7 | } 8 | -------------------------------------------------------------------------------- /frontend/.dockerignore: -------------------------------------------------------------------------------- 1 | # See https://help.github.com/articles/ignoring-files/ for more about ignoring files. 2 | 3 | # dependencies 4 | /node_modules 5 | /.pnp 6 | .pnp.js 7 | 8 | # testing 9 | /coverage 10 | 11 | # next.js 12 | /.next/ 13 | /out/ 14 | 15 | # production 16 | /build 17 | 18 | # misc 19 | .DS_Store 20 | *.pem 21 | 22 | # debug 23 | npm-debug.log* 24 | yarn-debug.log* 25 | yarn-error.log* 26 | 27 | # local env files 28 | .env*.local 29 | 30 | # vercel 31 | .vercel 32 | 33 | # typescript 34 | *.tsbuildinfo 35 | next-env.d.ts 36 | -------------------------------------------------------------------------------- /frontend/.eslintrc.json: -------------------------------------------------------------------------------- 1 | { 2 | "extends": "next", 3 | "plugins": ["simple-import-sort"], 4 | "rules": { 5 | "simple-import-sort/imports": "warn", 6 | "simple-import-sort/exports": "warn", 7 | "react-hooks/exhaustive-deps": "error" 8 | } 9 | } 10 | -------------------------------------------------------------------------------- /frontend/.gitignore: -------------------------------------------------------------------------------- 1 | # See https://help.github.com/articles/ignoring-files/ for more about ignoring files. 2 | 3 | # dependencies 4 | /node_modules 5 | /.pnp 6 | .pnp.js 7 | 8 | # testing 9 | /coverage 10 | 11 | # next.js 12 | /.next/ 13 | /out/ 14 | 15 | # production 16 | /build 17 | 18 | # misc 19 | .DS_Store 20 | *.pem 21 | .vscode 22 | 23 | # debug 24 | npm-debug.log* 25 | yarn-debug.log* 26 | yarn-error.log* 27 | 28 | # local env files 29 | .env*.local 30 | 31 | # vercel 32 | .vercel 33 | 34 | # typescript 35 | *.tsbuildinfo 36 | next-env.d.ts 37 | -------------------------------------------------------------------------------- /frontend/README.md: -------------------------------------------------------------------------------- 1 | # Plex Frontend 2 | 3 | ## Get Started 4 | 5 | ```bash 6 | npm install && npm run dev 7 | ``` 8 | 9 | ## Add a Component 10 | 11 | Missing a component? Find it here: [shadcn/ui components](https://ui.shadcn.com/docs/components) 12 | Follow the instructions for installing via the CLI. 13 | 14 | ## Data Tables 15 | 16 | Tables use the [react-table](https://react-table.tanstack.com/) library. Good examples on integrating with shadcn can be found here: [shadcn/ui data-table](https://ui.shadcn.com/docs/components/data-table) 17 | 18 | ## Useful Docs 19 | 20 | - [Tailwind CSS](https://tailwindcss.com/docs) 21 | - [shadcn/ui](https://ui.shadcn.com/docs) 22 | - [react-table](https://react-table.tanstack.com/) 23 | - [Lucide Icons](https://lucide.dev/icons/) 24 | - [Next.js](https://nextjs.org/docs/getting-started) 25 | -------------------------------------------------------------------------------- /frontend/app/(auth)/login/page.tsx: -------------------------------------------------------------------------------- 1 | "use client"; 2 | 3 | import { usePrivy } from "@privy-io/react-auth"; 4 | import { LockIcon } from "lucide-react"; 5 | import { useRouter } from "next/navigation"; 6 | 7 | import PrivyLoginButton from "@/components/auth/PrivyLoginButton"; 8 | import { PageLoader } from "@/components/shared/PageLoader"; 9 | import { Button } from "@/components/ui/button"; 10 | 11 | export default function LoginPage() { 12 | const { ready, authenticated } = usePrivy(); 13 | const router = useRouter(); 14 | 15 | if (authenticated) { 16 | router.push("/"); 17 | } 18 | 19 | return ready && !authenticated ? ( 20 |
21 |
22 | 23 |

Log In to Your Lab.Bio Account

24 | Log In 25 |
26 |
27 | ) : ( 28 | 29 | ); 30 | } 31 | -------------------------------------------------------------------------------- /frontend/app/(resources)/infrastructure/page.tsx: -------------------------------------------------------------------------------- 1 | import React from "react"; 2 | 3 | export default function InfrastructurePage() { 4 | return
ToDo: Add Public Architecture Diagram
; 5 | } 6 | -------------------------------------------------------------------------------- /frontend/app/(resources)/philosophy/page.tsx: -------------------------------------------------------------------------------- 1 | import React from "react"; 2 | 3 | export default function PhilosophyPage() { 4 | return ( 5 |
6 |

Axioms

7 |
    8 |
  1. 9 | Network innovation produces value 10 |

    This is why we build Internet native interfaces

    11 |
    2. 12 |
  2. 13 | Permissionless Increases Creativity 14 |

    This is why we write open source software

    15 |
    3. 16 |
  3. 17 | Reproducibility increases network growth 18 |

    This is why we use content identified storage

    19 |
    4. 20 |
  4. 21 | Fork-ability minimizes gatekeeping 22 |

    This why we support decentralized infrastructure

    23 |
    5. 24 |
  5. 25 | Accessibility increases community 26 |

    This is why provide educational material

    27 |
    6. 28 |
29 |
30 | ); 31 | } 32 | -------------------------------------------------------------------------------- /frontend/app/api/identity-count/route.ts: -------------------------------------------------------------------------------- 1 | /* Core */ 2 | import { NextResponse } from 'next/server' 3 | 4 | export async function POST(req: Request, res: Response) { 5 | const body = await req.json() 6 | const { amount = 1 } = body 7 | 8 | // simulate IO latency 9 | await new Promise((r) => setTimeout(r, 500)) 10 | 11 | return NextResponse.json({ data: amount }) 12 | } 13 | -------------------------------------------------------------------------------- /frontend/app/experiments/(experiment)/(forms)/ContinuousSwitch.tsx: -------------------------------------------------------------------------------- 1 | import { Badge } from "@/components/ui/badge"; 2 | import { FormControl, FormDescription, FormLabel } from "@/components/ui/form"; 3 | import { Switch } from "@/components/ui/switch"; 4 | 5 | export default function ContinuousSwitch() { 6 | return ( 7 |
8 | 9 | 10 | 11 |
12 | 13 | continuous run Coming soon! 14 | 15 | continuously generate datapoints with the current sequence inputs. tURN OFF OR EDIT INPUT TO CANCEL. 16 |
17 |
18 | ); 19 | } 20 | -------------------------------------------------------------------------------- /frontend/app/experiments/(experiment)/ExperimentUIContext.tsx: -------------------------------------------------------------------------------- 1 | import { createContext, useState } from "react"; 2 | 3 | interface ExperimentUIContextType { 4 | activeJobUUID: string | undefined; 5 | setActiveJobUUID: React.Dispatch>; 6 | activeCheckpointUrl: string | undefined; 7 | setActiveCheckpointUrl: React.Dispatch>; 8 | modelPanelOpen: boolean; 9 | setModelPanelOpen: React.Dispatch>; 10 | } 11 | export const ExperimentUIContext = createContext({} as ExperimentUIContextType); 12 | export function ExperimentUIContextProvider({ children }: { children: React.ReactNode }) { 13 | const [activeJobUUID, setActiveJobUUID] = useState(undefined); 14 | const [activeCheckpointUrl, setActiveCheckpointUrl] = useState(undefined); 15 | const [modelPanelOpen, setModelPanelOpen] = useState(false); 16 | 17 | return ( 18 | 28 | {children} 29 | 30 | ); 31 | } 32 | -------------------------------------------------------------------------------- /frontend/app/experiments/(experiment)/[experimentID]/ExperimentShare.tsx: -------------------------------------------------------------------------------- 1 | import { Share2 } from 'lucide-react'; 2 | import React, { useState } from 'react'; 3 | 4 | import { Button } from "@/components/ui/button"; 5 | import { Tooltip, TooltipContent, TooltipProvider, TooltipTrigger } from "@/components/ui/tooltip"; 6 | 7 | const ExperimentShare = ({ experimentID }: { experimentID: string }) => { 8 | const [copied, setCopied] = useState(false); 9 | const currentPageLink = `${process.env.NEXT_PUBLIC_FRONTEND_URL}/experiments/${experimentID}`; 10 | 11 | const copyLinkToClipboard = async () => { 12 | await navigator.clipboard.writeText(currentPageLink); 13 | setCopied(true); 14 | setTimeout(() => { 15 | setCopied(false); 16 | }, 2000); 17 | }; 18 | 19 | return ( 20 | 21 | 22 | 23 | 26 | 27 | Copied! 28 | 29 | 30 | ); 31 | }; 32 | 33 | export default ExperimentShare; -------------------------------------------------------------------------------- /frontend/app/experiments/(experiment)/layout.tsx: -------------------------------------------------------------------------------- 1 | "use client"; 2 | 3 | import React, { ReactNode } from "react"; 4 | 5 | import { ExperimentUIContextProvider } from "./ExperimentUIContext"; 6 | 7 | type LayoutProps = { 8 | children: ReactNode; 9 | }; 10 | 11 | export default function Layout({ children }: LayoutProps) { 12 | return ( 13 | 14 |
{children}
15 | 16 | ); 17 | } 18 | -------------------------------------------------------------------------------- /frontend/app/models/default.tsx: -------------------------------------------------------------------------------- 1 | export default function Default() { 2 | return null; 3 | } 4 | -------------------------------------------------------------------------------- /frontend/app/models/layout.tsx: -------------------------------------------------------------------------------- 1 | import React, { ReactNode } from "react"; 2 | 3 | import { Breadcrumbs } from "@/components/global/Breadcrumbs"; 4 | 5 | type LayoutProps = { 6 | children: ReactNode; 7 | list: any; 8 | add: any; 9 | }; 10 | 11 | export default async function Layout({ children, list, add }: LayoutProps) { 12 | return ( 13 |
14 | {add}
} /> 15 | {list} 16 | {children} 17 |
18 | ); 19 | } 20 | -------------------------------------------------------------------------------- /frontend/app/not-found.tsx: -------------------------------------------------------------------------------- 1 | export default function NotFound() { 2 | return ( 3 |
4 |

Not Found

5 |
6 | ); 7 | } 8 | -------------------------------------------------------------------------------- /frontend/app/page.tsx: -------------------------------------------------------------------------------- 1 | export default function IndexPage() { 2 | return null; // We redirect to the model list in next.config 3 | } 4 | -------------------------------------------------------------------------------- /frontend/app/tasks/TaskCard.tsx: -------------------------------------------------------------------------------- 1 | import Image from "next/image"; 2 | import Link from "next/link"; 3 | import { ReactNode } from "react"; 4 | 5 | import { Badge } from "@/components/ui/badge"; 6 | import { Card, CardContent, CardTitle } from "@/components/ui/card"; 7 | 8 | const CardWithHref = ({ href, children }: { href: string | undefined; children: ReactNode }) => 9 | href ? ( 10 | 11 | {children} 12 | 13 | ) : ( 14 | 15 |
16 | 17 | Coming soon 18 | 19 |
20 | {children} 21 | 22 | ); 23 | 24 | export default function TaskCard({ name, slug, available }: { name: string; slug: string; available: boolean }) { 25 | return ( 26 | 27 |
28 | 29 | {name} 30 | 31 | {name} 32 |
33 | 34 | ); 35 | } 36 | -------------------------------------------------------------------------------- /frontend/app/tasks/TasksMenu.tsx: -------------------------------------------------------------------------------- 1 | "use client"; 2 | 3 | import { DropdownMenuContentProps } from "@radix-ui/react-dropdown-menu"; 4 | import Link from "next/link"; 5 | import React from "react"; 6 | 7 | import { tasks } from "@/app/tasks/taskList"; 8 | import { Badge } from "@/components/ui/badge"; 9 | import { DropdownMenu, DropdownMenuContent, DropdownMenuItem, DropdownMenuTrigger } from "@/components/ui/dropdown-menu"; 10 | 11 | interface TasksMenuProps { 12 | trigger: React.ReactNode; 13 | dropdownMenuContentProps?: DropdownMenuContentProps; 14 | } 15 | 16 | export default function TasksMenu({ dropdownMenuContentProps, trigger }: TasksMenuProps) { 17 | return ( 18 | <> 19 | 20 | {trigger} 21 | 22 | {tasks.map((task) => ( 23 | 24 | 25 | {task.name} 26 | {!task.available && ( 27 | 28 | Coming soon 29 | 30 | )} 31 | 32 | 33 | ))} 34 | 35 | 36 | 37 | ); 38 | } 39 | -------------------------------------------------------------------------------- /frontend/app/tasks/page.tsx: -------------------------------------------------------------------------------- 1 | import { PlusIcon } from "lucide-react"; 2 | import Link from "next/link"; 3 | 4 | import { Breadcrumbs } from "@/components/global/Breadcrumbs"; 5 | import { Card, CardContent } from "@/components/ui/card"; 6 | 7 | import TaskCard from "./TaskCard"; 8 | import { tasks } from "./taskList"; 9 | 10 | export default function TaskList() { 11 | return ( 12 | <> 13 | 14 |
15 |

