├── Descriptor_headers.pdf
├── Feature_Description.pdf
├── LICENSE
├── Pfeature_Manual.pdf
├── PyLib
├── Functions_Tables.pdf
├── Pfeature.zip
└── README.md
├── README.md
├── Standalone
├── Data
│ ├── AAIndexNames.csv
│ ├── Grantham.csv
│ ├── PhysicoChemical.csv
│ ├── README.md
│ ├── Schneider-Wrede.csv
│ ├── aa_attr_group.csv
│ ├── aaind.txt
│ ├── aaindex.csv
│ ├── aaindices.csv
│ ├── atom.csv
│ ├── bin_di.csv
│ ├── bonds.csv
│ ├── can_pat.csv
│ ├── data
│ └── z_aaindex.csv
├── LICENSE
├── Pfeature_Descriptors.pdf
├── README.md
├── README.txt
├── Requirement.txt
├── Screenshot.png
├── envfile
├── pfeature_bin.py
├── pfeature_comp.py
├── pfeature_pssm.py
├── pfeature_standalone.zip
├── protein.fa
└── protein.seq
└── scripts
├── Pfeature_scripts.zip
└── readme
/Descriptor_headers.pdf:
--------------------------------------------------------------------------------
https://raw.githubusercontent.com/raghavagps/Pfeature/1117d4c9712a7d230ed0e0026be8d9a2d859e978/Descriptor_headers.pdf
--------------------------------------------------------------------------------
/Feature_Description.pdf:
--------------------------------------------------------------------------------
https://raw.githubusercontent.com/raghavagps/Pfeature/1117d4c9712a7d230ed0e0026be8d9a2d859e978/Feature_Description.pdf
--------------------------------------------------------------------------------
/LICENSE:
--------------------------------------------------------------------------------
1 | version https://git-lfs.github.com/spec/v1
2 | oid sha256:3972dc9744f6499f0f9b2dbf76696f2ae7ad8af9b23dde66d6af86c9dfb36986
3 | size 35149
4 |
--------------------------------------------------------------------------------
/Pfeature_Manual.pdf:
--------------------------------------------------------------------------------
https://raw.githubusercontent.com/raghavagps/Pfeature/1117d4c9712a7d230ed0e0026be8d9a2d859e978/Pfeature_Manual.pdf
--------------------------------------------------------------------------------
/PyLib/Functions_Tables.pdf:
--------------------------------------------------------------------------------
https://raw.githubusercontent.com/raghavagps/Pfeature/1117d4c9712a7d230ed0e0026be8d9a2d859e978/PyLib/Functions_Tables.pdf
--------------------------------------------------------------------------------
/PyLib/Pfeature.zip:
--------------------------------------------------------------------------------
https://raw.githubusercontent.com/raghavagps/Pfeature/1117d4c9712a7d230ed0e0026be8d9a2d859e978/PyLib/Pfeature.zip
--------------------------------------------------------------------------------
/PyLib/README.md:
--------------------------------------------------------------------------------
1 | Library Package of Pfeature
2 | ===============================
3 |
4 | INTRODUCTION
5 | ------------------
6 | Pfeature is a standalone software package for computing wide range of protein and peptides features from their amino acid sequence. It has the following five major modules for computing protein features based on;
7 | - Composition
8 | - Binary profiles
9 | - Evolutionary information
10 | - Structure
11 | - Pattern
12 |
13 | We have developed number of forms of Pfeature that include:
14 | - A web server that uses Pfeature functions via web interface from https://webs.iiitd.edu.in/raghava/pfeature
15 | - Standalone version of Pfeature
16 | - Library of python for Pfeature and iv) Python scripts for computing features.