Select a task to get started

16 |
17 | {tasks.map((task) => ( 18 | 19 | ))} 20 | 21 | 22 | 23 | 24 | Suggest a task 25 | 26 | 27 | 28 |
29 |
30 | 31 | ); 32 | } 33 | -------------------------------------------------------------------------------- /frontend/app/tasks/taskList.ts: -------------------------------------------------------------------------------- 1 | // These could eventually be fetched from the backend, but for now are hardcoded 2 | // Adding a task? Add it's image to /public/images with filename task-.png 3 | 4 | export const tasks = [ 5 | { 6 | name: "Protein Binder Design", 7 | slug: "protein-binder-design", 8 | available: true, 9 | }, 10 | // { 11 | // // set to true for testing story LAB-1166 12 | // name: "Protein Folding", 13 | // slug: "protein-folding", 14 | // available: true, 15 | // }, 16 | // { 17 | // name: "Protein Docking", 18 | // slug: "protein-docking", 19 | // available: false, 20 | // }, 21 | // { 22 | // name: "Small Molecule Docking", 23 | // slug: "small-molecule-docking", 24 | // available: false, 25 | // }, 26 | { 27 | name: "Community Models", 28 | slug: "community-models", 29 | available: true, 30 | }, 31 | ]; 32 | -------------------------------------------------------------------------------- /frontend/components.json: -------------------------------------------------------------------------------- 1 | { 2 | "$schema": "https://ui.shadcn.com/schema.json", 3 | "style": "default", 4 | "rsc": true, 5 | "tsx": true, 6 | "tailwind": { 7 | "config": "tailwind.config.js", 8 | "css": "./styles/globals.css", 9 | "baseColor": "neutral", 10 | "cssVariables": true 11 | }, 12 | "aliases": { 13 | "components": "@/components", 14 | "utils": "@/lib/utils" 15 | } 16 | } 17 | -------------------------------------------------------------------------------- /frontend/components/global/Breadcrumbs.tsx: -------------------------------------------------------------------------------- 1 | import Link from "next/link"; 2 | 3 | interface BreadcrumbsProps { 4 | items: { 5 | name: string; 6 | href?: string; 7 | }[]; 8 | actions?: React.ReactNode; 9 | } 10 | 11 | export function Breadcrumbs({ items, actions }: BreadcrumbsProps) { 12 | return ( 13 |
14 |
15 | {items.map((item, idx) => { 16 | if (idx === items.length - 1 || !item.href) 17 | return ( 18 |
19 | {item.name}/ 20 |
21 | ); 22 | return ( 23 | 24 | {item.name}/ 25 | 26 | ); 27 | })} 28 |
29 |
{actions}
30 |
31 | ); 32 | } 33 | -------------------------------------------------------------------------------- /frontend/components/global/Logo.tsx: -------------------------------------------------------------------------------- 1 | import * as React from "react"; 2 | const Logo = (props: React.JSX.IntrinsicAttributes & React.SVGProps) => ( 3 | 4 | 5 | 6 | 7 | 8 | 9 | ); 10 | export default Logo; 11 | -------------------------------------------------------------------------------- /frontend/components/global/PoweredByLogo.tsx: -------------------------------------------------------------------------------- 1 | import { cn } from "@/lib/utils"; 2 | export default function PoweredByLogo({ className }: { className?: string }) { 3 | return ( 4 | 5 | 6 | 10 | 11 | 12 | Powered by Convexity Labs 13 | 14 | ); 15 | } 16 | -------------------------------------------------------------------------------- /frontend/components/shared/CopyToClipboard.tsx: -------------------------------------------------------------------------------- 1 | import { CopyIcon } from "lucide-react"; 2 | import { useState } from "react"; 3 | 4 | import { Button } from "@/components/ui/button"; 5 | import { Tooltip, TooltipContent, TooltipProvider, TooltipTrigger } from "@/components/ui/tooltip"; 6 | import { cn } from "@/lib/utils"; 7 | 8 | interface CopyToClipboardProps { 9 | string: string; 10 | children?: React.ReactNode; 11 | className?: string; 12 | } 13 | 14 | export function CopyToClipboard({ string, children, className }: CopyToClipboardProps) { 15 | const [copied, setCopied] = useState(false); 16 | const copy = async () => { 17 | await navigator.clipboard.writeText(string); 18 | setCopied(true); 19 | setTimeout(() => { 20 | setCopied(false); 21 | }, 2000); 22 | }; 23 | 24 | if (!string) return children; 25 | 26 | return ( 27 |
{ 30 | copy(); 31 | }} 32 | > 33 | {children && {children}} 34 | 35 | 36 | 37 | 40 | 41 | Copied! 42 | 43 | 44 |
45 | ); 46 | } 47 | -------------------------------------------------------------------------------- /frontend/components/shared/PageLoader.tsx: -------------------------------------------------------------------------------- 1 | import { Loader2Icon } from "lucide-react"; 2 | 3 | import { cn } from "@/lib/utils"; 4 | 5 | import Logo from "../global/Logo"; 6 | 7 | interface PageLoaderProps { 8 | variant?: "default" | "logo"; 9 | className?: string; 10 | } 11 | 12 | export function PageLoader({ variant = "default", className }: PageLoaderProps) { 13 | return ( 14 |
15 | {variant === "logo" ? : } 16 |
17 | ); 18 | } 19 | -------------------------------------------------------------------------------- /frontend/components/shared/TruncatedString.tsx: -------------------------------------------------------------------------------- 1 | import { Tooltip, TooltipContent, TooltipProvider, TooltipTrigger } from "@/components/ui/tooltip"; 2 | 3 | export function TruncatedString({ value, trimLength = 6 }: { value: string; trimLength?: number }) { 4 | if (!value) return null; 5 | if (value?.length) { 6 | if (value?.length < trimLength * 2) return value; 7 | return ( 8 | 9 | 10 | 11 | 12 | {`${value.substring(0, trimLength)}...${value.substring(value.length - trimLength)}`} 13 | 14 | 15 | {value} 16 | 17 | 18 | 19 | 20 | ); 21 | } 22 | } 23 | -------------------------------------------------------------------------------- /frontend/components/shared/ViewportWarning.tsx: -------------------------------------------------------------------------------- 1 | "use client"; 2 | 3 | import { useEffect, useState } from "react"; 4 | 5 | import { 6 | AlertDialog, 7 | AlertDialogAction, 8 | AlertDialogContent, 9 | AlertDialogDescription, 10 | AlertDialogFooter, 11 | AlertDialogHeader, 12 | AlertDialogTitle, 13 | } from "@/components/ui/alert-dialog"; 14 | 15 | export function ViewportWarning() { 16 | const [open, setOpen] = useState(undefined as boolean | undefined); 17 | 18 | useEffect(() => { 19 | const handleResize = (width: number) => { 20 | width < 900 ? setOpen(true) : setOpen(false); 21 | }; 22 | 23 | handleResize(window.innerWidth); 24 | window.addEventListener("resize", () => { 25 | handleResize(window.innerWidth); 26 | }); 27 | }, []); 28 | 29 | return ( 30 | 31 | 32 | 33 | Optimized for larger screens 34 | 35 | We‘re still working on optimizing the UI for smaller screens. For the best experience, please use a device with a larger screen. 36 | 37 | 38 | 39 | Continue Anyway 40 | 41 | 42 | 43 | ); 44 | } 45 | -------------------------------------------------------------------------------- /frontend/components/ui/boolean-input.tsx: -------------------------------------------------------------------------------- 1 | import * as React from "react"; 2 | 3 | import { cn } from "@/lib/utils"; 4 | 5 | export interface CheckboxProps extends React.InputHTMLAttributes {} 6 | 7 | const BooleanInput = React.forwardRef(({ className, ...props }, ref) => { 8 | return ( 9 | 18 | ); 19 | }); 20 | BooleanInput.displayName = "BooleanInput"; 21 | 22 | export { BooleanInput }; 23 | -------------------------------------------------------------------------------- /frontend/components/ui/collapsible.tsx: -------------------------------------------------------------------------------- 1 | "use client" 2 | 3 | import * as CollapsiblePrimitive from "@radix-ui/react-collapsible" 4 | 5 | const Collapsible = CollapsiblePrimitive.Root 6 | 7 | const CollapsibleTrigger = CollapsiblePrimitive.CollapsibleTrigger 8 | 9 | const CollapsibleContent = CollapsiblePrimitive.CollapsibleContent 10 | 11 | export { Collapsible, CollapsibleContent,CollapsibleTrigger } 12 | -------------------------------------------------------------------------------- /frontend/components/ui/data-table-column-header.tsx: -------------------------------------------------------------------------------- 1 | import { Column } from "@tanstack/react-table"; 2 | import { ChevronDownIcon, ChevronsUpDownIcon, ChevronUpIcon, EyeOffIcon } from "lucide-react"; 3 | 4 | import { cn } from "@/lib/utils"; 5 | 6 | import { Button } from "./button"; 7 | import { DropdownMenu, DropdownMenuContent, DropdownMenuItem, DropdownMenuSeparator, DropdownMenuTrigger } from "./dropdown-menu"; 8 | 9 | interface DataTableColumnHeaderProps extends React.HTMLAttributes { 10 | column: Column; 11 | title: string; 12 | } 13 | 14 | export function DataTableColumnHeader({ column, title, className }: DataTableColumnHeaderProps) { 15 | if (!column.getCanSort()) { 16 | return
{title}
; 17 | } 18 | 19 | return ( 20 |
21 | {title} 22 | {column.getIsSorted() === "desc" ? ( 23 | 26 | ) : column.getIsSorted() === "asc" ? ( 27 | 30 | ) : ( 31 | 34 | )} 35 |
36 | ); 37 | } 38 | -------------------------------------------------------------------------------- /frontend/components/ui/input.tsx: -------------------------------------------------------------------------------- 1 | import { cva, type VariantProps } from "class-variance-authority"; 2 | import * as React from "react"; 3 | 4 | import { cn } from "@/lib/utils"; 5 | 6 | export interface InputProps extends React.InputHTMLAttributes {} 7 | 8 | const inputVariants = cva( 9 | "flex h-10 w-full rounded-md border bg-background p-3 ring-offset-background [&[type='file']]:p-2 file:border-0 file:bg-transparent file:text-sm file:font-bold placeholder:text-muted-foreground focus-visible:outline-none focus-visible:ring-2 focus-visible:ring-ring focus-visible:ring-offset-2 disabled:cursor-not-allowed disabled:opacity-50", 10 | { 11 | variants: { 12 | variant: { 13 | default: "border-input", 14 | subtle: "border-transparent hover:border-input", 15 | }, 16 | }, 17 | defaultVariants: { 18 | variant: "default", 19 | }, 20 | } 21 | ); 22 | 23 | const Input = React.forwardRef>(({ className, variant, type, ...props }, ref) => { 24 | return ; 25 | }); 26 | Input.displayName = "Input"; 27 | 28 | export { Input }; 29 | -------------------------------------------------------------------------------- /frontend/components/ui/label.tsx: -------------------------------------------------------------------------------- 1 | "use client"; 2 | 3 | import * as LabelPrimitive from "@radix-ui/react-label"; 4 | import { cva, type VariantProps } from "class-variance-authority"; 5 | import * as React from "react"; 6 | 7 | import { cn } from "@/lib/utils"; 8 | 9 | const labelVariants = cva("leading-none peer-disabled:cursor-not-allowed peer-disabled:opacity-70", { 10 | variants: { 11 | variant: { 12 | default: "font-heading block text-base py-2", 13 | description: "empty:hidden first:ml-0 mx-1 inline-block text-xs text-muted-foreground font-body font-normal", 14 | }, 15 | }, 16 | defaultVariants: { 17 | variant: "default", 18 | }, 19 | }); 20 | 21 | const Label = React.forwardRef< 22 | React.ElementRef, 23 | React.ComponentPropsWithoutRef & VariantProps 24 | >(({ className, ...props }, ref) => ); 25 | Label.displayName = LabelPrimitive.Root.displayName; 26 | 27 | const LabelDescription = React.forwardRef< 28 | React.ElementRef, 29 | React.ComponentPropsWithoutRef & VariantProps 30 | >(({ className, ...props }, ref) => ( 31 | 32 | )); 33 | LabelDescription.displayName = LabelPrimitive.Root.displayName; 34 | 35 | export { Label, LabelDescription }; 36 | -------------------------------------------------------------------------------- /frontend/components/ui/popover.tsx: -------------------------------------------------------------------------------- 1 | "use client" 2 | 3 | import * as PopoverPrimitive from "@radix-ui/react-popover" 4 | import * as React from "react" 5 | 6 | import { cn } from "@/lib/utils" 7 | 8 | const Popover = PopoverPrimitive.Root 9 | 10 | const PopoverTrigger = PopoverPrimitive.Trigger 11 | 12 | const PopoverContent = React.forwardRef< 13 | React.ElementRef, 14 | React.ComponentPropsWithoutRef 15 | >(({ className, align = "center", sideOffset = 4, ...props }, ref) => ( 16 | 17 | 27 | 28 | )) 29 | PopoverContent.displayName = PopoverPrimitive.Content.displayName 30 | 31 | export { Popover, PopoverContent,PopoverTrigger } 32 | -------------------------------------------------------------------------------- /frontend/components/ui/separator.tsx: -------------------------------------------------------------------------------- 1 | "use client" 2 | 3 | import * as SeparatorPrimitive from "@radix-ui/react-separator" 4 | import * as React from "react" 5 | 6 | import { cn } from "@/lib/utils" 7 | 8 | const Separator = React.forwardRef< 9 | React.ElementRef, 10 | React.ComponentPropsWithoutRef 11 | >( 12 | ( 13 | { className, orientation = "horizontal", decorative = true, ...props }, 14 | ref 15 | ) => ( 16 | 27 | ) 28 | ) 29 | Separator.displayName = SeparatorPrimitive.Root.displayName 30 | 31 | export { Separator } 32 | -------------------------------------------------------------------------------- /frontend/components/ui/sonner.tsx: -------------------------------------------------------------------------------- 1 | "use client" 2 | 3 | import { useTheme } from "next-themes" 4 | import { Toaster as Sonner } from "sonner" 5 | 6 | type ToasterProps = React.ComponentProps 7 | 8 | const Toaster = ({ ...props }: ToasterProps) => { 9 | const { theme = "system" } = useTheme() 10 | 11 | return ( 12 | 28 | ) 29 | } 30 | 31 | export { Toaster } 32 | -------------------------------------------------------------------------------- /frontend/components/ui/switch.tsx: -------------------------------------------------------------------------------- 1 | "use client" 2 | 3 | import * as React from "react" 4 | import * as SwitchPrimitives from "@radix-ui/react-switch" 5 | 6 | import { cn } from "@/lib/utils" 7 | 8 | const Switch = React.forwardRef< 9 | React.ElementRef, 10 | React.ComponentPropsWithoutRef 11 | >(({ className, ...props }, ref) => ( 12 | 20 | 25 | 26 | )) 27 | Switch.displayName = SwitchPrimitives.Root.displayName 28 | 29 | export { Switch } 30 | -------------------------------------------------------------------------------- /frontend/components/ui/textarea.tsx: -------------------------------------------------------------------------------- 1 | import * as React from "react"; 2 | import TextareaAutosize, { TextareaAutosizeProps } from "react-textarea-autosize"; 3 | 4 | import { cn } from "@/lib/utils"; 5 | export interface TextareaProps extends React.TextareaHTMLAttributes {} 6 | 7 | const Textarea = React.forwardRef(({ className, ...props }, ref) => { 8 | return ( 9 | 17 | ); 18 | }); 19 | Textarea.displayName = "Textarea"; 20 | 21 | export { Textarea }; 22 | -------------------------------------------------------------------------------- /frontend/components/ui/tooltip.tsx: -------------------------------------------------------------------------------- 1 | "use client" 2 | 3 | import * as TooltipPrimitive from "@radix-ui/react-tooltip" 4 | import * as React from "react" 5 | 6 | import { cn } from "@/lib/utils" 7 | 8 | const TooltipProvider = TooltipPrimitive.Provider 9 | 10 | const Tooltip = TooltipPrimitive.Root 11 | 12 | const TooltipTrigger = TooltipPrimitive.Trigger 13 | 14 | const TooltipContent = React.forwardRef< 15 | React.ElementRef, 16 | React.ComponentPropsWithoutRef 17 | >(({ className, sideOffset = 4, ...props }, ref) => ( 18 | 27 | )) 28 | TooltipContent.displayName = TooltipPrimitive.Content.displayName 29 | 30 | export { Tooltip, TooltipContent, TooltipProvider,TooltipTrigger } 31 | -------------------------------------------------------------------------------- /frontend/components/visualization/Molstar/skin.scss: -------------------------------------------------------------------------------- 1 | $default-background: #f9fafb; 2 | $font-color: #000000; 3 | $hover-font-color: #000000; 4 | $entity-current-font-color: #0343ba; 5 | $msp-btn-remove-background: #de0a28; 6 | $msp-btn-remove-hover-font-color: #de0a28; 7 | $msp-btn-commit-on-font-color: #0343ba; 8 | $entity-badge-font-color: #000000; 9 | 10 | // used in LOG 11 | $log-message: #0cca5d; 12 | $log-info: #5e3673; 13 | $log-warning: #fcc937; 14 | $log-error: #fd354b; 15 | 16 | $logo-background: rgba(0, 0, 0, 0.75); 17 | 18 | @function color-lower-contrast($color, $amount) { 19 | @return darken($color, $amount); 20 | } 21 | 22 | @function color-increase-contrast($color, $amount) { 23 | @return lighten($color, $amount); 24 | } 25 | 26 | @import "molstar/lib/mol-plugin-ui/skin/base/base.scss"; 27 | -------------------------------------------------------------------------------- /frontend/fonts/FKRasterRomanCompact-Blended.woff2: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/fonts/FKRasterRomanCompact-Blended.woff2 -------------------------------------------------------------------------------- /frontend/fonts/PPFraktionMono-Bold.woff2: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/fonts/PPFraktionMono-Bold.woff2 -------------------------------------------------------------------------------- /frontend/fonts/PPFraktionMono-BoldItalic.woff2: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/fonts/PPFraktionMono-BoldItalic.woff2 -------------------------------------------------------------------------------- /frontend/fonts/PPFraktionMono-Regular.woff2: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/fonts/PPFraktionMono-Regular.woff2 -------------------------------------------------------------------------------- /frontend/fonts/PPFraktionMono-RegularItalic.woff2: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/fonts/PPFraktionMono-RegularItalic.woff2 -------------------------------------------------------------------------------- /frontend/fonts/PPNeueMontreal-Bold.woff2: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/fonts/PPNeueMontreal-Bold.woff2 -------------------------------------------------------------------------------- /frontend/fonts/PPNeueMontreal-BoldItalic.woff2: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/fonts/PPNeueMontreal-BoldItalic.woff2 -------------------------------------------------------------------------------- /frontend/fonts/PPNeueMontreal-Italic.woff2: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/fonts/PPNeueMontreal-Italic.woff2 -------------------------------------------------------------------------------- /frontend/fonts/PPNeueMontreal-Regular.woff2: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/fonts/PPNeueMontreal-Regular.woff2 -------------------------------------------------------------------------------- /frontend/lib/PrivyContext.tsx: -------------------------------------------------------------------------------- 1 | import { User } from '@privy-io/react-auth'; 2 | import React from 'react'; 3 | 4 | interface AuthState { 5 | user: User | null; 6 | authenticated: boolean; 7 | } 8 | 9 | export const PrivyAuthContext = React.createContext({ user: null, authenticated: false}); -------------------------------------------------------------------------------- /frontend/lib/backendUrl.ts: -------------------------------------------------------------------------------- 1 | export default function backendUrl() { 2 | if(!process.env.NEXT_PUBLIC_BACKEND_URL) { 3 | throw new Error("The environment variable NEXT_PUBLIC_BACKEND_URL must be defined."); 4 | } 5 | return process.env.NEXT_PUBLIC_BACKEND_URL 6 | } 7 | -------------------------------------------------------------------------------- /frontend/lib/planTemplate.ts: -------------------------------------------------------------------------------- 1 | export interface PlanDetail { 2 | description: string; 3 | } 4 | 5 | export interface PlanTemplate { 6 | details: PlanDetail[]; 7 | } 8 | 9 | const getPlanTemplate = (): PlanTemplate => { 10 | return { 11 | details: [ 12 | { 13 | description: "{{includedCredits}} compute tokens per month included (about {{numMolecules}} molecules)" 14 | }, 15 | { 16 | description: "Every additional token costs {{overageCharge}} USD" 17 | }, 18 | { 19 | description: "Cancel subscription any time" 20 | } 21 | ] 22 | }; 23 | }; 24 | 25 | export default getPlanTemplate; -------------------------------------------------------------------------------- /frontend/lib/providers.tsx: -------------------------------------------------------------------------------- 1 | 'use client' 2 | 3 | import { Provider } from 'react-redux' 4 | 5 | import { reduxStore } from '@/lib/redux' 6 | 7 | import PrivyProviderWrapper from './PrivyProviderWrapper' 8 | 9 | export const Providers = (props: React.PropsWithChildren) => { 10 | return ( 11 | 12 | 13 | {props.children} 14 | 15 | 16 | ) 17 | } -------------------------------------------------------------------------------- /frontend/lib/redux/createAppAsyncThunk.ts: -------------------------------------------------------------------------------- 1 | /* Core */ 2 | import { createAsyncThunk } from '@reduxjs/toolkit' 3 | 4 | /* Instruments */ 5 | import type { ReduxDispatch,ReduxState } from './store' 6 | 7 | /** 8 | * ? A utility function to create a typed Async Thunk Actions. 9 | */ 10 | export const createAppAsyncThunk = createAsyncThunk.withTypes<{ 11 | state: ReduxState 12 | dispatch: ReduxDispatch 13 | rejectValue: string 14 | }>() 15 | -------------------------------------------------------------------------------- /frontend/lib/redux/index.ts: -------------------------------------------------------------------------------- 1 | export * from './slices' 2 | export * from './store' 3 | -------------------------------------------------------------------------------- /frontend/lib/redux/middleware.ts: -------------------------------------------------------------------------------- 1 | /* Core */ 2 | import { createLogger } from 'redux-logger' 3 | 4 | const middleware = [ 5 | createLogger({ 6 | duration: true, 7 | timestamp: false, 8 | collapsed: true, 9 | colors: { 10 | title: () => '#139BFE', 11 | prevState: () => '#1C5FAF', 12 | action: () => '#149945', 13 | nextState: () => '#A47104', 14 | error: () => '#ff0005', 15 | }, 16 | predicate: () => typeof window !== 'undefined', 17 | }), 18 | ] 19 | 20 | export { middleware } 21 | -------------------------------------------------------------------------------- /frontend/lib/redux/rootReducer.ts: -------------------------------------------------------------------------------- 1 | /* Instruments */ 2 | import { 3 | apiKeyAddSlice, 4 | apiKeyListSlice, 5 | fileAddSlice, 6 | fileListSlice, 7 | experimentAddSlice, 8 | experimentDetailSlice, 9 | experimentListSlice, 10 | experimentUpdateSlice, 11 | jobDetailSlice, 12 | stripeCheckoutSlice, 13 | modelAddSlice, 14 | modelDetailSlice, 15 | modelListSlice, 16 | transactionsSummarySlice, 17 | userSlice, 18 | experimentNamesSlice, 19 | } from "./slices"; 20 | 21 | export const reducer = { 22 | user: userSlice.reducer, 23 | fileAdd: fileAddSlice.reducer, 24 | fileList: fileListSlice.reducer, 25 | modelAdd: modelAddSlice.reducer, 26 | modelList: modelListSlice.reducer, 27 | modelDetail: modelDetailSlice.reducer, 28 | experimentAdd: experimentAddSlice.reducer, 29 | experimentList: experimentListSlice.reducer, 30 | experimentDetail: experimentDetailSlice.reducer, 31 | experimentUpdate: experimentUpdateSlice.reducer, 32 | experimentNames: experimentNamesSlice.reducer, 33 | jobDetail: jobDetailSlice.reducer, 34 | apiKeyAdd: apiKeyAddSlice.reducer, 35 | apiKeyList: apiKeyListSlice.reducer, 36 | stripeCheckout: stripeCheckoutSlice.reducer, 37 | transactionsSummary: transactionsSummarySlice.reducer, 38 | }; 39 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/apiKeyAddSlice/asyncActions.ts: -------------------------------------------------------------------------------- 1 | import { getAccessToken } from "@privy-io/react-auth" 2 | import backendUrl from "lib/backendUrl" 3 | 4 | export interface ApiKeyPayload { 5 | name: string; 6 | // Add any other properties that are needed for creating an API key 7 | } 8 | 9 | export const createApiKey = async ( 10 | payload: ApiKeyPayload 11 | ): Promise => { 12 | let authToken 13 | try { 14 | authToken = await getAccessToken(); 15 | } catch (error) { 16 | console.log("Failed to get access token: ", error) 17 | throw new Error("Authentication failed") 18 | } 19 | 20 | const response = await fetch(`${backendUrl()}/api-keys`, { 21 | method: 'POST', 22 | headers: { 23 | 'Authorization': `Bearer ${authToken}`, 24 | 'Content-Type': 'application/json', 25 | }, 26 | body: JSON.stringify(payload), 27 | }) 28 | 29 | if (!response.ok) { 30 | const errorResult = await response.json(); 31 | throw new Error(errorResult.message || "Failed to create API Key") 32 | } 33 | 34 | const result = await response.json() 35 | return result; 36 | } -------------------------------------------------------------------------------- /frontend/lib/redux/slices/apiKeyAddSlice/index.ts: -------------------------------------------------------------------------------- 1 | export * from './selectors' 2 | export * from './slice' 3 | export * from './thunks' 4 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/apiKeyAddSlice/selectors.ts: -------------------------------------------------------------------------------- 1 | import type { ReduxState } from "@/lib/redux" 2 | 3 | export const selectApiKeyAdd = (state: ReduxState) => state.apiKeyAdd.key 4 | export const selectApiKeyAddLoading = (state: ReduxState) => state.apiKeyAdd.loading 5 | export const selectApiKeyAddError = (state: ReduxState) => state.apiKeyAdd.error 6 | export const selectApiKeyAddSuccess = (state: ReduxState) => state.apiKeyAdd.success -------------------------------------------------------------------------------- /frontend/lib/redux/slices/apiKeyAddSlice/slice.ts: -------------------------------------------------------------------------------- 1 | import { createSlice, PayloadAction } from "@reduxjs/toolkit"; 2 | 3 | interface ApiKeyAddSliceState { 4 | key: string; 5 | name: string; 6 | loading: boolean; 7 | error: string | null; 8 | success: boolean; 9 | } 10 | 11 | const initialState: ApiKeyAddSliceState = { 12 | key: "", 13 | name: "", 14 | loading: false, 15 | error: null, 16 | success: false, 17 | }; 18 | 19 | export const apiKeyAddSlice = createSlice({ 20 | name: "apiKeyAdd", 21 | initialState, 22 | reducers: { 23 | setApiKey: (state, action: PayloadAction) => { 24 | state.key = action.payload; 25 | }, 26 | setApiKeyName: (state, action: PayloadAction) => { 27 | state.name = action.payload; 28 | }, 29 | setApiKeyLoading: (state, action: PayloadAction) => { 30 | state.loading = action.payload; 31 | }, 32 | setApiKeyError: (state, action: PayloadAction) => { 33 | state.error = action.payload; 34 | }, 35 | setApiKeySuccess: (state, action: PayloadAction) => { 36 | state.success = action.payload; 37 | }, 38 | // You might need additional reducers depending on your form and API key creation logic 39 | }, 40 | }); 41 | 42 | export const { setApiKey, setApiKeyName, setApiKeyLoading, setApiKeyError, setApiKeySuccess } = 43 | apiKeyAddSlice.actions; 44 | 45 | export default apiKeyAddSlice.reducer; -------------------------------------------------------------------------------- /frontend/lib/redux/slices/apiKeyAddSlice/thunks.ts: -------------------------------------------------------------------------------- 1 | import { createAppAsyncThunk } from '@/lib/redux/createAppAsyncThunk' 2 | 3 | import { createApiKey } from './asyncActions' 4 | import { setApiKey, setApiKeyError, setApiKeySuccess } from './slice' 5 | 6 | interface ApiKeyPayload { 7 | name: string; 8 | // Add any other properties that are needed for creating an API key 9 | } 10 | 11 | export const addApiKeyThunk = createAppAsyncThunk( 12 | 'apiKey/addApiKey', 13 | async (payload: ApiKeyPayload, { dispatch }) => { 14 | try { 15 | const response = await createApiKey(payload) 16 | if (response && response.id) { // Assuming the response will have an 'id' field on successful creation 17 | dispatch(setApiKeySuccess(true)) 18 | dispatch(setApiKey(response.key)) // Assuming you want to store the key in the state 19 | } else { 20 | console.log('Failed to add API key.', response) 21 | dispatch(setApiKeyError('Failed to add API key.')) 22 | } 23 | return response 24 | } catch (error: unknown) { 25 | console.log('Failed to add API key.', error) 26 | if (error instanceof Error) { 27 | dispatch(setApiKeyError(error.message)) 28 | } else { 29 | dispatch(setApiKeyError('Failed to add API key.')) 30 | } 31 | return false 32 | } 33 | } 34 | ) -------------------------------------------------------------------------------- /frontend/lib/redux/slices/apiKeyListSlice/asyncActions.ts: -------------------------------------------------------------------------------- 1 | import { getAccessToken } from "@privy-io/react-auth"; 2 | import backendUrl from "lib/backendUrl"; 3 | 4 | export const listApiKeys = async (): Promise => { 5 | let authToken; 6 | try { 7 | authToken = await getAccessToken(); 8 | console.log('authToken: ', authToken); 9 | } catch (error) { 10 | console.log('Failed to get access token: ', error); 11 | throw new Error("Authentication failed"); 12 | } 13 | 14 | const requestUrl = `${backendUrl()}/api-keys`; 15 | const requestOptions = { 16 | method: 'GET', 17 | headers: { 18 | 'Authorization': `Bearer ${authToken}`, 19 | 'Content-Type': 'application/json', 20 | }, 21 | }; 22 | const response = await fetch(requestUrl, requestOptions); 23 | 24 | if (!response.ok) { 25 | let errorText = "Failed to list API Keys"; 26 | try { 27 | const errorResult = await response.json(); 28 | errorText = errorResult.message || errorText; 29 | console.log(errorText); 30 | } catch (e) { 31 | console.log('Failed to parse error response: ', e); 32 | } 33 | throw new Error(errorText); 34 | } 35 | 36 | const result = await response.json(); 37 | return result; 38 | } -------------------------------------------------------------------------------- /frontend/lib/redux/slices/apiKeyListSlice/index.ts: -------------------------------------------------------------------------------- 1 | export * from './selectors' 2 | export * from './slice' 3 | export * from './thunks' 4 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/apiKeyListSlice/selectors.ts: -------------------------------------------------------------------------------- 1 | import type { ReduxState } from '@/lib/redux' 2 | 3 | export const selectApiKeyList = (state: ReduxState) => state.apiKeyList.apiKeys 4 | export const selectApiKeyListLoading = (state: ReduxState) => state.apiKeyList.loading 5 | export const selectApiKeyListSuccess = (state: ReduxState) => state.apiKeyList.success 6 | export const selectApiKeyListError = (state: ReduxState) => state.apiKeyList.error 7 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/apiKeyListSlice/slice.ts: -------------------------------------------------------------------------------- 1 | import { createSlice, PayloadAction } from '@reduxjs/toolkit'; 2 | 3 | export interface ApiKey { 4 | key: string; 5 | scope: string; 6 | createdAt: string; 7 | expiresAt: string; 8 | } 9 | 10 | interface ApiKeyListSliceState { 11 | apiKeys: ApiKey[]; 12 | loading: boolean; 13 | error: string | null; 14 | success: boolean; 15 | } 16 | 17 | const initialState: ApiKeyListSliceState = { 18 | apiKeys: [], 19 | loading: false, 20 | error: null, 21 | success: false, 22 | }; 23 | 24 | export const apiKeyListSlice = createSlice({ 25 | name: 'ApiKeyList', 26 | initialState, 27 | reducers: { 28 | setApiKeyList: (state, action: PayloadAction) => { 29 | state.apiKeys = action.payload; 30 | }, 31 | setApiKeyListLoading: (state, action: PayloadAction) => { 32 | state.loading = action.payload; 33 | }, 34 | setApiKeyListError: (state, action: PayloadAction) => { 35 | state.error = action.payload; 36 | }, 37 | setApiKeyListSuccess: (state, action: PayloadAction) => { 38 | state.success = action.payload; 39 | }, 40 | }, 41 | }); 42 | 43 | export const { 44 | setApiKeyList, 45 | setApiKeyListLoading, 46 | setApiKeyListError, 47 | setApiKeyListSuccess, 48 | } = apiKeyListSlice.actions; 49 | 50 | export default apiKeyListSlice.reducer; -------------------------------------------------------------------------------- /frontend/lib/redux/slices/apiKeyListSlice/thunks.ts: -------------------------------------------------------------------------------- 1 | import { createAppAsyncThunk } from '@/lib/redux/createAppAsyncThunk' 2 | 3 | import { listApiKeys } from './asyncActions' 4 | import { setApiKeyList, setApiKeyListError, setApiKeyListSuccess } from './slice' 5 | 6 | export const apiKeyListThunk = createAppAsyncThunk( 7 | 'apiKey/apiKeyList', 8 | async (_, { dispatch }) => { 9 | try { 10 | const response = await listApiKeys() 11 | if (response) { 12 | dispatch(setApiKeyListSuccess(true)) 13 | dispatch(setApiKeyList(response)) 14 | } else { 15 | console.log('Failed to list API Keys.', response) 16 | dispatch(setApiKeyListError('Failed to list API Keys.')) 17 | } 18 | return response 19 | } catch (error: unknown) { 20 | console.log('Failed to list API Keys.', error) 21 | if (error instanceof Error) { 22 | dispatch(setApiKeyListError(error.message)) 23 | } else { 24 | dispatch(setApiKeyListError('Failed to list API Keys.')) 25 | } 26 | return false 27 | } 28 | } 29 | ) -------------------------------------------------------------------------------- /frontend/lib/redux/slices/experimentAddSlice/index.ts: -------------------------------------------------------------------------------- 1 | export * from './selectors' 2 | export * from './slice' 3 | export * from './thunks' 4 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/experimentAddSlice/selectors.ts: -------------------------------------------------------------------------------- 1 | import type { ReduxState } from '@/lib/redux' 2 | 3 | export const selectExperimentAddName = (state: ReduxState) => state.experimentAdd.name 4 | export const selectExperimentAddModel = (state: ReduxState) => state.experimentAdd.model 5 | export const selectExperimentAddKwargs = (state: ReduxState) => state.experimentAdd.kwargs 6 | export const selectExperimentAddLoading = (state: ReduxState) => state.experimentAdd.loading 7 | export const selectExperimentAddError = (state: ReduxState) => state.experimentAdd.error 8 | export const selectExperimentAddID = (state: ReduxState) => state.experimentAdd.ID 9 | export const selectExperimentAddSuccess = (state: ReduxState) => state.experimentAdd.success 10 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/experimentDetailSlice/index.ts: -------------------------------------------------------------------------------- 1 | export * from './selectors' 2 | export * from './slice' 3 | export * from './thunks' 4 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/experimentDetailSlice/selectors.ts: -------------------------------------------------------------------------------- 1 | import type { ReduxState } from '@/lib/redux' 2 | 3 | export const selectExperimentDetail = (state: ReduxState) => state.experimentDetail.experiment 4 | export const selectExperimentDetailLoading = (state: ReduxState) => state.experimentDetail.loading 5 | export const selectExperimentDetailSuccess = (state: ReduxState) => state.experimentDetail.success 6 | export const selectExperimentDetailError = (state: ReduxState) => state.experimentDetail.error 7 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/experimentDetailSlice/thunks.ts: -------------------------------------------------------------------------------- 1 | import { createAppAsyncThunk } from "@/lib/redux/createAppAsyncThunk"; 2 | 3 | import { getExperiment, patchExperiment } from "./asyncActions"; 4 | import { setExperimentDetail, setExperimentDetailError, setExperimentDetailLoading, setExperimentDetailSuccess } from "./slice"; 5 | 6 | export const experimentDetailThunk = createAppAsyncThunk("experiment/experimentDetail", async (experimentID: string, { dispatch }) => { 7 | try { 8 | dispatch(setExperimentDetailLoading(true)); 9 | const responseData = await getExperiment(experimentID); 10 | dispatch(setExperimentDetailSuccess(true)); 11 | dispatch(setExperimentDetail(responseData)); 12 | dispatch(setExperimentDetailLoading(false)); 13 | return responseData; 14 | } catch (error: unknown) { 15 | console.log("Failed to get Experiment.", error); 16 | if (error instanceof Error) { 17 | dispatch(setExperimentDetailError(error.message)); 18 | } else { 19 | dispatch(setExperimentDetailError("Failed to get Experiment.")); 20 | } 21 | dispatch(setExperimentDetailLoading(false)); 22 | return false; 23 | } 24 | }); 25 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/experimentListSlice/asyncActions.ts: -------------------------------------------------------------------------------- 1 | import { getAccessToken } from "@privy-io/react-auth"; 2 | import backendUrl from "lib/backendUrl" 3 | 4 | export const listExperiments = async (walletAddress: string): Promise => { 5 | let authToken; 6 | try { 7 | authToken = await getAccessToken() 8 | } catch (error) { 9 | console.log('Failed to get access token: ', error) 10 | throw new Error("Authentication failed"); 11 | } 12 | 13 | const requestUrl = `${backendUrl()}/experiments?walletAddress=${encodeURIComponent(walletAddress)}`; 14 | const requestOptions = { 15 | method: 'GET', 16 | headers: { 17 | 'Authorization': `Bearer ${authToken}`, 18 | 'Content-Type': 'application/json', 19 | }, 20 | }; 21 | const response = await fetch(requestUrl, requestOptions); 22 | 23 | if (!response) { 24 | let errorText = "Failed to list Experiments"; 25 | try { 26 | console.log(errorText); 27 | } catch (e) { 28 | // Parsing JSON failed, retain the default error message. 29 | } 30 | throw new Error(errorText); 31 | } 32 | 33 | const result = await response.json(); 34 | return result; 35 | }; 36 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/experimentListSlice/index.ts: -------------------------------------------------------------------------------- 1 | export * from './selectors' 2 | export * from './slice' 3 | export * from './thunks' 4 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/experimentListSlice/selectors.ts: -------------------------------------------------------------------------------- 1 | import type { ReduxState } from '@/lib/redux' 2 | 3 | export const selectExperimentList = (state: ReduxState) => state.experimentList.experiments 4 | export const selectExperimentListLoading = (state: ReduxState) => state.experimentList.loading 5 | export const selectExperimentListSuccess = (state: ReduxState) => state.experimentList.success 6 | export const selectExperimentListError = (state: ReduxState) => state.experimentList.error 7 | export const selectCategorizedExperiments = (state: ReduxState) => state.experimentList.categorizedExperiments 8 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/experimentNamesSlice/asyncActions.ts: -------------------------------------------------------------------------------- 1 | // redux/experimentNames/asyncActions.ts 2 | import { getAccessToken } from "@privy-io/react-auth"; 3 | import backendUrl from "lib/backendUrl"; 4 | 5 | export const listExperimentNames = async (walletAddress: string): Promise => { 6 | let authToken; 7 | try { 8 | authToken = await getAccessToken(); 9 | } catch (error) { 10 | console.log('Failed to get access token: ', error); 11 | throw new Error("Authentication failed"); 12 | } 13 | 14 | const requestUrl = `${backendUrl()}/experiments?fields=name&walletAddress=${encodeURIComponent(walletAddress)}`; 15 | const requestOptions = { 16 | method: 'GET', 17 | headers: { 18 | 'Authorization': `Bearer ${authToken}`, 19 | 'Content-Type': 'application/json', 20 | }, 21 | }; 22 | const response = await fetch(requestUrl, requestOptions); 23 | 24 | if (!response) { 25 | let errorText = "Failed to list Experiments"; 26 | try { 27 | console.log(errorText); 28 | } catch (e) { 29 | // Parsing JSON failed, retain the default error message. 30 | } 31 | throw new Error(errorText); 32 | } 33 | 34 | const result = await response.json(); 35 | return result; 36 | }; 37 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/experimentNamesSlice/index.ts: -------------------------------------------------------------------------------- 1 | // redux/experimentNames/index.ts 2 | export * from './selectors'; 3 | export * from './slice'; 4 | export * from './thunks'; 5 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/experimentNamesSlice/selectors.ts: -------------------------------------------------------------------------------- 1 | // redux/experimentNames/selectors.ts 2 | import type { ReduxState } from '@/lib/redux'; // Correct the path as needed 3 | 4 | export const selectExperimentNames = (state: ReduxState) => state.experimentNames.names; 5 | export const selectExperimentNamesLoading = (state: ReduxState) => state.experimentNames.loading; 6 | export const selectExperimentNamesError = (state: ReduxState) => state.experimentNames.error; 7 | export const selectExperimentNamesSuccess = (state: ReduxState) => state.experimentNames.success; 8 | export const selectCategorizedExperimentNames = (state: ReduxState) => state.experimentNames.categorizedExperimentNames; -------------------------------------------------------------------------------- /frontend/lib/redux/slices/experimentUpdateSlice/asyncActions.ts: -------------------------------------------------------------------------------- 1 | import { getAccessToken } from "@privy-io/react-auth"; 2 | import backendUrl from "lib/backendUrl"; 3 | 4 | export const updateExperiment = async (experimentId: string, data: { name?: string; public?: boolean; }): Promise => { 5 | let authToken; 6 | try { 7 | authToken = await getAccessToken() 8 | } catch (error) { 9 | console.log('Failed to get access token: ', error) 10 | throw new Error("Authentication failed"); 11 | } 12 | 13 | const requestUrl = `${backendUrl()}/experiments/${experimentId}`; 14 | const requestOptions = { 15 | method: 'PUT', 16 | headers: { 17 | 'Authorization': `Bearer ${authToken}`, 18 | 'Content-Type': 'application/json', 19 | }, 20 | body: JSON.stringify(data) 21 | }; 22 | 23 | try { 24 | const response = await fetch(requestUrl, requestOptions); 25 | if (!response.ok) { 26 | throw new Error(`Failed to update Experiment: ${response.statusText}`); 27 | } 28 | return await response.json(); 29 | } catch (error) { 30 | console.error('Failed to update Experiment:', error); 31 | throw new Error('Failed to update Experiment'); 32 | } 33 | }; -------------------------------------------------------------------------------- /frontend/lib/redux/slices/experimentUpdateSlice/index.ts: -------------------------------------------------------------------------------- 1 | export * from './selectors' 2 | export * from './slice' 3 | export * from './thunks' -------------------------------------------------------------------------------- /frontend/lib/redux/slices/experimentUpdateSlice/selectors.ts: -------------------------------------------------------------------------------- 1 | import type { ReduxState } from '@/lib/redux' 2 | 3 | export const selectExperimentUpdateLoading = (state: ReduxState) => state.experimentUpdate.loading; 4 | export const selectExperimentUpdateError = (state: ReduxState) => state.experimentUpdate.error; 5 | export const selectExperimentUpdateSuccess = (state: ReduxState) => state.experimentUpdate.success; 6 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/experimentUpdateSlice/slice.ts: -------------------------------------------------------------------------------- 1 | import { createSlice, PayloadAction } from "@reduxjs/toolkit"; 2 | 3 | export interface ExperimentUpdateSliceState { 4 | loading: boolean; 5 | error: string | null; 6 | success: boolean; 7 | } 8 | 9 | const initialState: ExperimentUpdateSliceState = { 10 | loading: false, 11 | error: null, 12 | success: false, 13 | }; 14 | 15 | export const experimentUpdateSlice = createSlice({ 16 | name: "ExperimentUpdate", 17 | initialState, 18 | reducers: { 19 | setExperimentUpdateLoading: (state, action: PayloadAction) => { 20 | state.loading = action.payload; 21 | }, 22 | setExperimentUpdateError: (state, action: PayloadAction) => { 23 | state.error = action.payload; 24 | }, 25 | setExperimentUpdateSuccess: (state, action: PayloadAction) => { 26 | state.success = action.payload; 27 | }, 28 | }, 29 | }); 30 | 31 | export const { 32 | setExperimentUpdateLoading, 33 | setExperimentUpdateError, 34 | setExperimentUpdateSuccess, 35 | } = experimentUpdateSlice.actions; 36 | 37 | export default experimentUpdateSlice.reducer; -------------------------------------------------------------------------------- /frontend/lib/redux/slices/experimentUpdateSlice/thunks.ts: -------------------------------------------------------------------------------- 1 | import { createAppAsyncThunk } from 'lib/redux/createAppAsyncThunk'; 2 | import { AppDispatch } from 'lib/redux/store'; 3 | 4 | import { updateExperiment } from './asyncActions'; 5 | import { setExperimentUpdateError, setExperimentUpdateLoading, setExperimentUpdateSuccess } from './slice'; 6 | 7 | interface UpdateExperimentArgs { 8 | experimentId: string; 9 | updates: { 10 | name?: string; 11 | public?: boolean; 12 | }; 13 | } 14 | 15 | export const experimentUpdateThunk = createAppAsyncThunk( 16 | 'experiment/updateExperiment', 17 | async ({ experimentId, updates }: UpdateExperimentArgs, { dispatch }: { dispatch: AppDispatch }) => { 18 | dispatch(setExperimentUpdateLoading(true)); 19 | try { 20 | const result = await updateExperiment(experimentId, updates); 21 | dispatch(setExperimentUpdateSuccess(true)); 22 | return result; 23 | } catch (error) { 24 | dispatch(setExperimentUpdateError(error instanceof Error ? error.toString() : 'Failed to update Experiment.')); 25 | return { error: error instanceof Error ? error.toString() : 'Failed to update Experiment.' }; 26 | } finally { 27 | dispatch(setExperimentUpdateLoading(false)); 28 | } 29 | } 30 | ); -------------------------------------------------------------------------------- /frontend/lib/redux/slices/fileAddSlice/actions.ts: -------------------------------------------------------------------------------- 1 | import { getAccessToken } from "@privy-io/react-auth" 2 | import backendUrl from "lib/backendUrl" 3 | 4 | export const saveFileToServer = async ( 5 | file: File, 6 | metadata: { [key: string]: any }, 7 | isPublic: boolean 8 | ): Promise<{ filename: string, id: string }> => { 9 | const formData = new FormData() 10 | formData.append('file', file, file.name) 11 | formData.append('filename', file.name) 12 | formData.append('public', (isPublic ?? false).toString()) 13 | 14 | for (const key in metadata) { 15 | formData.append(key, metadata[key]) 16 | } 17 | 18 | let authToken 19 | try { 20 | authToken = await getAccessToken(); 21 | } catch (error) { 22 | console.log("Failed to get access token: ", error) 23 | throw new Error("Authentication failed") 24 | } 25 | 26 | const response = await fetch(`${backendUrl()}/files`, { 27 | method: 'POST', 28 | headers: { 29 | 'Authorization': `Bearer ${authToken}`, 30 | }, 31 | body: formData, 32 | }) 33 | 34 | if (!response.ok) { 35 | let errorMsg = 'An error occurred while uploading the file' 36 | try { 37 | const errorResult = await response.json() 38 | errorMsg = errorResult.message || errorMsg; 39 | } catch (e) { 40 | // Parsing JSON failed, retain the default error message. 