17 |
18 | INSTALLATION
19 | ---------------
20 | Installation of Pfeature is simple as explained below:
21 |
22 | On Microsoft Windows:
23 | 1. Download Pfeature.zip from https://github.com/raghavagps/Pfeature/blob/master/PyLib/Pfeature.zip
24 | 2. extract or uncompress the Pfeature.zip
25 | 3. change directory to Pfeature
26 | 4. Run the command: python3 setup.py install
27 |
28 | On Mac/Linux:
29 | 1. Download Pfeature.zip from https://github.com/raghavagps/Pfeature/blob/master/PyLib/Pfeature.zip
30 | 2. unzip the Pfeature.zip
31 | 3. change directory to Pfeature
32 | 4. Run the command: python3 setup.py install or sudo python3 setup.py install
33 |
34 | On Centos:
35 | 1. Download Pfeature.zip from https://github.com/raghavagps/Pfeature/blob/master/PyLib/Pfeature.zip
36 | 2. unzip the Pfeature.zip
37 | 3. change directory to Pfeature
38 | 4. Run the command: python3 setup.py install
39 |
40 |
41 |
--------------------------------------------------------------------------------
/README.md:
--------------------------------------------------------------------------------
1 | # Pfeature: Computation of features of peptides and proteins
2 |
3 | ## Introduction
4 | Pfeature is a comprehensive software developed for computing wide range of protein/peptide features that have been discovered over the past decades. It has the following five major modules for computing protein features based on; i) Composition, ii) Binary profiles, iii) Evolutionary information iv) Structure and v) Pattern. The composition based module allows user to compute; i) Simple compositions like amino acid, dipeptide, tripeptide; ii) Physicochemical properties based compositions; iii) Repeats and distribution of amino acids; iv) Shannon entropy to measure the low complexity regions; iv) Miscellaneous compositions like pseudo amino acid, autocorrelation, conjoint triad, quasi-sequence order. Binary profile of amino acid sequence provides complete information including order of residues or type of residues, which is not possible with composition based features. Thus, binary profile can be used to annotate protein at residue level. It is well established in literature that sequence profile based on evolutionary information provides more information then sequence itself.
5 |
6 | We have developed number of isoforms of Pfeature that include: i) A web server that uses Pfeature functions via web interface from https://webs.iiitd.edu.in/raghava/pfeature/ ; ii) Standalone version of Pfeature; iii) Library of python for Pfeature and iv) Python scripts for computing features.
7 |
8 | ## Documentation
9 | One can read more about subroutines developed under Pfeature to compute wide range of proteins and peptide features from https://github.com/raghavagps/Pfeature/blob/master/Pfeature_Man.pdf . Further information is available from help page of web site https://webs.iiitd.edu.in/raghava/pfeature/help.php
10 |
11 | ## Web Service for Pfeature
12 | A web server for computing wide range of protein and peptides features from their amino acid sequences. Following are main menus for computing features; i) Composition-based features, ii) Binary profile of sequences, iii) evolutionary information based features, iv) structural descriptors,and v) pattern based descriptors, for a group of protein/peptide sequences. Additionally, users will also be able to generate these features for sub-parts of protein/peptide sequences. Pfeature will be helpful to annotate structure, function and therapeutic properties of proteins/peptides.
13 |
14 | **Available from URL: https://webs.iiitd.edu.in/raghava/pfeature/**
15 | ## PIP Installation
16 | PIP version is also available for easy installation and usage of this tool. The following command is required to install the package
17 | ```
18 | pip install pfeature
19 | ```
20 | To know about the available option for the pip package, type the following command:
21 | ```
22 | pfeature -h
23 | ```
24 |
25 | ### Installation of Pfeature Library
26 |
27 | ### Prerequisite
28 | The prerequisite to run the python library is pandas, numpy and python version above 3.6
29 | pandas can be installed using following command: pip3 install pandas
30 | numpy can be installed using following command: pip3 install numpy
31 |
32 | ### Steps for setting library
33 | It has been tested on wide range of platforms that include Apple MAC, Windows and Linux (Ubuntu,Fedora). After installing pandas and numpy user can install using following commands
34 |
35 | 1. Download Pfeature from https://github.com/raghavagps/Pfeature/blob/master/PyLib/Pfeature.zip
36 | 2. Extract or uncompress Pfeature.zip
37 | 3. cd Pfeature
38 | 4. python setup.py install
39 |
40 | ## Standalone Package of Pfeature
41 | In order to facilitate users, we created a single program of Pfeature which computes individual as well as, all possible descriptors for a protein/peptide sequence.