41 | } 42 | console.log('errorMsg', errorMsg) 43 | throw new Error(errorMsg) 44 | } 45 | 46 | const result = await response.json() 47 | console.log('result', result) 48 | return result 49 | } 50 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/fileAddSlice/index.ts: -------------------------------------------------------------------------------- 1 | export * from './dataSlice' 2 | export * from './selectors' 3 | export * from './thunks' 4 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/fileAddSlice/selectors.ts: -------------------------------------------------------------------------------- 1 | import type { ReduxState } from "@/lib/redux"; 2 | 3 | export const selectFilename = (state: ReduxState) => state.fileAdd.filename; 4 | export const selectID = (state: ReduxState) => state.fileAdd.id; 5 | export const selectFileError = (state: ReduxState) => state.fileAdd.error; 6 | export const selectFileIsLoading = (state: ReduxState) => state.fileAdd.isLoading; 7 | export const selectDateFileIsUploaded = (state: ReduxState) => state.fileAdd.isUploaded; 8 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/fileAddSlice/thunks.ts: -------------------------------------------------------------------------------- 1 | import { createAppAsyncThunk } from "@/lib/redux/createAppAsyncThunk"; 2 | 3 | import { saveFileToServer } from "./actions"; 4 | import { setIdDataSlice, setFileError, setFilenameDataSlice } from "./dataSlice"; 5 | 6 | interface FilePayload { 7 | file: File; 8 | metadata: { [key: string]: any }; 9 | isPublic: boolean; 10 | handleSuccess: (id: string) => void; 11 | } 12 | 13 | export const saveFileAsync = createAppAsyncThunk( 14 | "file/saveFile", 15 | async ({ file, metadata, isPublic, handleSuccess }: FilePayload, { dispatch }) => { 16 | try { 17 | const response = await saveFileToServer(file, metadata, isPublic); 18 | if (response.id) { 19 | handleSuccess(response.id); 20 | } else { 21 | dispatch(setFileError("Failed to save file.")); 22 | } 23 | return response; 24 | } catch (error: unknown) { 25 | const errorMessage = 26 | typeof error === "object" && error !== null && "message" in error 27 | ? (error as { message?: string }).message 28 | : "An error occurred while saving file."; 29 | 30 | dispatch(setFileError(errorMessage || "An error occurred while saving file.")); 31 | } 32 | } 33 | ); 34 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/fileListSlice/asyncActions.ts: -------------------------------------------------------------------------------- 1 | import { getAccessToken } from "@privy-io/react-auth" 2 | import backendUrl from "lib/backendUrl" 3 | 4 | export const listFiles = async ({ page = 1, pageSize = 50, filters = {} }: { page?: number, pageSize?: number, filters?: Record }): Promise => { 5 | const queryParams = new URLSearchParams({ ...filters, page: page.toString(), pageSize: pageSize.toString() }); 6 | let authToken; 7 | try { 8 | authToken = await getAccessToken() 9 | } catch (error) { 10 | console.log('Failed to get access token: ', error) 11 | throw new Error("Authentication failed"); 12 | } 13 | 14 | const response = await fetch(`${backendUrl()}/files?${queryParams}`, { 15 | method: 'Get', 16 | headers: { 17 | 'Authorization': `Bearer ${authToken}`, 18 | 'Content-Type': 'application/json', 19 | }, 20 | }) 21 | 22 | if (!response.ok) { 23 | throw new Error("Failed to list Files"); 24 | } 25 | 26 | return await response.json(); 27 | } 28 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/fileListSlice/index.ts: -------------------------------------------------------------------------------- 1 | export * from './selectors' 2 | export * from './slice' 3 | export * from './thunks' 4 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/fileListSlice/selectors.ts: -------------------------------------------------------------------------------- 1 | import type { ReduxState } from '@/lib/redux' 2 | 3 | export const selectFileList = (state: ReduxState) => state.fileList.files 4 | export const selectFileListPagination = (state: ReduxState) => state.fileList.pagination 5 | export const selectFileListLoading = (state: ReduxState) => state.fileList.status === 'loading'; 6 | export const selectFileListSuccess = (state: ReduxState) => state.fileList.success 7 | export const selectFileListError = (state: ReduxState) => state.fileList.error 8 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/fileListSlice/thunks.ts: -------------------------------------------------------------------------------- 1 | import { createAppAsyncThunk } from '@/lib/redux/createAppAsyncThunk' 2 | 3 | import { listFiles } from './asyncActions' 4 | import { 5 | setFileList, 6 | setFileListError, 7 | setFileListPagination, 8 | setFileListSuccess 9 | } from './slice' 10 | 11 | export const fileListThunk = createAppAsyncThunk( 12 | 'files/listFiles', 13 | async (arg: Partial<{ page: number, pageSize: number, filters: Record }> = { page: 1, pageSize: 50, filters: {} }, { dispatch }) => { 14 | const { page = 1, pageSize = 50, filters = {} } = arg; 15 | try { 16 | const response = await listFiles({ page, pageSize, filters }); 17 | if (response) { 18 | dispatch(setFileListSuccess(true)); 19 | dispatch(setFileList(response.data)); 20 | dispatch(setFileListPagination(response.pagination)); 21 | } else { 22 | console.log('Failed to list Files.', response); 23 | dispatch(setFileListError('Failed to list Files.')); 24 | } 25 | return response; 26 | } catch (error: unknown) { 27 | console.log('Failed to list Files.', error); 28 | if (error instanceof Error) { 29 | dispatch(setFileListError(error.message)); 30 | } else { 31 | dispatch(setFileListError('Failed to list Files.')); 32 | } 33 | return false; 34 | } 35 | } 36 | ) 37 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/index.ts: -------------------------------------------------------------------------------- 1 | export * from "./apiKeyAddSlice"; 2 | export * from "./apiKeyListSlice"; 3 | export * from "./fileAddSlice"; 4 | export * from "./fileListSlice"; 5 | export * from "./experimentAddSlice"; 6 | export * from "./experimentDetailSlice"; 7 | export * from "./experimentListSlice"; 8 | export * from "./experimentUpdateSlice"; 9 | export * from "./jobDetailSlice"; 10 | export * from "./stripeCheckoutSlice"; 11 | export * from "./modelAddSlice"; 12 | export * from "./modelDetailSlice"; 13 | export * from "./modelListSlice"; 14 | export * from "./transactionsSummarySlice"; 15 | export * from "./userSlice"; 16 | export * from "./experimentNamesSlice"; -------------------------------------------------------------------------------- /frontend/lib/redux/slices/jobDetailSlice/asyncActions.ts: -------------------------------------------------------------------------------- 1 | import { getAccessToken } from "@privy-io/react-auth"; 2 | import backendUrl from "lib/backendUrl" 3 | 4 | export const getJob = async (jobID: string): Promise => { 5 | let authToken; 6 | try { 7 | authToken = await getAccessToken() 8 | } catch (error) { 9 | console.log('Failed to get access token: ', error) 10 | throw new Error("Authentication failed"); 11 | } 12 | 13 | const response = await fetch(`${backendUrl()}/jobs/${jobID}`, { 14 | method: 'Get', 15 | headers: { 16 | 'Authorization': `Bearer ${authToken}`, 17 | 'Content-Type': 'application/json', 18 | }, 19 | }) 20 | 21 | if (!response.ok) { 22 | throw new Error(`Failed to get job: ${response.status} ${response.statusText}`); 23 | } 24 | 25 | const result = await response.json() 26 | return result 27 | } 28 | 29 | export const patchJob = async (jobID: string): Promise => { 30 | let authToken; 31 | try { 32 | authToken = await getAccessToken() 33 | } catch (error) { 34 | console.log('Failed to get access token: ', error) 35 | throw new Error("Authentication failed"); 36 | } 37 | 38 | const response = await fetch(`${backendUrl()}/jobs/${jobID}`, { 39 | method: 'PATCH', 40 | headers: { 41 | 'Authorization': `Bearer ${authToken}`, 42 | 'Content-Type': 'application/json', 43 | }, 44 | }) 45 | 46 | if (!response.ok) { 47 | throw new Error(`Failed to patch job: ${response.status} ${response.statusText}`); 48 | } 49 | 50 | const result = await response.json() 51 | return result 52 | } 53 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/jobDetailSlice/index.ts: -------------------------------------------------------------------------------- 1 | export * from './selectors' 2 | export * from './slice' 3 | export * from './thunks' 4 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/jobDetailSlice/selectors.ts: -------------------------------------------------------------------------------- 1 | import type { ReduxState } from '@/lib/redux' 2 | 3 | export const selectJobDetail = (state: ReduxState) => state.jobDetail.job 4 | export const selectJobDetailLoading = (state: ReduxState) => state.jobDetail.loading 5 | export const selectJobDetailSuccess = (state: ReduxState) => state.jobDetail.success 6 | export const selectJobDetailError = (state: ReduxState) => state.jobDetail.error 7 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/jobDetailSlice/thunks.ts: -------------------------------------------------------------------------------- 1 | import { createAppAsyncThunk } from '@/lib/redux/createAppAsyncThunk' 2 | 3 | import { getJob, patchJob } from './asyncActions' 4 | import { setJobDetail, setJobDetailError, setJobDetailLoading,setJobDetailSuccess } from './slice' 5 | 6 | 7 | export const jobDetailThunk = createAppAsyncThunk( 8 | 'job/jobDetail', 9 | async (jobID: string, { dispatch }) => { 10 | dispatch(setJobDetailLoading(true)) 11 | try { 12 | const responseData = await getJob(jobID) 13 | dispatch(setJobDetailSuccess(true)) 14 | dispatch(setJobDetail(responseData)) 15 | dispatch(setJobDetailLoading(false)) 16 | return responseData 17 | } catch (error: unknown) { 18 | console.log('Failed to get Job.', error) 19 | if (error instanceof Error) { 20 | dispatch(setJobDetailError(error.message)) 21 | } else { 22 | dispatch(setJobDetailError('Failed to get Job.')) 23 | } 24 | dispatch(setJobDetailLoading(false)) 25 | return false 26 | } 27 | } 28 | ) 29 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/modelAddSlice/asyncActions.ts: -------------------------------------------------------------------------------- 1 | import { getAccessToken } from "@privy-io/react-auth" 2 | import backendUrl from "lib/backendUrl" 3 | 4 | export const createModel = async ( 5 | payload: { modelJson: { [key: string]: any } } 6 | ): Promise => { 7 | let authToken 8 | try { 9 | authToken = await getAccessToken(); 10 | } catch (error) { 11 | console.log("Failed to get access token: ", error) 12 | throw new Error("Authentication failed") 13 | } 14 | 15 | const response = await fetch(`${backendUrl()}/models`, { 16 | method: 'POST', 17 | headers: { 18 | 'Authorization': `Bearer ${authToken}`, 19 | 'Content-Type': 'application/json', 20 | }, 21 | body: JSON.stringify(payload), 22 | }) 23 | 24 | if (!response) { 25 | throw new Error("Failed to create Model") 26 | } 27 | 28 | const result = await response.json() 29 | return result; 30 | } 31 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/modelAddSlice/index.ts: -------------------------------------------------------------------------------- 1 | export * from './selectors' 2 | export * from './thunks' 3 | export * from './slice' 4 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/modelAddSlice/selectors.ts: -------------------------------------------------------------------------------- 1 | import type { ReduxState } from '@/lib/redux' 2 | 3 | export const selectAddModelJson = (state: ReduxState) => state.modelAdd.modelJson 4 | export const selectAddModelError = (state: ReduxState) => state.modelAdd.error 5 | export const selectAddModelLoading = (state: ReduxState) => state.modelAdd.loading 6 | export const selectAddModelSuccess = (state: ReduxState) => state.modelAdd.success 7 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/modelAddSlice/slice.ts: -------------------------------------------------------------------------------- 1 | import { createSlice, PayloadAction } from '@reduxjs/toolkit' 2 | 3 | interface ModelAddSliceState { 4 | modelJson: string 5 | loading: boolean 6 | error: string | null 7 | success: boolean 8 | } 9 | 10 | const initialState: ModelAddSliceState = { 11 | modelJson: '', 12 | loading: false, 13 | error: null, 14 | success: false, 15 | } 16 | 17 | export const modelAddSlice = createSlice({ 18 | name: 'modelAdd', 19 | initialState, 20 | reducers: { 21 | setAddModelJson: (state, action: PayloadAction) => { 22 | state.modelJson = action.payload 23 | }, 24 | setAddModelError: (state, action: PayloadAction) => { 25 | state.error = action.payload 26 | }, 27 | setAddModelLoading: (state, action: PayloadAction) => { 28 | state.loading = action.payload 29 | }, 30 | setAddModelSuccess: (state, action: PayloadAction) => { 31 | state.success = action.payload 32 | } 33 | } 34 | }) 35 | 36 | export const { 37 | setAddModelJson, 38 | setAddModelError, 39 | setAddModelLoading, 40 | setAddModelSuccess, 41 | } = modelAddSlice.actions 42 | 43 | export default modelAddSlice.reducer 44 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/modelAddSlice/thunks.ts: -------------------------------------------------------------------------------- 1 | import { createAppAsyncThunk } from '@/lib/redux/createAppAsyncThunk' 2 | 3 | import { createModel } from './asyncActions' 4 | import { setAddModelError, setAddModelSuccess } from './slice' 5 | 6 | interface ModelPayload { 7 | modelJson: { [key: string]: any } 8 | } 9 | 10 | export const createModelThunk = createAppAsyncThunk( 11 | 'model/addModel', 12 | async ({ modelJson }: ModelPayload, { dispatch }) => { 13 | try { 14 | const response = await createModel({ modelJson }) 15 | if (response && response.id) { 16 | dispatch(setAddModelSuccess(true)) 17 | } else { 18 | console.log('Failed to add model.', response) 19 | dispatch(setAddModelError('Failed to add model.')) 20 | } 21 | return response 22 | } catch (error: unknown) { 23 | console.log('Failed to add model.', error) 24 | if (error instanceof Error) { 25 | dispatch(setAddModelError(error.message)) 26 | } else { 27 | dispatch(setAddModelError('Failed to add model.')) 28 | } 29 | return false 30 | } 31 | } 32 | ) 33 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/modelDetailSlice/asyncActions.ts: -------------------------------------------------------------------------------- 1 | import { getAccessToken } from "@privy-io/react-auth" 2 | import backendUrl from "lib/backendUrl" 3 | 4 | export const getModel = async (ID: string): Promise => { 5 | let authToken 6 | try { 7 | authToken = await getAccessToken(); 8 | } catch (error) { 9 | console.log("Failed to get access token: ", error) 10 | throw new Error("Authentication failed") 11 | } 12 | 13 | const response = await fetch(`${backendUrl()}/models/${ID}`, { 14 | method: "Get", 15 | headers: { 16 | "Authorization": `Bearer ${authToken}`, 17 | "Content-Type": "application/json", 18 | }, 19 | }) 20 | 21 | if (!response.ok) { 22 | throw new Error(`Failed to get model: ${response.status} ${response.statusText}`); 23 | } 24 | 25 | const result = await response.json(); 26 | return result; 27 | } 28 | 29 | export const patchModel = async (ID: string): Promise => { 30 | const response = await fetch(`${backendUrl()}/models/${ID}`, { 31 | method: "PATCH", 32 | headers: { 33 | "Content-Type": "application/json", 34 | }, 35 | }) 36 | 37 | if (!response.ok) { 38 | throw new Error(`Failed to patch model: ${response.status} ${response.statusText}`); 39 | } 40 | 41 | const result = await response.json(); 42 | return result; 43 | } 44 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/modelDetailSlice/index.ts: -------------------------------------------------------------------------------- 1 | export * from './selectors' 2 | export * from './slice' 3 | export * from './thunks' 4 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/modelDetailSlice/selectors.ts: -------------------------------------------------------------------------------- 1 | import type { ReduxState } from "@/lib/redux"; 2 | 3 | export const selectModelDetail = (state: ReduxState) => state.modelDetail.model; 4 | export const selectModelDetailLoading = (state: ReduxState) => state.modelDetail.loading; 5 | export const selectModelDetailSuccess = (state: ReduxState) => state.modelDetail.success; 6 | export const selectModelDetailError = (state: ReduxState) => state.modelDetail.error; 7 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/modelListSlice/asyncActions.ts: -------------------------------------------------------------------------------- 1 | import { getAccessToken } from "@privy-io/react-auth"; 2 | import backendUrl from "lib/backendUrl" 3 | 4 | export const listModels = async (taskSlug?: string): Promise => { 5 | const url = taskSlug ? `${backendUrl()}/models?taskCategory=${encodeURIComponent(taskSlug)}` : `${backendUrl()}/models`; 6 | const authToken = await getAccessToken() 7 | const response = await fetch(url, { 8 | method: 'Get', 9 | headers: { 10 | 'Authorization': `Bearer ${authToken}`, 11 | 'Content-Type': 'application/json', 12 | }, 13 | }) 14 | 15 | if (!response) { 16 | throw new Error("Failed to list Models") 17 | } 18 | 19 | const result = await response.json() 20 | return result; 21 | } 22 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/modelListSlice/index.ts: -------------------------------------------------------------------------------- 1 | export * from './selectors' 2 | export * from './slice' 3 | export * from './thunks' 4 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/modelListSlice/selectors.ts: -------------------------------------------------------------------------------- 1 | import type { ReduxState } from '@/lib/redux' 2 | 3 | export const selectModelList = (state: ReduxState) => state.modelList.models 4 | export const selectModelListLoading = (state: ReduxState) => state.modelList.loading 5 | export const selectModelListSuccess = (state: ReduxState) => state.modelList.success 6 | export const selectModelListError = (state: ReduxState) => state.modelList.error 7 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/modelListSlice/slice.ts: -------------------------------------------------------------------------------- 1 | import { createSlice, PayloadAction } from "@reduxjs/toolkit"; 2 | 3 | import { ModelDetail } from "@/lib/redux"; 4 | 5 | interface ModelListSliceState { 6 | models: ModelDetail[]; 7 | loading: boolean; 8 | error: string | null; 9 | success: boolean; 10 | } 11 | 12 | const initialState: ModelListSliceState = { 13 | models: [], 14 | loading: false, 15 | error: null, 16 | success: false, 17 | }; 18 | 19 | export const modelListSlice = createSlice({ 20 | name: "modelList", 21 | initialState, 22 | reducers: { 23 | setModelList: (state, action: PayloadAction) => { 24 | state.models = action.payload; 25 | }, 26 | setModelListLoading: (state, action: PayloadAction) => { 27 | state.loading = action.payload; 28 | }, 29 | setModelListError: (state, action: PayloadAction) => { 30 | state.error = action.payload; 31 | }, 32 | setModelListSuccess: (state, action: PayloadAction) => { 33 | state.success = action.payload; 34 | }, 35 | resetModelList: () => { 36 | return initialState; 37 | }, 38 | }, 39 | }); 40 | 41 | export const { setModelList, setModelListLoading, setModelListError, setModelListSuccess, resetModelList } = modelListSlice.actions; 42 | 43 | export default modelListSlice.reducer; 44 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/modelListSlice/thunks.ts: -------------------------------------------------------------------------------- 1 | import { createAppAsyncThunk } from '@/lib/redux/createAppAsyncThunk' 2 | 3 | import { AppDispatch } from '../..' 4 | import { listModels } from './asyncActions' 5 | import { setModelList,setModelListError, setModelListSuccess } from './slice' 6 | 7 | 8 | export const modelListThunk = createAppAsyncThunk( 9 | 'model/listModels', 10 | async (taskSlug: string | undefined, { dispatch }) => { 11 | console.log('modelListThunk') 12 | try { 13 | const response = await listModels(taskSlug) 14 | if (response) { 15 | dispatch(setModelListSuccess(true)) 16 | dispatch(setModelList(response)) 17 | } else { 18 | console.log('Failed to list Models.', response) 19 | dispatch(setModelListError('Failed to list Models.')) 20 | } 21 | return response 22 | } catch (error: unknown) { 23 | console.log('Failed to list Experiments.', error) 24 | if (error instanceof Error) { 25 | dispatch(setModelListError(error.message)) 26 | } else { 27 | dispatch(setModelListError('Failed to add model.')) 28 | } 29 | return false 30 | } 31 | } 32 | ) 33 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/stripeCheckoutSlice/asyncActions.ts: -------------------------------------------------------------------------------- 1 | import { getAccessToken } from "@privy-io/react-auth"; 2 | import backendUrl from "lib/backendUrl"; 3 | 4 | interface CheckoutPayload { 5 | modelId: string; 6 | scatteringMethod: string; 7 | kwargs: string; 8 | } 9 | 10 | export const getCheckoutURL = async (): Promise => { 11 | let authToken; 12 | try { 13 | authToken = await getAccessToken(); 14 | } catch (error) { 15 | console.log("Failed to get access token: ", error); 16 | throw new Error("Authentication failed"); 17 | } 18 | 19 | const response = await fetch(`${backendUrl()}/stripe/checkout`, { 20 | method: "POST", 21 | headers: { 22 | Authorization: `Bearer ${authToken}`, 23 | "Content-Type": "application/json", 24 | }, 25 | body: JSON.stringify({ 26 | success_url: `${window.location.origin}/subscription/manage`, 27 | cancel_url: `${window.location.origin}/checkout/cancel`, 28 | }), 29 | }); 30 | 31 | if (!response.ok) { 32 | throw new Error(`Problem getting checkout URL: ${response.status} ${response.statusText}`); 33 | } 34 | 35 | const result = await response.json(); 36 | return result; 37 | }; 38 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/stripeCheckoutSlice/index.ts: -------------------------------------------------------------------------------- 1 | export * from "./selectors"; 2 | export * from "./slice"; 3 | export * from "./thunks"; 4 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/stripeCheckoutSlice/selectors.ts: -------------------------------------------------------------------------------- 1 | import type { ReduxState } from "@/lib/redux"; 2 | 3 | export const selectStripeCheckoutUrl = (state: ReduxState) => state.stripeCheckout.url; 4 | export const selectStripeCheckoutLoading = (state: ReduxState) => state.stripeCheckout.loading; 5 | export const selectStripeCheckoutSuccess = (state: ReduxState) => state.stripeCheckout.success; 6 | export const selectStripeCheckoutError = (state: ReduxState) => state.stripeCheckout.error; 7 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/stripeCheckoutSlice/slice.ts: -------------------------------------------------------------------------------- 1 | import { createSlice, PayloadAction } from "@reduxjs/toolkit"; 2 | 3 | export interface StripePayload { 4 | url: string | null; 5 | } 6 | 7 | export interface StripeCheckoutSliceState { 8 | url: string | null; 9 | loading: boolean; 10 | error: string | null; 11 | success: boolean; 12 | } 13 | 14 | const initialState: StripeCheckoutSliceState = { 15 | url: null, 16 | loading: false, 17 | error: null, 18 | success: false, 19 | }; 20 | 21 | export const stripeCheckoutSlice = createSlice({ 22 | name: "stripeCheckout", 23 | initialState, 24 | reducers: { 25 | setStripeCheckoutUrl: (state, action: PayloadAction) => { 26 | state.url = action.payload?.url || null; 27 | }, 28 | setStripeCheckoutLoading: (state, action: PayloadAction) => { 29 | state.loading = action.payload; 30 | }, 31 | setStripeCheckoutError: (state, action: PayloadAction) => { 32 | state.error = action.payload; 33 | }, 34 | setStripeCheckoutSuccess: (state, action: PayloadAction) => { 35 | state.success = action.payload; 36 | }, 37 | }, 38 | }); 39 | 40 | export const { setStripeCheckoutUrl, setStripeCheckoutLoading, setStripeCheckoutError, setStripeCheckoutSuccess } = stripeCheckoutSlice.actions; 41 | 42 | export default stripeCheckoutSlice.reducer; 43 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/stripeCheckoutSlice/thunks.ts: -------------------------------------------------------------------------------- 1 | import { createAppAsyncThunk } from "@/lib/redux/createAppAsyncThunk"; 2 | 3 | import { getCheckoutURL } from "./asyncActions"; 4 | import { setStripeCheckoutError, setStripeCheckoutLoading, setStripeCheckoutSuccess, setStripeCheckoutUrl } from "./slice"; 5 | 6 | export const stripeCheckoutThunk = createAppAsyncThunk("stripe/checkout", async (_, { dispatch }) => { 7 | dispatch(setStripeCheckoutError(null)); 8 | dispatch(setStripeCheckoutLoading(true)); 9 | try { 10 | // const responseData = await getCheckoutURL(); 11 | // dispatch(setStripeCheckoutSuccess(true)); 12 | // dispatch(setStripeCheckoutUrl(responseData)); 13 | // dispatch(setStripeCheckoutLoading(false)); 14 | // return responseData; 15 | } catch (error: unknown) { 16 | console.log("Problem getting checkout URL", error); 17 | if (error instanceof Error) { 18 | dispatch(setStripeCheckoutError(error.message)); 19 | } else { 20 | dispatch(setStripeCheckoutError("Problem getting checkout URL")); 21 | } 22 | dispatch(setStripeCheckoutLoading(false)); 23 | return false; 24 | } 25 | }); 26 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/transactionsSummarySlice/asyncActions.ts: -------------------------------------------------------------------------------- 1 | import { getAccessToken } from "@privy-io/react-auth"; 2 | import backendUrl from "lib/backendUrl"; 3 | 4 | export const getTransactionsSummary = async (): Promise => { 5 | let authToken; 6 | try { 7 | authToken = await getAccessToken(); 8 | } catch (error) { 9 | console.log("Failed to get access token: ", error); 10 | throw new Error("Authentication failed"); 11 | } 12 | 13 | const response = await fetch(`${backendUrl()}/transactions-summary`, { 14 | method: "Get", 15 | headers: { 16 | Authorization: `Bearer ${authToken}`, 17 | "Content-Type": "application/json", 18 | }, 19 | }); 20 | 21 | if (!response.ok) { 22 | throw new Error(`Problem fetching transactions: ${response.status} ${response.statusText}`); 23 | } 24 | 25 | const result = await response.json(); 26 | return result; 27 | }; 28 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/transactionsSummarySlice/index.ts: -------------------------------------------------------------------------------- 1 | export * from "./selectors"; 2 | export * from "./slice"; 3 | export * from "./thunks"; 4 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/transactionsSummarySlice/selectors.ts: -------------------------------------------------------------------------------- 1 | import type { ReduxState } from "@/lib/redux"; 2 | 3 | export const selectTransactionsSummary = (state: ReduxState) => state.transactionsSummary.summary; 4 | export const selectTransactionsSummaryLoading = (state: ReduxState) => state.transactionsSummary.loading; 5 | export const selectTransactionsSummarySuccess = (state: ReduxState) => state.transactionsSummary.success; 6 | export const selectTransactionsSummaryError = (state: ReduxState) => state.transactionsSummary.error; 7 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/transactionsSummarySlice/slice.ts: -------------------------------------------------------------------------------- 1 | import { createSlice, PayloadAction } from "@reduxjs/toolkit"; 2 | 3 | export interface TransactionsSummary { 4 | tokens: number | null; 5 | balance: number | null; 6 | } 7 | 8 | export interface TransactionsSummarySliceState { 9 | summary: TransactionsSummary; 10 | loading: boolean; 11 | error: string | null; 12 | success: boolean; 13 | } 14 | 15 | const initialState: TransactionsSummarySliceState = { 16 | summary: { 17 | tokens: null, 18 | balance: null, 19 | }, 20 | loading: false, 21 | error: null, 22 | success: false, 23 | }; 24 | 25 | export const transactionsSummarySlice = createSlice({ 26 | name: "jobDetail", 27 | initialState, 28 | reducers: { 29 | setTransactionsSummary: (state, action: PayloadAction) => { 30 | state.summary = action.payload; 31 | }, 32 | setTransactionsSummaryLoading: (state, action: PayloadAction) => { 33 | state.loading = action.payload; 34 | }, 35 | setTransactionsSummaryError: (state, action: PayloadAction) => { 36 | state.error = action.payload; 37 | }, 38 | setTransactionsSummarySuccess: (state, action: PayloadAction) => { 39 | state.success = action.payload; 40 | }, 41 | }, 42 | }); 43 | 44 | export const { setTransactionsSummary, setTransactionsSummaryLoading, setTransactionsSummaryError, setTransactionsSummarySuccess } = 45 | transactionsSummarySlice.actions; 46 | 47 | export default transactionsSummarySlice.reducer; 48 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/transactionsSummarySlice/thunks.ts: -------------------------------------------------------------------------------- 1 | import { createAppAsyncThunk } from "@/lib/redux/createAppAsyncThunk"; 2 | 3 | import { getTransactionsSummary } from "./asyncActions"; 4 | import { setTransactionsSummary, setTransactionsSummaryError, setTransactionsSummaryLoading, setTransactionsSummarySuccess } from "./slice"; 5 | 6 | export const transactionsSummaryThunk = createAppAsyncThunk("stripe/checkout", async (_, { dispatch }) => { 7 | dispatch(setTransactionsSummaryError(null)); 8 | dispatch(setTransactionsSummaryLoading(true)); 9 | try { 10 | const responseData = await getTransactionsSummary(); 11 | dispatch(setTransactionsSummarySuccess(true)); 12 | dispatch(setTransactionsSummary(responseData)); 13 | dispatch(setTransactionsSummaryLoading(false)); 14 | return responseData; 15 | } catch (error: unknown) { 16 | console.log("Problem getting checkout URL", error); 17 | if (error instanceof Error) { 18 | dispatch(setTransactionsSummaryError(error.message)); 19 | } else { 20 | dispatch(setTransactionsSummaryError("Problem getting checkout URL")); 21 | } 22 | dispatch(setTransactionsSummaryLoading(false)); 23 | return false; 24 | } 25 | }); 26 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/userSlice/index.ts: -------------------------------------------------------------------------------- 1 | export * from './selectors' 2 | export * from './thunks' 3 | export * from './userSlice' 4 | -------------------------------------------------------------------------------- /frontend/lib/redux/slices/userSlice/selectors.ts: -------------------------------------------------------------------------------- 1 | import type { ReduxState } from "@/lib/redux"; 2 | 3 | export const selectUserError = (state: ReduxState) => state.user.error; 4 | export const selectUserWalletAddress = (state: ReduxState) => state.user.walletAddress; 5 | export const selectUserDID = (state: ReduxState) => state.user.did; 6 | export const selectUserTier = (state: ReduxState) => state.user.tier; 7 | export const selectUserIsAdmin = (state: ReduxState) => state.user.isAdmin; 8 | export const selectUserSubscriptionStatus = (state: ReduxState) => state.user.subscriptionStatus; 9 | export const selectIsUserSubscribed = (state: ReduxState) => state.user.subscriptionStatus === 'active'; -------------------------------------------------------------------------------- /frontend/lib/redux/slices/userSlice/thunks.ts: -------------------------------------------------------------------------------- 1 | import { createAppAsyncThunk } from '@/lib/redux/createAppAsyncThunk' 2 | 3 | import { fetchUserData, saveUserDataToServer } from './actions' 4 | 5 | interface UserPayload { 6 | walletAddress: string, 7 | } 8 | 9 | export const saveUserAsync = createAppAsyncThunk( 10 | 'user/saveUserDataToServer', 11 | async ({walletAddress}: {walletAddress: string}) => { 12 | const result = await saveUserDataToServer(walletAddress); 13 | return result; 14 | } 15 | ) 16 | 17 | export const fetchUserDataAsync = createAppAsyncThunk( 18 | 'user/fetchUserData', 19 | async () => { 20 | const result = await fetchUserData(); 21 | return result; 22 | } 23 | ) 24 | 25 | export const refreshUserDataThunk = createAppAsyncThunk( 26 | 'user/refreshUserData', 27 | async (_, { dispatch }) => { 28 | try { 29 | await dispatch(fetchUserDataAsync()).unwrap(); 30 | } catch (error) { 31 | console.error('Failed to refresh user data: ', error); 32 | throw error; 33 | } 34 | } 35 | ) -------------------------------------------------------------------------------- /frontend/lib/redux/store.ts: -------------------------------------------------------------------------------- 1 | /* Core */ 2 | import { type Action,configureStore, type ThunkAction } from '@reduxjs/toolkit' 3 | import { 4 | type TypedUseSelectorHook, 5 | useDispatch as useReduxDispatch, 6 | useSelector as useReduxSelector, 7 | } from 'react-redux' 8 | 9 | import { middleware } from './middleware' 10 | /* Instruments */ 11 | import { reducer } from './rootReducer' 12 | 13 | export const reduxStore = configureStore({ 14 | reducer, 15 | middleware: (getDefaultMiddleware) => { 16 | return getDefaultMiddleware().concat(middleware) 17 | }, 18 | }) 19 | export const useDispatch = () => useReduxDispatch() 20 | export const useSelector: TypedUseSelectorHook = useReduxSelector 21 | 22 | /* Types */ 23 | export type AppDispatch = typeof reduxStore.dispatch 24 | export type ReduxStore = typeof reduxStore 25 | export type ReduxState = ReturnType 26 | export type ReduxDispatch = typeof reduxStore.dispatch 27 | export type ReduxThunkAction = ThunkAction< 28 | ReturnType, 29 | ReduxState, 30 | unknown, 31 | Action 32 | > 33 | -------------------------------------------------------------------------------- /frontend/lib/utils.ts: -------------------------------------------------------------------------------- 1 | import { type ClassValue, clsx } from "clsx"; 2 | import { twMerge } from "tailwind-merge"; 3 | 4 | export function cn(...inputs: ClassValue[]) { 5 | return twMerge(clsx(inputs)); 6 | } 7 | 8 | export function formatCurrency(amount: number, currency = "USD") { 9 | return `${new Intl.NumberFormat("en-US", { 10 | style: "currency", 11 | currency, 12 | }).format(amount)} ${currency}`; 13 | } 14 | -------------------------------------------------------------------------------- /frontend/next.config.mjs: -------------------------------------------------------------------------------- 1 | /** @type {import('next').NextConfig} */ 2 | const nextConfig = { 3 | reactStrictMode: true, 4 | // Molstar makes prod build fail with swcMinify enabled 5 | // https://github.com/molstar/molstar/issues/1046 6 | // https://github.com/vercel/next.js/issues/52373 7 | swcMinify: false, 8 | output: "standalone", 9 | async redirects() { 10 | return [ 11 | { 12 | source: "/", 13 | destination: "/experiments/new/protein-binder-design", 14 | permanent: false, 15 | }, 16 | { 17 | source: "/tasks/:path*", 18 | destination: "/experiments/new/:path*", 19 | permanent: false, 20 | }, 21 | { 22 | source: "/experiments/new", 23 | destination: "/experiments/new/protein-binder-design", 24 | permanent: false, 25 | }, 26 | { 27 | source: "/checkout/success", 28 | destination: "/experiments/new/protein-binder-design", 29 | permanent: false, 30 | }, 31 | { 32 | source: "/checkout/cancel", 33 | destination: "/experiments/new/protein-binder-design", 34 | permanent: false, 35 | }, 36 | ]; 37 | }, 38 | }; 39 | 40 | export default nextConfig; 41 | -------------------------------------------------------------------------------- /frontend/postcss.config.js: -------------------------------------------------------------------------------- 1 | module.exports = { 2 | plugins: { 3 | tailwindcss: {}, 4 | autoprefixer: {}, 5 | }, 6 | } 7 | -------------------------------------------------------------------------------- /frontend/public/browserconfig.xml: -------------------------------------------------------------------------------- 1 | 2 | 3 | 4 | 5 | 6 | #6bdbad 7 | 8 | 9 | 10 | -------------------------------------------------------------------------------- /frontend/public/icons/android-chrome-192x192.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/public/icons/android-chrome-192x192.png -------------------------------------------------------------------------------- /frontend/public/icons/android-chrome-512x512.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/public/icons/android-chrome-512x512.png -------------------------------------------------------------------------------- /frontend/public/icons/apple-touch-icon.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/public/icons/apple-touch-icon.png -------------------------------------------------------------------------------- /frontend/public/icons/favicon-16x16.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/public/icons/favicon-16x16.png -------------------------------------------------------------------------------- /frontend/public/icons/favicon-32x32.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/public/icons/favicon-32x32.png -------------------------------------------------------------------------------- /frontend/public/icons/favicon.ico: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/public/icons/favicon.ico -------------------------------------------------------------------------------- /frontend/public/icons/mstile-144x144.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/public/icons/mstile-144x144.png -------------------------------------------------------------------------------- /frontend/public/icons/mstile-150x150.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/public/icons/mstile-150x150.png -------------------------------------------------------------------------------- /frontend/public/icons/mstile-310x150.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/public/icons/mstile-310x150.png -------------------------------------------------------------------------------- /frontend/public/icons/mstile-310x310.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/public/icons/mstile-310x310.png -------------------------------------------------------------------------------- /frontend/public/icons/mstile-70x70.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/public/icons/mstile-70x70.png -------------------------------------------------------------------------------- /frontend/public/images/task-community-models.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/public/images/task-community-models.png -------------------------------------------------------------------------------- /frontend/public/images/task-protein-binder-design.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/public/images/task-protein-binder-design.png -------------------------------------------------------------------------------- /frontend/public/images/task-protein-docking.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/public/images/task-protein-docking.png -------------------------------------------------------------------------------- /frontend/public/images/task-protein-folding.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/public/images/task-protein-folding.png -------------------------------------------------------------------------------- /frontend/public/images/task-small-molecule-docking.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/frontend/public/images/task-small-molecule-docking.png -------------------------------------------------------------------------------- /frontend/public/site.webmanifest: -------------------------------------------------------------------------------- 1 | { 2 | "name": "", 3 | "short_name": "", 4 | "icons": [ 5 | { 6 | "src": "/icons/android-chrome-192x192.png", 7 | "sizes": "192x192", 8 | "type": "image/png" 9 | }, 10 | { 11 | "src": "/icons/android-chrome-512x512.png", 12 | "sizes": "512x512", 13 | "type": "image/png" 14 | } 15 | ], 16 | "theme_color": "#ffffff", 17 | "background_color": "#ffffff", 18 | "display": "standalone" 19 | } 20 | -------------------------------------------------------------------------------- /frontend/run.sh: -------------------------------------------------------------------------------- 1 | #!/bin/sh 2 | 3 | set -eoux pipefail 4 | 5 | echo "Dummping envs into file for nodejs" 6 | 7 | env > /app/.env.${NODE_ENV:-local} 8 | 9 | exec node server.js 10 | -------------------------------------------------------------------------------- /frontend/tsconfig.json: -------------------------------------------------------------------------------- 1 | { 2 | "$schema": "https://json.schemastore.org/tsconfig", 3 | "compilerOptions": { 4 | "baseUrl": ".", 5 | "paths": { "@/*": ["./*"] }, 6 | "target": "ESNext", 7 | "lib": ["DOM", "DOM.Iterable", "ESNext"], 8 | "allowJs": true, 9 | "skipLibCheck": true, 10 | "strict": true, 11 | "forceConsistentCasingInFileNames": true, 12 | "noEmit": true, 13 | "esModuleInterop": true, 14 | "module": "ESNEXT", 15 | "moduleResolution": "node", 16 | "resolveJsonModule": true, 17 | "isolatedModules": true, 18 | "jsx": "preserve", 19 | "incremental": true, 20 | "plugins": [{ "name": "next" }] 21 | }, 22 | "include": ["next-env.d.ts", "**/*.ts", "**/*.tsx", ".next/types/**/*.ts"], 23 | "exclude": ["node_modules"] 24 | } 25 | -------------------------------------------------------------------------------- /gateway/README.md: -------------------------------------------------------------------------------- 1 | # Setup 2 | 3 | * Install [docker](https://docs.docker.com/engine/install/) 4 | * Define necessary env variables 5 | ``` 6 | NEXT_PUBLIC_BACKEND_URL=http://localhost:8080 7 | FRONTEND_URL=http://localhost:3000 8 | POSTGRES_PASSWORD=MAKE_UP_SOMETHING_RANDOM 9 | POSTGRES_USER=labdao 10 | POSTGRES_DB=labdao 11 | POSTGRES_HOST=localhost 12 | ``` 13 | * Recommended: Install [direnv](https://direnv.net/). With it installed you can create `.env` file with the above environment variables and have them automagically set when you descend into the folder. 14 | 15 | # Start the database 16 | 17 | ``` 18 | docker compose up -d 19 | ``` 20 | 21 | Note: New docker installation include docker compose, older installations required you install docker-compose separately and run `docker-compose up -d` 22 | 23 | # Frontend start command 24 | 25 | from ./gateway/frontend 26 | ``` 27 | npm run dev 28 | ``` 29 | 30 | # Backend start command 31 | 32 | from ./gateway 33 | ``` 34 | go run app.go 35 | ``` 36 | -------------------------------------------------------------------------------- /gateway/handlers/healthcheck.go: -------------------------------------------------------------------------------- 1 | package handlers 2 | 3 | import ( 4 | "fmt" 5 | "net/http" 6 | ) 7 | 8 | func HealthCheckHandler() http.HandlerFunc { 9 | return func(w http.ResponseWriter, r *http.Request) { 10 | w.WriteHeader(http.StatusOK) 11 | fmt.Fprintf(w, "Healthy") 12 | } 13 | } 14 | -------------------------------------------------------------------------------- /gateway/migrations/10_update_other_to_community_models.up.sql: -------------------------------------------------------------------------------- 1 | UPDATE tools 2 | SET task_category = 'community-models' 3 | WHERE task_category = 'other-models'; 4 | 5 | ALTER TABLE tools 6 | ALTER COLUMN task_category SET DEFAULT 'community-models'; -------------------------------------------------------------------------------- /gateway/migrations/11_add_s3_info_to_jobs.down.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE jobs 2 | DROP COLUMN job_uuid; -------------------------------------------------------------------------------- /gateway/migrations/11_add_s3_info_to_jobs.up.sql: -------------------------------------------------------------------------------- 1 | -- change the file name later 2 | ALTER TABLE jobs 3 | ADD COLUMN job_uuid UUID; -------------------------------------------------------------------------------- /gateway/migrations/12_populate_generated_datafile_wallet_address.up.sql: -------------------------------------------------------------------------------- 1 | WITH mismatched_wallets AS ( 2 | SELECT df.cid, j.wallet_address 3 | FROM data_files df 4 | INNER JOIN job_output_files jof ON df.cid = jof.data_file_c_id 5 | INNER JOIN jobs j ON j.id = jof.job_id 6 | WHERE df.wallet_address != j.wallet_address 7 | and df.wallet_address = '' 8 | ) 9 | UPDATE data_files df 10 | SET wallet_address = mw.wallet_address 11 | FROM mismatched_wallets mw 12 | WHERE df.cid = mw.cid; -------------------------------------------------------------------------------- /gateway/migrations/13_add_user_admins.down.sql: -------------------------------------------------------------------------------- 1 | -- Down migration to remove the 'admin' column from the 'users' table 2 | ALTER TABLE users DROP COLUMN admin; -------------------------------------------------------------------------------- /gateway/migrations/13_add_user_admins.up.sql: -------------------------------------------------------------------------------- 1 | -- Up migration to add the 'admin' column to the 'users' table 2 | ALTER TABLE users ADD COLUMN admin BOOLEAN DEFAULT false; -------------------------------------------------------------------------------- /gateway/migrations/14_add_datafile_public_attribute.down.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE `data_files` 2 | DROP COLUMN `public`; -------------------------------------------------------------------------------- /gateway/migrations/14_add_datafile_public_attribute.up.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE data_files 2 | ADD COLUMN public BOOLEAN NOT NULL DEFAULT FALSE; -------------------------------------------------------------------------------- /gateway/migrations/15_create_user_data_file_table.up.sql: -------------------------------------------------------------------------------- 1 | CREATE TABLE user_datafiles ( 2 | wallet_address varchar(42) NOT NULL, 3 | data_file_c_id varchar(255) NOT NULL, 4 | created_at timestamp DEFAULT CURRENT_TIMESTAMP, 5 | CONSTRAINT pk_user_datafiles PRIMARY KEY (wallet_address, data_file_c_id), 6 | CONSTRAINT fk_user_datafiles_wallet_address FOREIGN KEY (wallet_address) REFERENCES users(wallet_address), 7 | CONSTRAINT fk_user_datafiles_data_file FOREIGN KEY (data_file_c_id) REFERENCES data_files(cid) 8 | ); 9 | 10 | INSERT INTO user_datafiles (wallet_address, data_file_c_id, created_at) 11 | SELECT wallet_address, cid, COALESCE(timestamp, CURRENT_TIMESTAMP) 12 | FROM data_files; 13 | 14 | -- below steps will be done as a separate migration after we test and make sure the above information has been copied over correctly 15 | -- ALTER TABLE data_files 16 | -- DROP COLUMN wallet_address, 17 | -- DROP COLUMN timestamp; 18 | -------------------------------------------------------------------------------- /gateway/migrations/16_add_flow_public_attribute.down.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE flows 2 | DROP COLUMN public; -------------------------------------------------------------------------------- /gateway/migrations/16_add_flow_public_attribute.up.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE flows 2 | ADD COLUMN public BOOLEAN NOT NULL DEFAULT FALSE; -------------------------------------------------------------------------------- /gateway/migrations/17_add_job_public_attribute.down.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE jobs 2 | DROP COLUMN public; -------------------------------------------------------------------------------- /gateway/migrations/17_add_job_public_attribute.up.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE jobs 2 | ADD COLUMN public BOOLEAN NOT NULL DEFAULT FALSE; -------------------------------------------------------------------------------- /gateway/migrations/18_add_exp_uuid.down.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE flows 2 | DROP COLUMN flow_uuid; -------------------------------------------------------------------------------- /gateway/migrations/18_add_exp_uuid.up.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE flows 2 | ADD COLUMN flow_uuid UUID; -------------------------------------------------------------------------------- /gateway/migrations/19_add_flow_record_cid_attribute.down.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE flows DROP COLUMN record_cid; -------------------------------------------------------------------------------- /gateway/migrations/19_add_flow_record_cid_attribute.up.