42 | It has been tested on wide range of platforms that include Apple MAC, Windows and Linux (Ubuntu,Fedora). After installing pandas and numpy user can install using following commands
43 |
44 | 1. Download Pfeature from https://github.com/raghavagps/Pfeature/blob/master/Standalone/pfeature_standalone.zip
45 | 2. Extract or uncompress pfeature_standalone.zip
46 | 3. cd pfeature_standalone
47 |
48 | # Reference
49 | Pande et al (2022) Pfeature: A Tool for Computing Wide Range of Protein Features and Building Prediction Models. J Comput Biol. 2022 Oct 13. doi: 10.1089/cmb.2022.0241.
50 |
--------------------------------------------------------------------------------
/Standalone/Data/AAIndexNames.csv:
--------------------------------------------------------------------------------
1 | ANDN920101
2 | ARGP820101
3 | ARGP820102
4 | ARGP820103
5 | AURR980101
6 | AURR980102
7 | AURR980103
8 | AURR980104
9 | AURR980105
10 | AURR980106
11 | AURR980107
12 | AURR980108
13 | AURR980109
14 | AURR980110
15 | AURR980111
16 | AURR980112
17 | AURR980113
18 | AURR980114
19 | AURR980115
20 | AURR980116
21 | AURR980117
22 | AURR980118
23 | AURR980119
24 | AURR980120
25 | BAEK050101
26 | BASU050101
27 | BASU050102
28 | BASU050103
29 | BEGF750101
30 | BEGF750102
31 | BEGF750103
32 | BHAR880101
33 | BIGC670101
34 | BIOV880101
35 | BIOV880102
36 | BLAM930101
37 | BLAS910101
38 | BROC820101
39 | BROC820102
40 | BULH740101
41 | BULH740102
42 | BUNA790101
43 | BUNA790102
44 | BUNA790103
45 | BURA740101
46 | BURA740102
47 | CASG920101
48 | CEDJ970101
49 | CEDJ970102
50 | CEDJ970103
51 | CEDJ970104
52 | CEDJ970105
53 | CHAM810101
54 | CHAM820101
55 | CHAM820102
56 | CHAM830101
57 | CHAM830102
58 | CHAM830103
59 | CHAM830104
60 | CHAM830105
61 | CHAM830106
62 | CHAM830107
63 | CHAM830108
64 | CHOC750101
65 | CHOC760101
66 | CHOC760102
67 | CHOC760103
68 | CHOC760104
69 | CHOP780101
70 | CHOP780201
71 | CHOP780202
72 | CHOP780203
73 | CHOP780204
74 | CHOP780205
75 | CHOP780206
76 | CHOP780207
77 | CHOP780208
78 | CHOP780209
79 | CHOP780210
80 | CHOP780211
81 | CHOP780212
82 | CHOP780213
83 | CHOP780214
84 | CHOP780215
85 | CHOP780216
86 | CIDH920101
87 | CIDH920102
88 | CIDH920103
89 | CIDH920104
90 | CIDH920105
91 | COHE430101
92 | CORJ870101
93 | CORJ870102
94 | CORJ870103
95 | CORJ870104
96 | CORJ870105
97 | CORJ870106
98 | CORJ870107
99 | CORJ870108
100 | COSI940101
101 | COWR900101
102 | CRAJ730101
103 | CRAJ730102
104 | CRAJ730103
105 | DAWD720101
106 | DAYM780101
107 | DAYM780201
108 | DESM900101
109 | DESM900102
110 | DIGM050101
111 | EISD840101
112 | EISD860101
113 | EISD860102
114 | EISD860103
115 | ENGD860101
116 | FASG760101
117 | FASG760102
118 | FASG760103
119 | FASG760104
120 | FASG760105
121 | FASG890101
122 | FAUJ830101
123 | FAUJ880101
124 | FAUJ880102
125 | FAUJ880103
126 | FAUJ880104
127 | FAUJ880105
128 | FAUJ880106
129 | FAUJ880107
130 | FAUJ880108
131 | FAUJ880109
132 | FAUJ880110
133 | FAUJ880111
134 | FAUJ880112