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE flows ADD COLUMN record_cid VARCHAR(255); -------------------------------------------------------------------------------- /gateway/migrations/1_initial_schema.down.sql: -------------------------------------------------------------------------------- 1 | -- Drop many-to-many relation tables 2 | DROP TABLE IF EXISTS job_inputs; 3 | DROP TABLE IF EXISTS job_outputs; 4 | 5 | -- Drop users table 6 | DROP TABLE IF EXISTS users; 7 | 8 | -- Drop tools table 9 | DROP TABLE IF EXISTS tools; 10 | 11 | -- Drop jobs table along with its indexes 12 | DROP INDEX IF EXISTS idx_jobs_tool_id; 13 | DROP INDEX IF EXISTS idx_jobs_flow_id; 14 | DROP TABLE IF EXISTS jobs; 15 | 16 | -- Drop flows table 17 | DROP TABLE IF EXISTS flows; 18 | 19 | -- Drop data_files table 20 | DROP TABLE IF EXISTS data_files; 21 | -------------------------------------------------------------------------------- /gateway/migrations/20_add_job_retry_max_runtime.down.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE jobs 2 | DROP COLUMN retry_count; 3 | 4 | ALTER TABLE tools 5 | DROP COLUMN max_running_time; -------------------------------------------------------------------------------- /gateway/migrations/20_add_job_retry_max_runtime.up.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE jobs 2 | ADD COLUMN retry_count INT DEFAULT 0; 3 | 4 | ALTER TABLE tools 5 | ADD COLUMN max_running_time INT DEFAULT 2700; -------------------------------------------------------------------------------- /gateway/migrations/21_jobs_job_type.down.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE jobs DROP COLUMN job_type; 2 | ALTER TABLE jobs RENAME COLUMN job_id TO bacalhau_job_id; -------------------------------------------------------------------------------- /gateway/migrations/21_jobs_job_type.up.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE jobs RENAME COLUMN bacalhau_job_id TO job_id; 2 | ALTER TABLE jobs ADD COLUMN job_type VARCHAR(255) NOT NULL DEFAULT 'bacalhau'; -------------------------------------------------------------------------------- /gateway/migrations/22_add_job_result_json_column.down.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE jobs 2 | DROP COLUMN result_json; -------------------------------------------------------------------------------- /gateway/migrations/22_add_job_result_json_column.up.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE jobs 2 | ADD COLUMN result_json JSONB; -------------------------------------------------------------------------------- /gateway/migrations/23_datafile_s3_location_columns.down.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE datafile DROP COLUMN s3_bucket; 2 | ALTER TABLE datafile DROP COLUMN s3_location; -------------------------------------------------------------------------------- /gateway/migrations/23_datafile_s3_location_columns.up.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE data_files ADD COLUMN s3_bucket VARCHAR(255); 2 | ALTER TABLE data_files ADD COLUMN s3_location VARCHAR(255); -------------------------------------------------------------------------------- /gateway/migrations/24_tool_ray_service_endpoint_rename.down.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE tools DROP COLUMN ray_service_endpoint VARCHAR(255); -------------------------------------------------------------------------------- /gateway/migrations/24_tool_ray_service_endpoint_rename.up.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE tools ADD COLUMN ray_service_endpoint VARCHAR(255); -------------------------------------------------------------------------------- /gateway/migrations/25_s3_uri_in_datafile_table.down.sql: -------------------------------------------------------------------------------- 1 | BEGIN; 2 | 3 | ALTER TABLE data_files ADD COLUMN s3_bucket VARCHAR(255); 4 | ALTER TABLE data_files ADD COLUMN s3_location VARCHAR(255); 5 | 6 | UPDATE data_files 7 | SET s3_bucket = SPLIT_PART(SUBSTRING(s3_uri FROM 6), '/', 1) 8 | WHERE s3_uri LIKE 's3://%/%'; 9 | 10 | UPDATE data_files 11 | SET s3_location = SUBSTRING(s3_uri FROM LENGTH(SPLIT_PART(SUBSTRING(s3_uri FROM 6), '/', 1)) + 7) 12 | WHERE s3_uri LIKE 's3://%/%'; 13 | 14 | ALTER TABLE data_files DROP COLUMN s3_uri; 15 | 16 | COMMIT; 17 | -------------------------------------------------------------------------------- /gateway/migrations/25_s3_uri_in_datafile_table.up.sql: -------------------------------------------------------------------------------- 1 | BEGIN; 2 | 3 | ALTER TABLE data_files ADD COLUMN s3_uri VARCHAR(255); 4 | 5 | UPDATE data_files 6 | SET s3_uri = CONCAT( 7 | 's3://', 8 | s3_bucket, 9 | CASE 10 | WHEN LEFT(s3_location, 1) != '/' THEN '/' 11 | ELSE '' 12 | END, 13 | s3_location 14 | ) 15 | WHERE s3_bucket IS NOT NULL AND s3_location IS NOT NULL; 16 | 17 | ALTER TABLE data_files DROP COLUMN s3_bucket; 18 | ALTER TABLE data_files DROP COLUMN s3_location; 19 | 20 | COMMIT; 21 | -------------------------------------------------------------------------------- /gateway/migrations/26_tool_s3_uri_column.down.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE tools ADD COLUMN s3_uri VARCHAR(255); -------------------------------------------------------------------------------- /gateway/migrations/26_tool_s3_uri_column.up.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE tools ADD COLUMN s3_uri VARCHAR(255); -------------------------------------------------------------------------------- /gateway/migrations/27_flow_drop_cid.down.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE flows ADD COLUMN cid VARCHAR(255); -------------------------------------------------------------------------------- /gateway/migrations/27_flow_drop_cid.up.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE flows DROP COLUMN cid; -------------------------------------------------------------------------------- /gateway/migrations/28_job_id_updates.up copy.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE jobs RENAME COLUMN ray_job_id TO job_id; 2 | ALTER TABLE jobs ADD COLUMN job_uuid UUID; -------------------------------------------------------------------------------- /gateway/migrations/28_job_id_updates.up.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE jobs RENAME COLUMN job_id TO ray_job_id; 2 | ALTER TABLE jobs DROP COLUMN job_uuid; -------------------------------------------------------------------------------- /gateway/migrations/29_add_tier_and_compute_tally.down.sql: -------------------------------------------------------------------------------- 1 | -- Remove the 'compute_tally' column from the 'users' table 2 | ALTER TABLE users DROP COLUMN compute_tally; 3 | 4 | -- Remove the 'tier' column from the 'users' table 5 | ALTER TABLE users DROP COLUMN tier; -------------------------------------------------------------------------------- /gateway/migrations/29_add_tier_and_compute_tally.up.sql: -------------------------------------------------------------------------------- 1 | -- Add the 'tier' column to the 'users' table 2 | ALTER TABLE users ADD COLUMN tier INTEGER NOT NULL DEFAULT 0; 3 | 4 | -- Add the 'compute_tally' column to the 'users' table 5 | ALTER TABLE users ADD COLUMN compute_tally INTEGER NOT NULL DEFAULT 0; -------------------------------------------------------------------------------- /gateway/migrations/2_add_tags_schema.down.sql: -------------------------------------------------------------------------------- 1 | -- Drop many-to-many relation table between data_files and tags 2 | DROP TABLE IF EXISTS datafile_tags; 3 | 4 | -- Drop tags table 5 | DROP TABLE IF EXISTS tags; 6 | -------------------------------------------------------------------------------- /gateway/migrations/2_add_tags_schema.up.sql: -------------------------------------------------------------------------------- 1 | -- Create tags table 2 | CREATE TABLE tags ( 3 | name VARCHAR(255) NOT NULL PRIMARY KEY, 4 | type VARCHAR(100) NOT NULL 5 | ); 6 | 7 | -- Create many-to-many relation table between data_files and tags 8 | CREATE TABLE datafile_tags ( 9 | data_file_c_id VARCHAR(255) NOT NULL, 10 | tag_name VARCHAR(255) NOT NULL, 11 | PRIMARY KEY (data_file_c_id, tag_name), 12 | FOREIGN KEY (data_file_c_id) REFERENCES data_files(cid), 13 | FOREIGN KEY (tag_name) REFERENCES tags(name) 14 | ); 15 | -------------------------------------------------------------------------------- /gateway/migrations/30_add_compute_cost.down.sql: -------------------------------------------------------------------------------- 1 | -- Remove the 'compute_cost' column from the 'tools' table 2 | ALTER TABLE tools DROP COLUMN compute_cost; -------------------------------------------------------------------------------- /gateway/migrations/30_add_compute_cost.up.sql: -------------------------------------------------------------------------------- 1 | -- Add the 'compute_cost' column to the 'tools' table 2 | ALTER TABLE tools ADD COLUMN compute_cost INTEGER NOT NULL DEFAULT 0; -------------------------------------------------------------------------------- /gateway/migrations/31_add_stripe_user_id.down.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE users DROP COLUMN stripe_user_id; -------------------------------------------------------------------------------- /gateway/migrations/31_add_stripe_user_id.up.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE users ADD COLUMN stripe_user_id VARCHAR(255) UNIQUE; -------------------------------------------------------------------------------- /gateway/migrations/32_flow_to_experiment_rename.down.sql: -------------------------------------------------------------------------------- 1 | BEGIN; 2 | 3 | ALTER TABLE experiments RENAME TO flows; 4 | 5 | ALTER TABLE flows RENAME COLUMN experiment_uuid TO flow_uuid; 6 | 7 | ALTER TABLE jobs RENAME COLUMN experiment_id TO flow_id; 8 | 9 | DROP INDEX idx_jobs_experiment_id; 10 | CREATE INDEX idx_jobs_flow_id ON jobs USING btree (flow_id); 11 | 12 | ALTER SEQUENCE experiments_id_seq RENAME TO flows_id_seq; 13 | 14 | ALTER TABLE flows RENAME CONSTRAINT experiments_pkey TO flows_pkey; 15 | ALTER TABLE jobs RENAME CONSTRAINT jobs_experimentid_fkey TO jobs_flowid_fkey; 16 | 17 | COMMIT; -------------------------------------------------------------------------------- /gateway/migrations/32_flow_to_experiment_rename.up.sql: -------------------------------------------------------------------------------- 1 | BEGIN; 2 | 3 | ALTER TABLE flows RENAME TO experiments; 4 | 5 | ALTER TABLE experiments RENAME COLUMN flow_uuid TO experiment_uuid; 6 | 7 | ALTER TABLE jobs RENAME COLUMN flow_id TO experiment_id; 8 | 9 | DROP INDEX idx_jobs_flow_id; 10 | CREATE INDEX idx_jobs_experiment_id ON jobs USING btree (experiment_id); 11 | 12 | ALTER SEQUENCE flows_id_seq RENAME TO experiments_id_seq; 13 | 14 | ALTER TABLE experiments RENAME CONSTRAINT flows_pkey TO experiments_pkey; 15 | ALTER TABLE jobs RENAME CONSTRAINT jobs_flowid_fkey TO jobs_experimentid_fkey; 16 | 17 | COMMIT; -------------------------------------------------------------------------------- /gateway/migrations/33_datafile_to_file_rename.down.sql: -------------------------------------------------------------------------------- 1 | BEGIN; 2 | 3 | ALTER TABLE files RENAME TO data_files; 4 | ALTER TABLE file_tags RENAME TO datafile_tags; 5 | ALTER TABLE user_files RENAME TO user_datafiles; 6 | 7 | ALTER TABLE datafile_tags RENAME file_c_id TO data_file_c_id; 8 | ALTER TABLE user_datafiles RENAME file_c_id TO data_file_c_id; 9 | 10 | ALTER TABLE job_input_files RENAME COLUMN file_c_id TO data_file_c_id; 11 | ALTER TABLE job_output_files RENAME COLUMN file_c_id TO data_file_c_id; 12 | 13 | ALTER TABLE data_files RENAME CONSTRAINT files_pkey TO data_files_pkey; 14 | 15 | ALTER TABLE datafile_tags RENAME CONSTRAINT file_tags_pkey TO datafile_tags_pkey; 16 | ALTER TABLE datafile_tags RENAME CONSTRAINT file_tags_file_c_id_fkey TO datafile_tags_data_file_c_id_fkey; 17 | ALTER TABLE datafile_tags RENAME CONSTRAINT file_tags_tag_name_fkey TO datafile_tags_tag_name_fkey; 18 | 19 | ALTER TABLE user_datafiles RENAME CONSTRAINT pk_user_files TO pk_user_datafiles; 20 | ALTER TABLE user_datafiles RENAME CONSTRAINT fk_user_files_file TO fk_user_datafiles_data_file; 21 | ALTER TABLE user_datafiles RENAME CONSTRAINT fk_user_files_wallet_address TO fk_user_datafiles_wallet_address; 22 | 23 | ALTER TABLE job_input_files RENAME CONSTRAINT job_input_files_file_c_id_fkey TO job_input_files_data_file_c_id_fkey; 24 | ALTER TABLE job_output_files RENAME CONSTRAINT job_output_files_file_c_id_fkey TO job_output_files_data_file_c_id_fkey; 25 | 26 | COMMIT; -------------------------------------------------------------------------------- /gateway/migrations/33_datafile_to_file_rename.up.sql: -------------------------------------------------------------------------------- 1 | BEGIN; 2 | 3 | ALTER TABLE data_files RENAME TO files; 4 | ALTER TABLE datafile_tags RENAME TO file_tags; 5 | ALTER TABLE user_datafiles RENAME TO user_files; 6 | 7 | ALTER TABLE file_tags RENAME data_file_c_id TO file_c_id; 8 | ALTER TABLE user_files RENAME data_file_c_id TO file_c_id; 9 | 10 | ALTER TABLE job_input_files RENAME COLUMN data_file_c_id TO file_c_id; 11 | ALTER TABLE job_output_files RENAME COLUMN data_file_c_id TO file_c_id; 12 | 13 | ALTER TABLE files RENAME CONSTRAINT data_files_pkey TO files_pkey; 14 | 15 | ALTER TABLE file_tags RENAME CONSTRAINT datafile_tags_pkey TO file_tags_pkey; 16 | ALTER TABLE file_tags RENAME CONSTRAINT datafile_tags_data_file_c_id_fkey TO file_tags_file_c_id_fkey; 17 | ALTER TABLE file_tags RENAME CONSTRAINT datafile_tags_tag_name_fkey TO file_tags_tag_name_fkey; 18 | 19 | ALTER TABLE user_files RENAME CONSTRAINT pk_user_datafiles TO pk_user_files; 20 | ALTER TABLE user_files RENAME CONSTRAINT fk_user_datafiles_data_file TO fk_user_files_file; 21 | ALTER TABLE user_files RENAME CONSTRAINT fk_user_datafiles_wallet_address TO fk_user_files_wallet_address; 22 | 23 | ALTER TABLE job_input_files RENAME CONSTRAINT job_input_files_data_file_c_id_fkey TO job_input_files_file_c_id_fkey; 24 | ALTER TABLE job_output_files RENAME CONSTRAINT job_output_files_data_file_c_id_fkey TO job_output_files_file_c_id_fkey; 25 | 26 | COMMIT; -------------------------------------------------------------------------------- /gateway/migrations/34_tool_to_model_rename.down.sql: -------------------------------------------------------------------------------- 1 | BEGIN; 2 | 3 | ALTER TABLE models RENAME TO tools; 4 | 5 | ALTER TABLE jobs RENAME COLUMN model_id TO tool_id; 6 | ALTER TABLE tools RENAME model_json TO tool_json; 7 | ALTER TABLE tools RENAME COLUMN default_model TO default_tool; 8 | 9 | DROP INDEX idx_jobs_model_id; 10 | CREATE INDEX idx_jobs_tool_id ON jobs USING btree (tool_id); 11 | 12 | ALTER TABLE tools RENAME CONSTRAINT models_name_key TO tools_name_key; 13 | ALTER TABLE tools RENAME CONSTRAINT models_pkey TO tools_pkey; 14 | 15 | COMMIT; -------------------------------------------------------------------------------- /gateway/migrations/34_tool_to_model_rename.up.sql: -------------------------------------------------------------------------------- 1 | BEGIN; 2 | 3 | ALTER TABLE tools RENAME TO models; 4 | 5 | ALTER TABLE jobs RENAME COLUMN tool_id TO model_id; 6 | ALTER TABLE models RENAME tool_json TO model_json; 7 | ALTER TABLE models RENAME COLUMN default_tool TO default_model; 8 | 9 | DROP INDEX idx_jobs_tool_id; 10 | CREATE INDEX idx_jobs_model_id ON jobs USING btree (model_id); 11 | 12 | ALTER TABLE models RENAME CONSTRAINT tools_name_key TO models_name_key; 13 | ALTER TABLE models RENAME CONSTRAINT tools_pkey TO models_pkey; 14 | 15 | COMMIT; -------------------------------------------------------------------------------- /gateway/migrations/36_user_subscriptions.down.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE users 2 | DROP COLUMN subscription_status, 3 | DROP COLUMN subscription_id; -------------------------------------------------------------------------------- /gateway/migrations/36_user_subscriptions.up.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE users 2 | ADD COLUMN subscription_status VARCHAR(255), 3 | ADD COLUMN subscription_id VARCHAR(255) UNIQUE NULL; -------------------------------------------------------------------------------- /gateway/migrations/37_filehash_nullable.down.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE files ALTER COLUMN file_hash SET NOT NULL; -------------------------------------------------------------------------------- /gateway/migrations/37_filehash_nullable.up.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE files ALTER COLUMN file_hash DROP NOT NULL; -------------------------------------------------------------------------------- /gateway/migrations/38_job_type_column.down.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE jobs DROP COLUMN IF EXISTS job_type; 2 | ALTER TABLE experiments DROP COLUMN IF EXISTS experiment_uuid; -------------------------------------------------------------------------------- /gateway/migrations/38_job_type_column.up.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE jobs ADD COLUMN IF NOT EXISTS job_type VARCHAR; 2 | ALTER TABLE experiments ADD COLUMN IF NOT EXISTS experiment_uuid VARCHAR; -------------------------------------------------------------------------------- /gateway/migrations/39_inference_event_filename_column.down.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE inference_events DROP COLUMN IF EXISTS file_name; -------------------------------------------------------------------------------- /gateway/migrations/39_inference_event_filename_column.up.sql: -------------------------------------------------------------------------------- 1 | ALTER TABLE inference_events ADD COLUMN IF NOT EXISTS file_name VARCHAR; -------------------------------------------------------------------------------- /gateway/migrations/3_seed_tags_table.down.sql: -------------------------------------------------------------------------------- 1 | -- Remove seeded entries from tags table 2 | DELETE FROM tags WHERE name IN ('uploaded', 'generated'); 3 | -------------------------------------------------------------------------------- /gateway/migrations/3_seed_tags_table.up.sql: -------------------------------------------------------------------------------- 1 | -- Seed tags table with predefined values 2 | INSERT INTO tags (name, type) VALUES 3 | ('uploaded', 'autogenerated'), 4 | ('generated', 'autogenerated') 5 | ON CONFLICT (name) DO NOTHING; -- This prevents duplication if the migration is run multiple times 6 | -------------------------------------------------------------------------------- /gateway/migrations/4_add_timestamps.down.sql: -------------------------------------------------------------------------------- 1 | -- Remove StartTime and EndTime columns from flows table 2 | ALTER TABLE flows 3 | DROP COLUMN IF EXISTS start_time, 4 | DROP COLUMN IF EXISTS end_time; 5 | 6 | -- Remove Timestamp column from tools table 7 | ALTER TABLE tools 8 | DROP COLUMN IF EXISTS timestamp; 9 | 10 | -- Remove CreatedAt column from users table 11 | ALTER TABLE users 12 | DROP COLUMN IF EXISTS created_at; 13 | 14 | -- Remove CreatedAt, StartedAt, CompletedAt columns from jobs table 15 | ALTER TABLE jobs 16 | DROP COLUMN IF EXISTS created_at, 17 | DROP COLUMN IF EXISTS started_at, 18 | DROP COLUMN IF EXISTS completed_at; 19 | -------------------------------------------------------------------------------- /gateway/migrations/4_add_timestamps.up.sql: -------------------------------------------------------------------------------- 1 | -- Add StartTime and EndTime columns to flows table 2 | ALTER TABLE flows 3 | ADD COLUMN start_time TIMESTAMP, 4 | ADD COLUMN end_time TIMESTAMP; 5 | 6 | -- Add Timestamp column to tools table 7 | ALTER TABLE tools 8 | ADD COLUMN timestamp TIMESTAMP; 9 | 10 | -- Add CreatedAt column to users table 11 | ALTER TABLE users 12 | ADD COLUMN created_at TIMESTAMP; 13 | 14 | -- Add CreatedAt, StartedAt, CompletedAt columns to jobs table 15 | ALTER TABLE jobs 16 | ADD COLUMN created_at TIMESTAMP, 17 | ADD COLUMN started_at TIMESTAMP, 18 | ADD COLUMN completed_at TIMESTAMP; 19 | -------------------------------------------------------------------------------- /gateway/migrations/6_add_tool_flags.down.sql: -------------------------------------------------------------------------------- 1 | -- This migration removes the display, task_category, and default_tool columns from the tools table. 2 | ALTER TABLE tools DROP COLUMN display; 3 | ALTER TABLE tools DROP COLUMN task_category; 4 | ALTER TABLE tools DROP COLUMN default_tool; 5 | -------------------------------------------------------------------------------- /gateway/migrations/6_add_tool_flags.up.sql: -------------------------------------------------------------------------------- 1 | -- This migration adds the display, task_category, and default_tool flags to the tools table. 2 | ALTER TABLE tools ADD COLUMN display BOOLEAN DEFAULT true; 3 | ALTER TABLE tools ADD COLUMN task_category VARCHAR(255) DEFAULT 'other-models'; 4 | ALTER TABLE tools ADD COLUMN default_tool BOOLEAN DEFAULT false; -------------------------------------------------------------------------------- /gateway/migrations/7_add_api_keys_table.down.sql: -------------------------------------------------------------------------------- 1 | DROP TABLE IF EXISTS api_keys; 2 | -------------------------------------------------------------------------------- /gateway/migrations/7_add_api_keys_table.up.sql: -------------------------------------------------------------------------------- 1 | CREATE TABLE api_keys ( 2 | id SERIAL PRIMARY KEY, 3 | key VARCHAR(255) NOT NULL UNIQUE, 4 | scope VARCHAR(255) NOT NULL, 5 | created_at TIMESTAMP NOT NULL, 6 | expires_at TIMESTAMP NOT NULL, 7 | user_id VARCHAR(42) NOT NULL, 8 | CONSTRAINT fk_user FOREIGN KEY (user_id) REFERENCES users(wallet_address) 9 | ); 10 | -------------------------------------------------------------------------------- /gateway/migrations/8_add_api_keys_to_users.down.sql: -------------------------------------------------------------------------------- 1 | -- Remove the DID column from the users table 2 | ALTER TABLE users 3 | DROP COLUMN did; 4 | 5 | -- Remove the foreign key constraint from the api_keys table 6 | ALTER TABLE api_keys 7 | DROP CONSTRAINT fk_user; -------------------------------------------------------------------------------- /gateway/migrations/8_add_api_keys_to_users.up.sql: -------------------------------------------------------------------------------- 1 | -- Add the DID column to the users table 2 | ALTER TABLE users 3 | ADD COLUMN did VARCHAR(255) UNIQUE; 4 | 5 | -- Ensure the foreign key constraint from the api_keys table to the users table is correct 6 | ALTER TABLE api_keys 7 | DROP CONSTRAINT IF EXISTS fk_user, 8 | ADD CONSTRAINT fk_user FOREIGN KEY (user_id) REFERENCES users(wallet_address); -------------------------------------------------------------------------------- /gateway/migrations/9_add_transaction_table.down.sql: -------------------------------------------------------------------------------- 1 | DROP TABLE IF EXISTS transactions; 2 | -------------------------------------------------------------------------------- /gateway/migrations/9_add_transaction_table.up.sql: -------------------------------------------------------------------------------- 1 | CREATE TABLE transactions ( 2 | id VARCHAR(255) PRIMARY KEY, 3 | amount FLOAT NOT NULL, 4 | is_debit BOOLEAN NOT NULL, 5 | user_id VARCHAR(42) NOT NULL, 6 | description TEXT, 7 | created_at TIMESTAMP WITHOUT TIME ZONE DEFAULT (now() at time zone 'utc'), 8 | FOREIGN KEY (user_id) REFERENCES users(wallet_address) ON DELETE CASCADE 9 | ); 10 | 11 | -------------------------------------------------------------------------------- /gateway/models/design.go: -------------------------------------------------------------------------------- 1 | package models 2 | 3 | import "gorm.io/datatypes" 4 | 5 | type Design struct { 6 | ID int `json:"id"` 7 | JobID int `json:"job_id"` 8 | XAxisValue string `json:"x_axis_value"` 9 | YAxisValue string `json:"y_axis_value"` 10 | CheckpointPDBID int `json:"checkpoint_pdb_id"` 11 | AdditionalDetails datatypes.JSON `json:""` 12 | } 13 | -------------------------------------------------------------------------------- /gateway/models/experiment.go: -------------------------------------------------------------------------------- 1 | package models 2 | 3 | import "time" 4 | 5 | type Experiment struct { 6 | ID uint `gorm:"primaryKey;autoIncrement"` 7 | Jobs []Job `gorm:"foreignKey:ExperimentID"` 8 | Name string `gorm:"type:varchar(255);"` 9 | Public bool `gorm:"type:boolean;not null;default:false"` 10 | RecordCID string `gorm:"column:record_cid;type:varchar(255);"` 11 | WalletAddress string `gorm:"type:varchar(42);not null"` 12 | CreatedAt time.Time `gorm:"autoCreateTime"` 13 | ExperimentUUID string `gorm:"type:varchar(255);"` 14 | } 15 | -------------------------------------------------------------------------------- /gateway/models/file.go: -------------------------------------------------------------------------------- 1 | package models 2 | 3 | import ( 4 | "time" 5 | ) 6 | 7 | type File struct { 8 | ID int `gorm:"primaryKey;autoIncrement"` 9 | FileHash string `gorm:"type:varchar(64)"` 10 | WalletAddress string `gorm:"type:varchar(42);not null"` 11 | Filename string `gorm:"type:varchar(255);not null"` 12 | InputFiles []Job `gorm:"many2many:job_input_files;foreignKey:ID;joinForeignKey:file_id;References:ID;JoinReferences:job_id"` 13 | OutputFiles []Job `gorm:"many2many:job_output_files;foreignKey:ID;joinForeignKey:file_id;inverseJoinForeignKey:job_id"` 14 | Tags []Tag `gorm:"many2many:file_tags;foreignKey:ID;joinForeignKey:file_id;inverseJoinForeignKey:tag_name"` 15 | Public bool `gorm:"type:boolean;not null;default:false"` 16 | UserFiles []User `gorm:"many2many:user_files;foreignKey:ID;joinForeignKey:file_id;inverseJoinForeignKey:wallet_address"` 17 | S3URI string `gorm:"type:varchar(255)"` 18 | CreatedAt time.Time `gorm:"autoCreateTime"` 19 | LastModifiedAt time.Time `gorm:"autoUpdateTime"` 20 | } 21 | -------------------------------------------------------------------------------- /gateway/models/fileevent.go: -------------------------------------------------------------------------------- 1 | package models 2 | 3 | import "time" 4 | 5 | type FileEvent struct { 6 | ID int `json:"id"` 7 | FileID int `json:"file_id"` 8 | WalletAddress string `json:"wallet_address"` 9 | EventTime time.Time `json:"event_time"` 10 | EventType string `json:"event_type"` 11 | } 12 | -------------------------------------------------------------------------------- /gateway/models/inferenceevent.go: -------------------------------------------------------------------------------- 1 | package models 2 | 3 | import ( 4 | "time" 5 | 6 | "gorm.io/datatypes" 7 | ) 8 | 9 | // event type can only be certain string values 10 | const ( 11 | EventTypeJobQueued = "job_queued" 12 | EventTypeJobProcessing = "job_processing" 13 | EventTypeJobPending = "job_pending" 14 | EventTypeJobRunning = "job_running" 15 | EventTypeJobStopped = "job_stopped" 16 | EventTypeJobSucceeded = "job_succeeded" 17 | EventTypeJobFailed = "job_failed" 18 | EventTypeFileProcessed = "file_processed" 19 | ) 20 | 21 | // retry default 0? 22 | type InferenceEvent struct { 23 | ID uint `gorm:"primaryKey;autoIncrement"` 24 | JobID uint `gorm:"not null"` 25 | Job Job `gorm:"foreignKey:JobID"` 26 | RayJobID string `gorm:"type:varchar(255);not null"` 27 | InputJson datatypes.JSON `gorm:"type:json"` 28 | OutputJson datatypes.JSON `gorm:"type:json"` 29 | RetryCount int `gorm:"not null"` 30 | JobStatus JobState `gorm:"type:varchar(255);default:'queued'"` 31 | ResponseCode int `gorm:"type:int"` 32 | EventTime time.Time `gorm:""` 33 | EventMessage string `gorm:"type:text"` 34 | EventType string `gorm:"type:varchar(255);not null"` 35 | FileName string `gorm:"type:varchar(255)"` 36 | } 37 | -------------------------------------------------------------------------------- /gateway/models/key.go: -------------------------------------------------------------------------------- 1 | package models 2 | 3 | import "time" 4 | 5 | const ( 6 | ScopeReadOnly = "read-only" 7 | ScopeReadWrite = "read-write" 8 | ScopeAdmin = "admin" 9 | ) 10 | 11 | type APIKey struct { 12 | ID uint `gorm:"primaryKey;autoIncrement"` 13 | Key string `gorm:"type:varchar(255);not null;unique"` 14 | Scope string `gorm:"type:varchar(255);not null"` 15 | UserID string `gorm:"type:varchar(42);not null"` 16 | User User `gorm:"foreignKey:UserID"` 17 | CreatedAt time.Time `gorm:"autoCreateTime"` 18 | ExpiresAt time.Time `gorm:""` 19 | RevokedAt time.Time `gorm:""` 20 | } 21 | -------------------------------------------------------------------------------- /gateway/models/model.go: -------------------------------------------------------------------------------- 1 | package models 2 | 3 | import ( 4 | "time" 5 | 6 | "gorm.io/datatypes" 7 | ) 8 | 9 | type JobType string 10 | 11 | const ( 12 | JobTypeJob JobType = "job" 13 | JobTypeService JobType = "service" 14 | ) 15 | 16 | type Model struct { 17 | ID int `gorm:"primaryKey;autoIncrement"` 18 | Name string `gorm:"type:text;not null;unique"` 19 | WalletAddress string `gorm:"type:varchar(42);not null"` 20 | ModelJson datatypes.JSON `gorm:"type:json"` 21 | CreatedAt time.Time `gorm:"autoCreateTime"` 22 | Display bool `gorm:"type:boolean;default:true"` 23 | TaskCategory string `gorm:"type:text;default:'community-models'"` 24 | DefaultModel bool `gorm:"type:boolean;default:false"` 25 | MaxRunningTime int `gorm:"type:int;default:2700"` 26 | ComputeCost int `gorm:"type:int;not null;default:0"` 27 | RayEndpoint string `gorm:"type:varchar(255)"` 28 | RayJobEntrypoint string `gorm:"type:varchar(255)"` 29 | S3URI string `gorm:"type:varchar(255)"` 30 | JobType JobType `gorm:"type:text;default:'job'"` 31 | } 32 | -------------------------------------------------------------------------------- /gateway/models/organization.go: -------------------------------------------------------------------------------- 1 | package models 2 | 3 | type Organization struct { 4 | ID uint `gorm:"primaryKey;autoIncrement"` 5 | Name string `gorm:"type:varchar(255);not null;unique"` 6 | Description string `gorm:"type:text"` 7 | } 8 | -------------------------------------------------------------------------------- /gateway/models/rayjobresponse.go: -------------------------------------------------------------------------------- 1 | package models 2 | 3 | type RayJobResponse struct { 4 | UUID string `json:"uuid"` 5 | PDB FileDetail `json:"pdb"` 6 | Scores map[string]float64 `json:"-"` 7 | Files map[string]FileDetail `json:"-"` 8 | Points int `json:"points"` 9 | } 10 | 11 | type FileDetail struct { 12 | URI string `json:"uri"` 13 | } 14 | -------------------------------------------------------------------------------- /gateway/models/scatterplotdata.go: -------------------------------------------------------------------------------- 1 | package models 2 | 3 | type ScatterPlotData struct { 4 | Plddt float64 `json:"plddt"` 5 | IPae float64 `json:"i_pae"` 6 | Checkpoint string `json:"checkpoint"` 7 | StructureFile string `json:"structureFile"` 8 | PdbFilePath string `json:"pdbFilePath"` 9 | RayJobID string `json:"rayJobId"` 10 | } 11 | -------------------------------------------------------------------------------- /gateway/models/tag.go: -------------------------------------------------------------------------------- 1 | package models 2 | 3 | type Tag struct { 4 | Name string `gorm:"primaryKey;type:varchar(255);not null;unique"` 5 | Type string `gorm:"type:varchar(100);not null"` 6 | Files []File `gorm:"many2many:file_tags;foreignKey:Name;joinForeignKey:tag_name;inverseJoinForeignKey:file_id"` 7 | // Files []File `gorm:"many2many:file_tags;foreignKey:Name;joinForeignKey:tag_name;inverseJoinForeignKey:file_id" 8 | } 9 | -------------------------------------------------------------------------------- /gateway/models/transaction.go: -------------------------------------------------------------------------------- 1 | package models 2 | 3 | import ( 4 | "time" 5 | ) 6 | 7 | type Transaction struct { 8 | ID string `gorm:"primaryKey;type:varchar(255)" json:"id"` 9 | Amount float64 `gorm:"type:float" json:"amount"` 10 | IsDebit bool `gorm:"type:boolean" json:"isDebit"` 11 | WalletAddress string `gorm:"type:varchar(42);not null" json:"walletAddress"` 12 | Description string `gorm:"type:text" json:"description"` 13 | CreatedAt time.Time `gorm:""` 14 | } 15 | -------------------------------------------------------------------------------- /gateway/models/user.go: -------------------------------------------------------------------------------- 1 | package models 2 | 3 | import "time" 4 | 5 | type Tier int 6 | 7 | const ( 8 | TierFree Tier = iota 9 | TierPaid 10 | ) 11 | 12 | type User struct { 13 | WalletAddress string `gorm:"primaryKey;type:varchar(42);not null" json:"walletAddress"` 14 | DID string `gorm:"column:did;type:varchar(255);unique" json:"did"` 15 | CreatedAt time.Time `gorm:""` 16 | APIKeys []APIKey `gorm:"foreignKey:UserID"` 17 | Admin bool `gorm:"column:admin;default:false" json:"admin"` 18 | UserFiles []File `gorm:"many2many:user_files;foreignKey:WalletAddress;joinForeignKey:wallet_address;inverseJoinForeignKey:file_id"` 19 | Tier Tier `gorm:"type:int;not null;default:0" json:"tier"` 20 | ComputeTally int `gorm:"column:compute_tally;default:0" json:"computeTally"` 21 | StripeUserID string `gorm:"column:stripe_user_id;type:varchar(255)" json:"stripeUserId"` 22 | OrganizationID uint `gorm:"column:organization_id"` 23 | Organization Organization `gorm:"foreignKey:OrganizationID"` 24 | SubscriptionStatus string `gorm:"column:subscription_status;type:varchar(255)" json:"subscriptionStatus"` 25 | SubscriptionID *string `gorm:"column:subscription_id;type:varchar(255);unique" json:"subscriptionId"` 26 | } 27 | -------------------------------------------------------------------------------- /gateway/models/userevent.go: -------------------------------------------------------------------------------- 1 | package models 2 | 3 | import "time" 4 | 5 | type UserEvent struct { 6 | ID int `json:"id"` 7 | WalletAddress string `json:"wallet_address"` 8 | ApiKeyID int `json:"api_key_id"` 9 | EventTime time.Time `json:"event_time"` 10 | EventType string `json:"event_type"` 11 | } 12 | -------------------------------------------------------------------------------- /gateway/utils/api.go: -------------------------------------------------------------------------------- 1 | package utils 2 | 3 | import ( 4 | "crypto/rand" 5 | "encoding/base64" 6 | "fmt" 7 | "hash/crc32" 8 | "strings" 9 | "time" 10 | 11 | "github.com/labdao/plex/gateway/models" 12 | ) 13 | 14 | func GenerateAPIKey(length int, label string) (string, error) { 15 | bytes := make([]byte, length) 16 | if _, err := rand.Read(bytes); err != nil { 17 | return "", fmt.Errorf("error generating random bytes: %v", err) 18 | } 19 | 20 | key := base64.URLEncoding.EncodeToString(bytes) 21 | checksum := crc32.ChecksumIEEE([]byte(key)) 22 | keyWithChecksum := fmt.Sprintf("lab_%s_%x", key, checksum) 23 | 24 | return keyWithChecksum, nil 25 | } 26 | 27 | // useful for validation before DB lookup 28 | func ValidateAPIKey(key string) (bool, error) { 29 | parts := strings.Split(key, "_") 30 | if len(parts) != 3 || parts[0] != "lab" { 31 | return false, fmt.Errorf("invalid API key format") 32 | } 33 | 34 | encodedPart := parts[1] 35 | providedChecksum := parts[2] 36 | 37 | var checksum uint32 38 | _, err := fmt.Sscanf(providedChecksum, "%x", &checksum) 39 | if err != nil { 40 | return false, fmt.Errorf("error parsing checksum: %v", err) 41 | } 42 | 43 | decoded, err := base64.URLEncoding.DecodeString(encodedPart) 44 | if err != nil { 45 | return false, fmt.Errorf("base64 decoding failed: %v", err) 46 | } 47 | computedChecksum := crc32.ChecksumIEEE(decoded) 48 | 49 | return computedChecksum == checksum, nil 50 | } 51 | 52 | func IsAPIKeyExpired(apiKey models.APIKey) bool { 53 | return apiKey.ExpiresAt.Before(time.Now().UTC()) 54 | } 55 | -------------------------------------------------------------------------------- /gateway/utils/stripe.go: -------------------------------------------------------------------------------- 1 | package utils 2 | 3 | import ( 4 | "fmt" 5 | "os" 6 | "strconv" 7 | "time" 8 | 9 | "github.com/stripe/stripe-go/v78" 10 | "github.com/stripe/stripe-go/v78/billing/meterevent" 11 | ) 12 | 13 | func setupStripeClient() error { 14 | apiKey := os.Getenv("STRIPE_SECRET_KEY") 15 | if apiKey == "" { 16 | return fmt.Errorf("STRIPE_SECRET_KEY environment variable not set") 17 | } 18 | stripe.Key = apiKey 19 | return nil 20 | } 21 | 22 | func RecordUsage(stripeCustomerID string, usage int64) error { 23 | err := setupStripeClient() 24 | if err != nil { 25 | return fmt.Errorf("failed to set up Stripe client: %v", err) 26 | } 27 | 28 | params := &stripe.BillingMeterEventParams{ 29 | EventName: stripe.String("compute_units"), 30 | Payload: map[string]string{ 31 | "value": strconv.FormatInt(usage, 10), 32 | "stripe_customer_id": stripeCustomerID, 33 | }, 34 | Identifier: stripe.String(fmt.Sprintf("usage-%d", time.Now().Unix())), 35 | } 36 | _, err = meterevent.New(params) 37 | if err != nil { 38 | return fmt.Errorf("failed to record usage: %v", err) 39 | } 40 | return nil 41 | } 42 | -------------------------------------------------------------------------------- /infrastructure/ansible/ansible.cfg: -------------------------------------------------------------------------------- 1 | [defaults] 2 | host_key_checking=false 3 | inventory = inventory.aws_ec2.yaml 4 | remote_user = ubuntu 5 | private_key_file = ~/.ssh/steward-dev.pem 6 | -------------------------------------------------------------------------------- /infrastructure/ansible/files/bacalhau.service: -------------------------------------------------------------------------------- 1 | [Unit] 2 | Description=Bacalhau 3 | 4 | [Service] 5 | Restart=on-failure 6 | RestartSec=5s 7 | User=ubuntu 8 | Group=ubuntu 9 | ExecStart=bacalhau serve \ 10 | --node-type compute,requester \ 11 | --ipfs-connect {{ ipfs_connect }} \ 12 | --private-internal-ipfs=false \ 13 | --limit-total-gpu 1 \ 14 | --limit-job-memory 12gb \ 15 | --job-selection-accept-networked \ 16 | --job-selection-data-locality anywhere \ 17 | --job-selection-probe-http {{ receptor_url }} \ 18 | --labels owner={{ owner }} 19 | 20 | [Install] 21 | WantedBy=multi-user.target 22 | -------------------------------------------------------------------------------- /infrastructure/ansible/files/compute.service: -------------------------------------------------------------------------------- 1 | [Unit] 2 | Description=Bacalhau 3 | 4 | [Service] 5 | Environment="KEEP_STACK=true" 6 | Restart=on-failure 7 | RestartSec=5s 8 | User=ubuntu 9 | Group=ubuntu 10 | ExecStart=bacalhau serve \ 11 | --node-type compute \ 12 | --ipfs-connect {{ ipfs_connect }} \ 13 | --private-internal-ipfs=false \ 14 | --labels owner={{ owner }} \ 15 | {% if ansible_ec2_instance_type is defined %} 16 | --labels instance-type={{ ansible_ec2_instance_type }} \ 17 | {% endif %} 18 | {% if ansible_ec2_instance_id is defined %} 19 | --labels instance-id={{ ansible_ec2_instance_id }} \ 20 | {% endif %} 21 | {% if num_of_gpus is defined and num_of_gpus | int > 0 %} 22 | --labels node-type=gpu \ 23 | {% else %} 24 | --labels node-type=cpu \ 25 | {% endif %} 26 | --job-selection-probe-http {{ receptor_url }} \ 27 | --peer {{ requester_peer }} \ 28 | --job-selection-accept-networked \ 29 | --job-selection-data-locality anywhere 30 | 31 | [Install] 32 | WantedBy=multi-user.target 33 | -------------------------------------------------------------------------------- /infrastructure/ansible/files/compute.yaml: -------------------------------------------------------------------------------- 1 | --- 2 | 3 | node: 4 | compute: 5 | capacity: 6 | queueresourcelimits: 7 | cpu: 0m 8 | disk: 0 B 9 | gpu: "0" 10 | memory: 0 B 11 | -------------------------------------------------------------------------------- /infrastructure/ansible/files/environment.py: -------------------------------------------------------------------------------- 1 | import os 2 | 3 | c.Spawner.environment = { 4 | 'PLEX_DIR': '{{ plex_dir }}', 5 | } 6 | -------------------------------------------------------------------------------- /infrastructure/ansible/files/ipfs.service: -------------------------------------------------------------------------------- 1 | [Unit] 2 | Description=IPFS daemon 3 | 4 | [Service] 5 | Restart=on-failure 6 | RestartSec=5s 7 | User=ubuntu 8 | Group=ubuntu 9 | ExecStart=ipfs daemon --routing=dhtclient 10 | Environment="IPFS_PATH={{ ipfs_path }}" 11 | 12 | [Install] 13 | WantedBy=multi-user.target 14 | -------------------------------------------------------------------------------- /infrastructure/ansible/files/jupyter_notebook_config.py: -------------------------------------------------------------------------------- 1 | import os 2 | os.umask(0o002) 3 | -------------------------------------------------------------------------------- /infrastructure/ansible/files/receptor-config: -------------------------------------------------------------------------------- 1 | PGHOST=terraform-20230620164721003000000001.cqbgzlch0qtq.us-east-1.rds.amazonaws.com 2 | PGUSER=receptor 3 | PGDATABASE=receptor 4 | PGSSLMODE=verify-ca 5 | PGSSLROOTCERT={{ receptor_dir }}/global-bundle.pem 6 | -------------------------------------------------------------------------------- /infrastructure/ansible/files/receptor.service: -------------------------------------------------------------------------------- 1 | [Unit] 2 | Description=Receptor Web Service 3 | 4 | [Service] 5 | Restart=on-failure 6 | RestartSec=5s 7 | User=ubuntu 8 | Group=ubuntu 9 | WorkingDirectory={{ plex_dir }}/receptor 10 | ExecStart=go run main.go 11 | EnvironmentFile={{ receptor_dir }}/configs 12 | EnvironmentFile={{ receptor_dir }}/secrets 13 | 14 | [Install] 15 | WantedBy=multi-user.target 16 | -------------------------------------------------------------------------------- /infrastructure/ansible/files/requester.service: -------------------------------------------------------------------------------- 1 | [Unit] 2 | Description=Bacalhau Requester 3 | 4 | [Service] 5 | Restart=on-failure 6 | RestartSec=5s 7 | User=ubuntu 8 | Group=ubuntu 9 | ExecStart=bacalhau serve \ 10 | --node-type requester \ 11 | --ipfs-connect {{ ipfs_connect }} \ 12 | --private-internal-ipfs=false \ 13 | --job-selection-probe-http {{ receptor_url }} \ 14 | --labels owner={{ owner }} \ 15 | --job-selection-accept-networked \ 16 | --job-selection-data-locality anywhere \ 17 | --peer none 18 | 19 | [Install] 20 | WantedBy=multi-user.target 21 | -------------------------------------------------------------------------------- /infrastructure/ansible/install_requirements.yaml: -------------------------------------------------------------------------------- 1 | - name: Install requirements on the host 2 | remote_user: ubuntu 3 | # Ability to override host, useful to running playbook in local mode 4 | hosts: "{{ target_hosts | default('all') }}" 5 | tasks: 6 | - name: Install collections and roles together 7 | community.general.ansible_galaxy_install: 8 | type: both 9 | requirements_file: "{{ playbook_dir }}/requirements.yaml" 10 | -------------------------------------------------------------------------------- /infrastructure/ansible/inventory.aws_ec2.yaml: -------------------------------------------------------------------------------- 1 | # demo.aws_ec2.yml 2 | plugin: amazon.aws.aws_ec2 3 | 4 | # This sets the region. If empty (the default) default this will include all regions, except possibly 5 | # restricted ones like us-gov-west-1 and cn-north-1. 6 | regions: 7 | - us-east-1 8 | 9 | filters: 10 | instance-state-name: running 11 | 12 | keyed_groups: 13 | - prefix: tag 14 | key: tags 15 | -------------------------------------------------------------------------------- /infrastructure/ansible/jupyter_set_users.yaml: -------------------------------------------------------------------------------- 1 | - name: Set Jupyter Users 2 | remote_user: ubuntu 3 | hosts: tag_Type_jupyter_notebook 4 | vars_files: 5 | - vars/teams.yaml 6 | tasks: 7 | - name: Create shared folder for teams 8 | become: true 9 | ansible.builtin.file: 10 | path: /srv/data/teams 11 | state: directory 12 | 13 | - name: Create admin users 14 | become: true 15 | ansible.builtin.command: 16 | cmd: tljh-config add-item users.admin {{ item }} 17 | loop: "{{ admins | default([])}}" 18 | 19 | - name: Create teams 20 | include_tasks: tasks/jupyter_team_setup_tasks.yaml 21 | loop: "{{ teams | default([])}}" 22 | 23 | - name: Reload the tljh configuration 24 | become: true 25 | ansible.builtin.command: tljh-config reload 26 | -------------------------------------------------------------------------------- /infrastructure/ansible/provision_ipfs.yaml: -------------------------------------------------------------------------------- 1 | - name: Provision IPFS 2 | remote_user: ubuntu 3 | hosts: "{{ target_hosts | default('tag_Type_ipfs') }}" 4 | vars: 5 | ipfs_version: "0.18.0" 6 | ipfs_path: "/opt/ipfs" 7 | ipfs_connect: /ip4/127.0.0.1/tcp/5001 8 | tasks: 9 | # Must provide limit flag to ensure running against current environment 10 | - fail: 11 | msg: "you must use -l or --limit" 12 | when: ansible_limit is not defined 13 | run_once: true 14 | 15 | - name: Run common tasks 16 | ansible.builtin.include_tasks: tasks/common_tasks.yaml 17 | 18 | # Docker 19 | - name: Install Docker 20 | ansible.builtin.include_tasks: tasks/install_docker_tasks.yaml 21 | 22 | - name: Install IPFS 23 | ansible.builtin.include_tasks: tasks/install_ipfs_docker_tasks.yaml 24 | 25 | - name: Systemd Daemon Reload 26 | become: true 27 | ansible.builtin.systemd: 28 | daemon_reload: true 29 | 30 | handlers: 31 | - name: Restart IPFS 32 | become: true 33 | ansible.builtin.service: 34 | name: ipfs 35 | state: restarted 36 | enabled: true 37 | -------------------------------------------------------------------------------- /infrastructure/ansible/provision_requester.yaml: -------------------------------------------------------------------------------- 1 | - name: Provision Bacalhau Requester 2 | remote_user: ubuntu 3 | hosts: "{{ target_hosts | default('tag_Type_requester') }}" 4 | vars: 5 | ipfs_version: "0.18.0" 6 | ipfs_path: "/opt/ipfs" 7 | bacalhau_version: "v1.2.0" 8 | bacalhau_node_type: "requester" 9 | ipfs_connect: /ip4/127.0.0.1/tcp/5001 10 | owner: labdao 11 | tasks: 12 | # Must provide limit flag to ensure running against current environment 13 | - fail: 14 | msg: "you must use -l or --limit" 15 | when: ansible_limit is not defined 16 | run_once: true 17 | 18 | - name: Run common tasks 19 | ansible.builtin.include_tasks: tasks/common_tasks.yaml 20 | 21 | # - name: Install IPFS 22 | # ansible.builtin.include_tasks: tasks/install_ipfs_tasks.yaml 23 | 24 | # Run Bacalhau agent 25 | - name: Install Bacalhau 26 | ansible.builtin.include_tasks: tasks/install_bacalhau_tasks.yaml 27 | tags: bacalhau 28 | 29 | - name: Systemd Daemon Reload 30 | become: true 31 | ansible.builtin.systemd: 32 | daemon_reload: true 33 | 34 | handlers: 35 | - name: Restart Bacalhau 36 | become: true 37 | ansible.builtin.service: 38 | name: requester 39 | state: restarted 40 | enabled: true 41 | -------------------------------------------------------------------------------- /infrastructure/ansible/requirements.yaml: -------------------------------------------------------------------------------- 1 | --- 2 | roles: 3 | 4 | collections: 5 | - name: community.general 6 | - name: community.docker 7 | - name: amazon.aws 8 | - name: community.aws 9 | -------------------------------------------------------------------------------- /infrastructure/ansible/tasks/common_tasks.yaml: -------------------------------------------------------------------------------- 1 | - name: "Gather service facts" 2 | become: true 3 | ansible.builtin.service_facts: 4 | 5 | - name: "Disable unattended upgrades service" 6 | become: true 7 | ansible.builtin.systemd: 8 | name: "unattended-upgrades.service" 9 | enabled: false 10 | masked: true 11 | state: "stopped" 12 | when: ansible_facts.services["unattended-upgrades.service"] is defined 13 | 14 | - name: "Remove unattended upgrades" 15 | become: true 16 | ansible.builtin.package: 17 | name: "unattended-upgrades" 18 | state: absent 19 | 20 | - name: Install required system packages 21 | become: true 22 | ansible.builtin.apt: 23 | pkg: 24 | - aptitude 25 | - ca-certificates 26 | - curl 27 | - git 28 | - gnupg 29 | - gzip 30 | - lsb-release 31 | - pip 32 | - tar 33 | - unzip 34 | - jq 35 | - tree 36 | - net-tools 37 | 38 | - name: Install required pip packages 39 | become: true 40 | ansible.builtin.pip: 41 | name: 42 | - pip 43 | - boto3 44 | - pyopenssl 45 | -------------------------------------------------------------------------------- /infrastructure/ansible/tasks/install_plex_tasks.yaml: -------------------------------------------------------------------------------- 1 | # {{ plex_dir }} must be writable by the user 2 | - name: Install required pip packages 3 | become: true 4 | ansible.builtin.pip: 5 | name: 6 | - github3.py 7 | 8 | - name: Print plex_version if provided 9 | ansible.builtin.debug: 10 | msg: "{{ plex_version }}" 11 | when: plex_version is defined 12 | 13 | - name: Get the latest plex release 14 | community.general.github_release: 15 | repo: plex 16 | user: labdao 17 | action: latest_release 18 | register: latest_release 19 | 20 | - name: Download the latest plex binary 21 | ansible.builtin.get_url: 22 | # https://github.com/labdao/plex/releases/download/v0.7.0/plex_0.7.0_linux_amd64.tar.gz 23 | url: https://github.com/labdao/plex/releases/download/{{ latest_release.tag }}/plex_{{ latest_release.tag | regex_replace('^v([0-9]\.