135 | FAUJ880113
136 | FINA770101
137 | FINA910101
138 | FINA910102
139 | FINA910103
140 | FINA910104
141 | FODM020101
142 | FUKS010101
143 | FUKS010102
144 | FUKS010103
145 | FUKS010104
146 | FUKS010105
147 | FUKS010106
148 | FUKS010107
149 | FUKS010108
150 | FUKS010109
151 | FUKS010110
152 | FUKS010111
153 | FUKS010112
154 | GARJ730101
155 | GEIM800101
156 | GEIM800102
157 | GEIM800103
158 | GEIM800104
159 | GEIM800105
160 | GEIM800106
161 | GEIM800107
162 | GEIM800108
163 | GEIM800109
164 | GEIM800110
165 | GEIM800111
166 | GEOR030101
167 | GEOR030102
168 | GEOR030103
169 | GEOR030104
170 | GEOR030105
171 | GEOR030106
172 | GEOR030107
173 | GEOR030108
174 | GEOR030109
175 | GOLD730101
176 | GOLD730102
177 | GRAR740101
178 | GRAR740102
179 | GRAR740103
180 | GUOD860101
181 | GUYH850101
182 | GUYH850102
183 | GUYH850104
184 | GUYH850105
185 | HARY940101
186 | HOPA770101
187 | HOPT810101
188 | HUTJ700101
189 | HUTJ700102
190 | HUTJ700103
191 | ISOY800101
192 | ISOY800102
193 | ISOY800103
194 | ISOY800104
195 | ISOY800105
196 | ISOY800106
197 | ISOY800107
198 | ISOY800108
199 | JACR890101
200 | JANJ780101
201 | JANJ780102
202 | JANJ780103
203 | JANJ790101
204 | JANJ790102
205 | JOND750101
206 | JOND750102
207 | JOND920101
208 | JOND920102
209 | JUKT750101
210 | JUNJ780101
211 | JURD980101
212 | KANM800101
213 | KANM800102
214 | KANM800103
215 | KANM800104
216 | KARP850101
217 | KARP850102
218 | KARP850103
219 | KARS160101
220 | KARS160102
221 | KARS160103
222 | KARS160104
223 | KARS160105
224 | KARS160106
225 | KARS160107
226 | KARS160108
227 | KARS160109
228 | KARS160110
229 | KARS160111
230 | KARS160112
231 | KARS160113
232 | KARS160114
233 | KARS160115
234 | KARS160116
235 | KARS160117
236 | KARS160118
237 | KARS160119
238 | KARS160120
239 | KARS160121
240 | KARS160122
241 | KHAG800101
242 | KIDA850101
243 | KIMC930101
244 | KLEP840101
245 | KOEP990101
246 | KOEP990102
247 | KRIW710101
248 | KRIW790101
249 | KRIW790102
250 | KRIW790103
251 | KUHL950101
252 | KUMS000101
253 | KUMS000102
254 | KUMS000103
255 | KUMS000104
256 | KYTJ820101
257 | LAWE840101
258 | LEVM760101
259 | LEVM760102
260 | LEVM760103
261 | LEVM760104
262 | LEVM760105
263 | LEVM760106
264 | LEVM760107
265 | LEVM780101
266 | LEVM780102
267 | LEVM780103
268 | LEVM780104
269 | LEVM780105
270 | LEVM780106
271 | LEWP710101
272 | LIFS790101
273 | LIFS790102
274 | LIFS790103
275 | MANP780101
276 | MAXF760101
277 | MAXF760102
278 | MAXF760103
279 | MAXF760104
280 | MAXF760105
281 | MAXF760106
282 | MCMT640101
283 | MEEJ800101
284 | MEEJ800102
285 | MEEJ810101
286 | MEEJ810102
287 | MEIH800101
288 | MEIH800102
289 | MEIH800103
290 | MITS020101
291 | MIYS850101
292 | MIYS990101
293 | MIYS990102
294 | MIYS990103
295 | MIYS990104
296 | MIYS990105
297 | MONM990101
298 | MONM990201
299 | MUNV940101
300 | MUNV940102
301 | MUNV940103
302 | MUNV940104
303 | MUNV940105
304 | NADH010101
305 | NADH010102
306 | NADH010103
307 | NADH010104
308 | NADH010105
309 | NADH010106
310 | NADH010107
311 | NAGK730101
312 | NAGK730102
313 | NAGK730103
314 | NAKH900101
315 | NAKH900102
316 | NAKH900103
317 | NAKH900104
318 | NAKH900105
319 | NAKH900106
320 | NAKH900107
321 | NAKH900108
322 | NAKH900109
323 | NAKH900110
324 | NAKH900111
325 | NAKH900112
326 | NAKH900113
327 | NAKH920101
328 | NAKH920102
329 | NAKH920103
330 | NAKH920104
331 | NAKH920105
332 | NAKH920106
333 | NAKH920107
334 | NAKH920108
335 | NISK800101
336 | NISK860101
337 | NOZY710101
338 | OLSK800101
339 | ONEK900101
340 | ONEK900102
341 | OOBM770101
342 | OOBM770102
343 | OOBM770103
344 | OOBM770104
345 | OOBM770105
346 | OOBM850101
347 | OOBM850102
348 | OOBM850103
349 | OOBM850104
350 | OOBM850105
351 | PALJ810101
352 | PALJ810102
353 | PALJ810103
354 | PALJ810104
355 | PALJ810105
356 | PALJ810106
357 | PALJ810107
358 | PALJ810108
359 | PALJ810109
360 | PALJ810110
361 | PALJ810111
362 | PALJ810112
363 | PALJ810113
364 | PALJ810114
365 | PALJ810115
366 | PALJ810116
367 | PARJ860101
368 | PARS000101
369 | PARS000102
370 | PLIV810101
371 | PONJ960101
372 | PONP800101
373 | PONP800102
374 | PONP800103
375 | PONP800104
376 | PONP800105
377 | PONP800106
378 | PONP800107
379 | PONP800108
380 | PONP930101
381 | PRAM820101
382 | PRAM820102
383 | PRAM820103
384 | PRAM900101
385 | PRAM900102
386 | PRAM900103
387 | PRAM900104
388 | PTIO830101
389 | PTIO830102
390 | PUNT030101
391 | PUNT030102
392 | QIAN880101
393 | QIAN880102
394 | QIAN880103
395 | QIAN880104
396 | QIAN880105
397 | QIAN880106
398 | QIAN880107
399 | QIAN880108
400 | QIAN880109
401 | QIAN880110
402 | QIAN880111
403 | QIAN880112
404 | QIAN880113
405 | QIAN880114
406 | QIAN880115
407 | QIAN880116
408 | QIAN880117
409 | QIAN880118
410 | QIAN880119
411 | QIAN880120
412 | QIAN880121
413 | QIAN880122
414 | QIAN880123
415 | QIAN880124
416 | QIAN880125
417 | QIAN880126
418 | QIAN880127
419 | QIAN880128
420 | QIAN880129
421 | QIAN880130
422 | QIAN880131
423 | QIAN880132
424 | QIAN880133
425 | QIAN880134
426 | QIAN880135
427 | QIAN880136
428 | QIAN880137
429 | QIAN880138
430 | QIAN880139
431 | RACS770101
432 | RACS770102
433 | RACS770103
434 | RACS820101
435 | RACS820102
436 | RACS820103
437 | RACS820104
438 | RACS820105
439 | RACS820106
440 | RACS820107
441 | RACS820108
442 | RACS820109
443 | RACS820110
444 | RACS820111
445 | RACS820112
446 | RACS820113
447 | RACS820114
448 | RADA880101
449 | RADA880102
450 | RADA880103
451 | RADA880104
452 | RADA880105
453 | RADA880106
454 | RADA880107
455 | RADA880108
456 | RICJ880101
457 | RICJ880102
458 | RICJ880103
459 | RICJ880104
460 | RICJ880105
461 | RICJ880106
462 | RICJ880107
463 | RICJ880108
464 | RICJ880109
465 | RICJ880110
466 | RICJ880111
467 | RICJ880112
468 | RICJ880113
469 | RICJ880114
470 | RICJ880115
471 | RICJ880116
472 | RICJ880117
473 | ROBB760101
474 | ROBB760102
475 | ROBB760103
476 | ROBB760104
477 | ROBB760105
478 | ROBB760106
479 | ROBB760107
480 | ROBB760108
481 | ROBB760109