[0-9][0-9]\.[0-9])$', '\1') }}_linux_amd64.tar.gz 24 | dest: /tmp/plex_release.tar.gz 25 | force: true 26 | 27 | - name: Unzip the plex release 28 | ansible.builtin.unarchive: 29 | src: /tmp/plex_release.tar.gz 30 | remote_src: true 31 | include: plex 32 | dest: "{{ plex_dir }}" 33 | 34 | - name: Link the plex binary to the system path 35 | become: true 36 | ansible.builtin.file: 37 | src: "{{ plex_dir }}/plex" 38 | dest: /usr/local/bin/plex 39 | state: link 40 | -------------------------------------------------------------------------------- /infrastructure/ansible/tasks/pull_common_containers.yaml: -------------------------------------------------------------------------------- 1 | --- 2 | 3 | - name: Wait for docker to run 4 | become: true 5 | ansible.builtin.command: docker pull alpine 6 | register: docker_pull 7 | retries: 5 8 | delay: 3 9 | until: docker_pull.rc == 0 10 | 11 | - name: Pull commonly used containers 12 | become: true 13 | community.docker.docker_image: 14 | name: "{{ item }}" 15 | source: pull 16 | loop: 17 | - "ubuntu" 18 | - "alpine" 19 | - "docker.io/library/python:3.9-slim" 20 | - "docker.io/rapidsai/mambaforge-cuda:cuda11.8.0-base-ubuntu22.04-py3.9" 21 | - "docker.io/pytorch/pytorch:2.1.0-cuda11.8-cudnn8-runtime" 22 | - "ghcr.io/labdao/equibind:main@sha256:21a381d9ab1ff047565685044569c8536a55e489c9531326498b28d6b3cc244f" 23 | - "ghcr.io/labdao/equibind@sha256:ae2cec63b3924774727ed1c6c8af95cf4aaea2d3f0c5acbec56478505ccb2b07" 24 | -------------------------------------------------------------------------------- /infrastructure/ansible/vars/teams.yaml: -------------------------------------------------------------------------------- 1 | # admins: 2 | # - josh 3 | # - aakaash 4 | # - humberto 5 | # teams: 6 | # - team: "labdao" 7 | # users: 8 | # - josh 9 | # - aakaash 10 | # - humberto 11 | -------------------------------------------------------------------------------- /internal/ipfs/ipfs_test.go: -------------------------------------------------------------------------------- 1 | package ipfs 2 | 3 | import ( 4 | "testing" 5 | ) 6 | 7 | func TestPinDir(t *testing.T) { 8 | expectedCid := "QmWVKoVYBWHWdRLrL8Td5kUpqN2qH6zQ5piwtdCE1fjSYt" 9 | actualCid, err := PinDir("../../testdata/ipfs_test") 10 | if err != nil { 11 | t.Fatalf("error creating client: %v", err) 12 | } 13 | if expectedCid != actualCid { 14 | t.Errorf(`unmatching cids 15 | expected CID: %s 16 | actual CID: %s`, expectedCid, actualCid, 17 | ) 18 | } 19 | } 20 | -------------------------------------------------------------------------------- /internal/ipwl/testdata/example_equibind_io.json: -------------------------------------------------------------------------------- 1 | [ 2 | { 3 | "tool": "tools/equibind.json", 4 | "inputs": { 5 | "protein": { 6 | "class": "File", 7 | "filepath": "*/testdata/binding/abl/7n9g.pdb" 8 | }, 9 | "small_molecule": { 10 | "class": "File", 11 | "filepath": "*/testdata/binding/abl/ZINC000003986735.sdf" 12 | } 13 | }, 14 | "outputs": { 15 | "best_docked_small_molecule": { 16 | "class": "File", 17 | "filepath": "" 18 | }, 19 | "protein": { 20 | "class": "File", 21 | "filepath": "" 22 | } 23 | }, 24 | "state": "created", 25 | "errMsg": "" 26 | }, 27 | { 28 | "tool": "tools/equibind.json", 29 | "inputs": { 30 | "protein": { 31 | "class": "File", 32 | "filepath": "*/testdata/binding/abl/7n9g.pdb" 33 | }, 34 | "small_molecule": { 35 | "class": "File", 36 | "filepath": "*/testdata/binding/abl/ZINC000019632618.sdf" 37 | } 38 | }, 39 | "outputs": { 40 | "best_docked_small_molecule": { 41 | "class": "File", 42 | "filepath": "" 43 | }, 44 | "protein": { 45 | "class": "File", 46 | "filepath": "" 47 | } 48 | }, 49 | "state": "created", 50 | "errMsg": "" 51 | } 52 | ] 53 | -------------------------------------------------------------------------------- /internal/ipwl/testdata/example_initial_io.json: -------------------------------------------------------------------------------- 1 | [ 2 | { 3 | "tool": "tools/equibind.json", 4 | "inputs": { 5 | "protein": { 6 | "class": "File", 7 | "filepath": "/path/to/protein.pdb" 8 | }, 9 | "small_molecule": { 10 | "class": "File", 11 | "filepath": "/path/to/small_molecule.sdf" 12 | } 13 | }, 14 | "outputs": { 15 | "best_docked_small_molecule": { 16 | "class": "File", 17 | "filepath": "" 18 | }, 19 | "protein": { 20 | "class": "File", 21 | "filepath": "" 22 | } 23 | }, 24 | "state": "created", 25 | "errMsg": "" 26 | } 27 | ] 28 | -------------------------------------------------------------------------------- /internal/ipwl/testdata/example_io.json: -------------------------------------------------------------------------------- 1 | [ 2 | { 3 | "tool": { 4 | "name": "equibind", 5 | "ipfs": "QmZ2HarAgwZGjc3LBx9mWNwAQkPWiHMignqKup1ckp8NhB" 6 | }, 7 | "inputs": { 8 | "protein": { 9 | "class": "File", 10 | "filepath": "/path/to/protein.pdb" 11 | }, 12 | "small_molecule": { 13 | "class": "File", 14 | "filepath": "/path/to/small_molecule.sdf" 15 | } 16 | }, 17 | "outputs": { 18 | "best_docked_small_molecule": { 19 | "class": "File", 20 | "filepath": "/path/to/best_docked_small_molecule.sdf" 21 | }, 22 | "protein": { 23 | "class": "File", 24 | "filepath": "/path/to/protein.pdb" 25 | } 26 | }, 27 | "state": "created", 28 | "errMsg": "" 29 | } 30 | ] 31 | -------------------------------------------------------------------------------- /internal/web3/wallet.go: -------------------------------------------------------------------------------- 1 | package web3 2 | 3 | import ( 4 | "regexp" 5 | ) 6 | 7 | func IsValidEthereumAddress(address string) bool { 8 | pattern := `^0x[0-9a-fA-F]{40}$` 9 | match, _ := regexp.MatchString(pattern, address) 10 | return match 11 | } 12 | -------------------------------------------------------------------------------- /jobs/.gitkeep: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/labdao/plex/e473e40765ef82ab83f05cd6047dd3bb5bc0765e/jobs/.gitkeep -------------------------------------------------------------------------------- /main.go: -------------------------------------------------------------------------------- 1 | package main 2 | 3 | import ( 4 | "github.com/labdao/plex/cmd" 5 | ) 6 | 7 | func main() { 8 | cmd.Execute() 9 | } 10 | -------------------------------------------------------------------------------- /models/colabdesign/CHANGELOG.md: -------------------------------------------------------------------------------- 1 | # Changelog 2 | 3 | All notable changes to this model will be documented in this file. 4 | 5 | The format is based on [Keep a Changelog](https://keepachangelog.com/en/1.0.0/). 6 | 7 | # Versions available on the platform: 8 | ## v1.2 - 2024-04-16 9 | 10 | - refactored code with convexity base image. 11 | - has checkpoints toggle. 12 | - max and default num of binders = 8 (v1.1 had 240) 13 | - these versions let you change the number of binders, but the maximum number allowed is 8 14 | - max running time set to 45 minutes 15 | -------------------------------------------------------------------------------- /models/colabdesign/conf/config.yaml: -------------------------------------------------------------------------------- 1 | defaults: 2 | - inputs: container 3 | - params: default 4 | - outputs: container 5 | -------------------------------------------------------------------------------- /models/colabdesign/conf/inputs/container.yaml: -------------------------------------------------------------------------------- 1 | target_directory: /inputs 2 | target_pattern: target -------------------------------------------------------------------------------- /models/colabdesign/conf/outputs/container.yaml: -------------------------------------------------------------------------------- 1 | directory: /outputs -------------------------------------------------------------------------------- /models/colabdesign/conf/outputs/local.yaml: -------------------------------------------------------------------------------- 1 | directory: null 2 | -------------------------------------------------------------------------------- /models/colabdesign/requirements.txt: -------------------------------------------------------------------------------- 1 | pyyaml==6.0.1 2 | -------------------------------------------------------------------------------- /models/colabdesign/viz-requirements.txt: -------------------------------------------------------------------------------- 1 | Pillow==10.3.0 2 | molecularnodes==4.0.12 3 | pandas==2.2.2 4 | biopython==1.83 5 | pydantic==2.7.1 6 | selfies==2.1.1 -------------------------------------------------------------------------------- /models/labsay/CHANGELOG.md: -------------------------------------------------------------------------------- 1 | # Changelog 2 | 3 | All notable changes to this model will be documented in this file. 4 | 5 | The format is based on [Keep a Changelog](https://keepachangelog.com/en/1.0.0/). 6 | 7 | # Versions available on the platform: 8 | ## v1.4 - 2024-04-16 9 | 10 | - max running time set to 20 seconds. refactored labsay model with checkpoint compatible toggle 11 | 12 | # Older versions of the model (hidden/no longer available/archived) 13 | ## v1.0 - 2024-04-04 14 | 15 | - combined labsay model with the ability to toggle checkpoints on and off 16 | 17 | ## v0.4 - 2024-03-22 18 | 19 | - upload with random number for plddt and ipae 20 | 21 | ## v0.3 - 2024-03-21 22 | 23 | - upload to flowUUID/rayJobID/.... instead of just rayJobID/... 24 | 25 | ## v0.2 - 2024-03-16 26 | 27 | - Version and image update in the manifest. Otherwise same as v0.1 28 | 29 | ## v0.1 - 2024-03-15 30 | 31 | - Initial Release -------------------------------------------------------------------------------- /models/labsay/Dockerfile: -------------------------------------------------------------------------------- 1 | FROM python:3.9-slim 2 | 3 | WORKDIR /app 4 | 5 | COPY main.py /app 6 | 7 | RUN pip install --no-cache-dir boto3 8 | 9 | ENTRYPOINT ["python", "-u", "main.py"] -------------------------------------------------------------------------------- /models/labsay/README.md: -------------------------------------------------------------------------------- 1 | # labsay-seq-only model 2 | 3 | Labsay is an internal model designed to merge the input functionality of the seq-only generator with the output of Labsay v0.8, to test the unified view frontend implementation and increase the development iteration speed. 4 | 5 | ## Features 6 | 7 | - Accepts seq-only generator inputs. 8 | - Takes in labsay sample checkpoint pdb inputs. 9 | - Uploads simulated checkpoints to s3. 10 | 11 | ## Points to note 12 | 13 | - This model is checkpoint compatible, so the model manifest reflects the same, with the `checkpointCompatible` flag set to `True`. 14 | - If you would like to test certain functionalities without checkpoints, and require checkpointCompatible = False, please set the above flag to false. 15 | - While the model mirrors labsay checkpoint inputs and seq-only generator inputs together, it does not take in the traditional file_example, number_example values during the experiment submission stage (like labsay v0.8). 16 | 17 | ## Steps to test locally: 18 | 19 | ```bash 20 | cd models/labsay/ 21 | chmod +x test.sh 22 | ./test.sh 23 | ``` 24 | (or) 25 | 26 | ### Note: Please refer to [CHANGELOG.md](./CHANGELOG.md) for steps to test the latest version of the model. -------------------------------------------------------------------------------- /models/labsay/test.sh: -------------------------------------------------------------------------------- 1 | #!/bin/bash 2 | PLEX_JOB_INPUTS=$(cat user_input.json) 3 | 4 | docker build -t labsay . 5 | 6 | FLOW_UUID="test-flow_uuid_$(date +%y%m%d)" 7 | JOB_UUID="test-job_uuid_$(date +%y%m%d_%H%M%S)" 8 | 9 | OUTPUT_DIR="test-runs/outputs_$(date +%Y%m%d_%H%M%S)" 10 | mkdir -p "$PWD/$OUTPUT_DIR" 11 | echo "Output directory is $OUTPUT_DIR" 12 | 13 | docker run \ 14 | -e PLEX_JOB_INPUTS="$PLEX_JOB_INPUTS" \ 15 | -e FLOW_UUID="$FLOW_UUID" \ 16 | -e JOB_UUID="$JOB_UUID" \ 17 | -e CHECKPOINT_COMPATIBLE="False" \ 18 | --env-file ~/aws.env \ 19 | -v $PWD/testdata/inputs:/inputs/ \ 20 | -v "$PWD/$OUTPUT_DIR":/outputs labsay 21 | -------------------------------------------------------------------------------- /models/labsay/testdata/inputs/file_example/message.txt: -------------------------------------------------------------------------------- 1 | this is the example_file contents 2 | =^..^= 3 | -------------------------------------------------------------------------------- /models/labsay/user_input.json: -------------------------------------------------------------------------------- 1 | { 2 | "binder_protein_sequence": "MKKAVINGEQIRSISDLHQTLKKELALPEYYGENLDALWDALTGWxxxxLVLEWRQFEQSKQLTENGAESVLQVFREAKAEGADITIILS", 3 | "target_protein_sequence": "MGSSHHHHHHSQAPIEGRAQVINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLCDVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTCGFRNSDRILYSSDWLIYKTTDHYQTFTKIR", 4 | "number_of_binders": 3, 5 | "init_permissibility_vec": "", 6 | "hotspots": "", 7 | "high_fidelity": true, 8 | "pdb_checkpoint_0": "/inputs/pdb_checkpoints/example.pdb", 9 | "pdb_checkpoint_1": "/inputs/pdb_checkpoints/design_1.pdb", 10 | "pdb_checkpoint_2": "/inputs/pdb_checkpoints/BioCD202b18_aa_7fd4f_unrelaxed_rank_003_alphafold2_multimer_v3_model_2_seed_000.pdb", 11 | "speedup": true 12 | } -------------------------------------------------------------------------------- /models/ray/simulate-protein-complex.json: -------------------------------------------------------------------------------- 1 | { 2 | "name": "relay-colabfold-v1.8", 3 | "description": "Simulate a protein complex using ColabFold", 4 | "task": "protein folding", 5 | "taskCategory": "protein-binder-design", 6 | "modelType": "ray", 7 | "checkpointCompatible": true, 8 | "xAxis": "plddt", 9 | "yAxis": "i_pae", 10 | "jobType": "service", 11 | "rayEndpoint": "/relay_simulate_protein_complex", 12 | "computeCost": 10, 13 | "inputs": { 14 | "binder_sequence": { 15 | "type": "string", 16 | "description": "The sequence of the binder protein", 17 | "required": true, 18 | "default": "PTVEAVTLLAKGEKEP", 19 | "example": "PTVEAVTLLAKGEKEP" 20 | }, 21 | "target_sequence": { 22 | "type": "string", 23 | "description": "The sequence of the target protein", 24 | "required": true, 25 | "default": "ASISTGGGN", 26 | "example": "ASISTGGGN" 27 | } 28 | }, 29 | "outputs": { 30 | "pdb": { 31 | "type": "File", 32 | "glob": ["*.pdb"] 33 | } 34 | } 35 | } -------------------------------------------------------------------------------- /pkg/README.md: -------------------------------------------------------------------------------- 1 | Placeholder for future packages that can be imported by 3rd parties -------------------------------------------------------------------------------- /receptor/Dockerfile: -------------------------------------------------------------------------------- 1 | FROM golang:1.18 as builder 2 | 3 | ADD https://truststore.pki.rds.amazonaws.com/global/global-bundle.pem /global-bundle.pem 4 | 5 | COPY . /app/ 6 | RUN cd /app/ \ 7 | && CGO_ENABLED=0 go build -o /go/bin/receptor 8 | 9 | FROM scratch 10 | 11 | COPY --from=builder /go/bin/receptor /receptor 12 | COPY --from=builder /global-bundle.pem /global-bundle.pem 13 | 14 | ENV PGHOST=postgres.example.com 15 | ENV PGUSER=receptor 16 | ENV PGDATABASE=receptor 17 | ENV PGSSLMODE=verify-ca 18 | ENV PGSSLROOTCERT=/global-bundle.pem 19 | 20 | EXPOSE 8080 21 | 22 | ENTRYPOINT ["/receptor"] 23 | -------------------------------------------------------------------------------- /receptor/main.go: -------------------------------------------------------------------------------- 1 | package main 2 | 3 | import ( 4 | "encoding/json" 5 | "log" 6 | "net/http" 7 | 8 | "github.com/gin-gonic/gin" 9 | "github.com/labdao/receptor/models" 10 | "gorm.io/gorm/clause" 11 | ) 12 | 13 | func main() { 14 | log.Print("Connecting to database") 15 | models.ConnectDatabase() 16 | 17 | r := gin.Default() 18 | 19 | log.Print("Setting up routes") 20 | r.GET("/_health_check", health) 21 | r.POST("/judge", judge) 22 | 23 | r.Run() 24 | } 25 | 26 | func health(c *gin.Context) { 27 | c.JSON(http.StatusOK, gin.H{"status": "ok"}) 28 | } 29 | 30 | func judge(c *gin.Context) { 31 | var requestPayload models.JobModel 32 | 33 | if err := c.BindJSON(&requestPayload); err != nil { 34 | c.JSON(http.StatusBadRequest, gin.H{"error": err.Error()}) 35 | return 36 | } 37 | 38 | // Extract Job.ID from the JSON data 39 | var jobID struct{ ID string } 40 | if err := json.Unmarshal(requestPayload.Spec, &jobID); err != nil { 41 | c.JSON(http.StatusBadRequest, gin.H{"error": err.Error()}) 42 | return 43 | } 44 | 45 | // Create a new JobModel instance 46 | jobModel := models.JobModel{ 47 | NodeID: requestPayload.NodeID, 48 | Spec: requestPayload.Spec, 49 | JobID: jobID.ID, 50 | } 51 | 52 | // Create or update the record in the database 53 | models.DB.Clauses(clause.OnConflict{DoNothing: true}).Create(&jobModel) 54 | 55 | c.JSON(http.StatusOK, gin.H{}) 56 | } 57 | -------------------------------------------------------------------------------- /receptor/models/job.go: -------------------------------------------------------------------------------- 1 | package models 2 | 3 | import ( 4 | "gorm.io/datatypes" 5 | "gorm.io/gorm" 6 | ) 7 | 8 | type JobModel struct { 9 | gorm.Model 10 | NodeID string `json:"NodeID"` 11 | Spec datatypes.JSON `json:"Job" gorm:"column:spec"` // Store Job object in JSON format 12 | JobID string `gorm:"column:job_id;uniqueIndex"` // Extracted Job.ID field 13 | } 14 | 15 | type Tabler interface { 16 | TableName() string 17 | } 18 | 19 | // TableName overrides the table name 20 | func (JobModel) TableName() string { 21 | return "jobs" 22 | } 23 | -------------------------------------------------------------------------------- /receptor/models/setup.go: -------------------------------------------------------------------------------- 1 | package models 2 | 3 | import ( 4 | "fmt" 5 | "log" 6 | "os" 7 | 8 | "gorm.io/driver/postgres" 9 | "gorm.io/gorm" 10 | "gorm.io/gorm/logger" 11 | ) 12 | 13 | var DB *gorm.DB 14 | 15 | func ConnectDatabase() { 16 | 17 | dsn := fmt.Sprintf( 18 | "host=%s user=%s password=%s dbname=%s", 19 | os.Getenv("PGHOST"), 20 | os.Getenv("PGUSER"), 21 | os.Getenv("PGPASSWORD"), 22 | os.Getenv("PGDATABASE"), 23 | ) 24 | database, err := gorm.Open(postgres.Open(dsn), &gorm.Config{ 25 | Logger: logger.Default.LogMode(logger.Silent), 26 | }) 27 | 28 | if err != nil { 29 | panic("Failed to connect to database!") 30 | } 31 | 32 | log.Print("Migrating database") 33 | err = database.AutoMigrate(&JobModel{}) 34 | if err != nil { 35 | return 36 | } 37 | 38 | DB = database 39 | } 40 | -------------------------------------------------------------------------------- /scripts/asciicast/asciicast-commands.txt: -------------------------------------------------------------------------------- 1 | ./plex -tool equibind -input-dir testdata/binding/abl 2 | ./plex -tool equibind -input-dir testdata/binding/pdbind_processed_size1 3 | ./plex -tool equibind -input-dir testdata/binding/pdbind_processed_size2 4 | ./plex -tool colabfold-mini -input-dir testdata/folding -gpu=true -network=true 5 | ./plex -tool oddt -input-dir testdata/scoring/abl -------------------------------------------------------------------------------- /scripts/asciicast/create-asciicast.sh: -------------------------------------------------------------------------------- 1 | #!/bin/bash 2 | # run inside container image with asciinema installed 3 | 4 | # File containing the list of CLI commands to record 5 | commands_file="scripts/asciicast/asciicast-commands.txt" 6 | 7 | # Display the commands in the file 8 | while IFS= read -r cmd; do 9 | echo "Command: $cmd" 10 | done < "$commands_file" 11 | 12 | # Read commands from the file into an array 13 | commands=() 14 | while IFS= read -r cmd; do 15 | commands+=("$cmd") 16 | done < "$commands_file" 17 | 18 | # Loop through the commands array and create a recording for each one 19 | for cmd in "${commands[@]}"; do 20 | # Create a unique filename for each recording 21 | filename="$(echo "$cmd" | tr -d '[:space:]/' | tr -cd '[:alnum:]._-').cast" 22 | 23 | # Create a script to simulate typing the command character by character 24 | typed_cmd_script="tmp.sh" 25 | echo "#!/bin/bash" > "$typed_cmd_script" 26 | for ((i=0; i<${#cmd}; i++)); do 27 | echo "printf '%s' '${cmd:$i:1}'" >> "$typed_cmd_script" 28 | echo "sleep 0.1" >> "$typed_cmd_script" 29 | done 30 | echo "printf '\n'" >> "$typed_cmd_script" 31 | echo "$cmd" >> "$typed_cmd_script" 32 | echo "exit" >> "$typed_cmd_script" 33 | chmod +x "$typed_cmd_script" 34 | 35 | # Start the recording, execute the command, and then exit the shell 36 | asciinema rec -c "bash $typed_cmd_script" scripts/asciicast/$filename -y -i 2 --overwrite 37 | 38 | # Cleanup the temporary script 39 | rm -f "$typed_cmd_script" 40 | done -------------------------------------------------------------------------------- /testdata/ipfs_test/haiku2.txt: -------------------------------------------------------------------------------- 1 | Science unbound flows 2 | Decentralized, it shines bright 3 | Knowledge spreads its wings. 4 | -------------------------------------------------------------------------------- /testdata/ipfs_test/test.csv: -------------------------------------------------------------------------------- 1 | A,B,C 2 | 1,2,3 3 | 4,5,6 4 | testing,testing,testing -------------------------------------------------------------------------------- /testdata/ipfs_test/testset_csv.csv: -------------------------------------------------------------------------------- 1 | Protein,Protein File,Ligand File 2 | 6d08,6d08/6d08_protein_processed.pdb,6d08/6d08_ligand.sdf 3 | 6jap,6jap/6jap_protein_processed.pdb,6jap/6jap_ligand.sdf 4 | 6hop,6hop/6hop_protein_processed.pdb,6hop/6hop_ligand.sdf 5 | 6qqq,6qqq/6qqq_protein_processed.pdb,6qqq/6qqq_ligand.mol2 6 | 6qqu,6qqu/6qqu_protein_processed.pdb,6qqu/6qqu_ligand.mol2 --------------------------------------------------------------------------------