482 | ROBB760110
483 | ROBB760111
484 | ROBB760112
485 | ROBB760113
486 | ROBB790101
487 | ROSG850101
488 | ROSG850102
489 | ROSM880101
490 | ROSM880102
491 | ROSM880103
492 | SIMZ760101
493 | SNEP660101
494 | SNEP660102
495 | SNEP660103
496 | SNEP660104
497 | SUEM840101
498 | SUEM840102
499 | SUYM030101
500 | SWER830101
501 | TAKK010101
502 | TANS770101
503 | TANS770102
504 | TANS770103
505 | TANS770104
506 | TANS770105
507 | TANS770106
508 | TANS770107
509 | TANS770108
510 | TANS770109
511 | TANS770110
512 | TSAJ990101
513 | TSAJ990102
514 | VASM830101
515 | VASM830102
516 | VASM830103
517 | VELV850101
518 | VENT840101
519 | VHEG790101
520 | VINM940101
521 | VINM940102
522 | VINM940103
523 | VINM940104
524 | WARP780101
525 | WEBA780101
526 | WERD780101
527 | WERD780102
528 | WERD780103
529 | WERD780104
530 | WILM950101
531 | WILM950102
532 | WILM950103
533 | WILM950104
534 | WIMW960101
535 | WOEC730101
536 | WOLR790101
537 | WOLR810101
538 | WOLS870101
539 | WOLS870102
540 | WOLS870103
541 | YUTK870101
542 | YUTK870102
543 | YUTK870103
544 | YUTK870104
545 | ZASB820101
546 | ZHOH040101
547 | ZHOH040102
548 | ZHOH040103
549 | ZIMJ680101
550 | ZIMJ680102
551 | ZIMJ680103
552 | ZIMJ680104
553 | ZIMJ680105
--------------------------------------------------------------------------------
/Standalone/Data/Grantham.csv:
--------------------------------------------------------------------------------
1 | Name,A,R,N,D,C,Q,E,G,H,I,L,K,M,F,P,S,T,W,Y,V
2 | A,0,112,111,126,195,91,107,60,86,94,96,106,84,113,27,99,58,148,112,64
3 | R,112,0,86,96,180,43,54,125,29,97,102,26,91,97,103,110,71,101,77,96
4 | N,111,86,0,23,139,46,42,80,68,149,153,94,142,158,91,46,65,174,143,133
5 | D,126,96,23,0,154,61,45,94,81,168,172,101,160,177,108,65,85,181,160,152
6 | C,195,180,139,154,0,154,170,159,174,198,198,202,196,205,169,112,149,215,194,192
7 | Q,91,43,46,61,154,0,29,87,24,109,113,53,101,116,76,68,42,130,99,96
8 | E,107,54,42,45,170,29,0,98,40,134,138,56,126,140,93,80,65,152,122,121
9 | G,60,125,80,94,159,87,98,0,98,135,138,127,127,153,42,56,59,184,147,109
10 | H,86,29,68,81,174,24,40,98,0,94,99,32,87,100,77,89,47,115,83,84
11 | I,94,97,149,168,198,109,134,135,94,0,5,102,10,21,95,142,89,61,33,29
12 | L,96,102,153,172,198,113,138,138,99,5,0,107,15,22,98,145,92,61,36,32
13 | K,106,26,94,101,202,53,56,127,32,102,107,0,95,102,103,121,78,110,85,97
14 | M,84,91,142,160,196,101,126,127,87,10,15,95,0,28,87,135,81,67,36,21
15 | F,113,97,158,177,205,116,140,153,100,21,22,102,28,0,114,155,103,40,22,50
16 | P,27,103,91,108,169,76,93,42,77,95,98,103,87,114,0,74,38,147,110,68
17 | S,99,110,46,65,112,68,80,56,89,142,145,121,135,155,74,0,58,177,144,124
18 | T,58,71,65,85,149,42,65,59,47,89,92,78,81,103,38,58,0,128,92,69
19 | W,148,101,174,181,215,130,152,184,115,61,61,110,67,40,147,177,128,0,37,88
20 | Y,112,77,143,160,194,99,122,147,83,33,36,85,36,22,110,144,92,37,0,55
21 | V,64,96,133,152,192,96,121,109,84,29,32,97,21,50,68,124,69,88,55,0
22 |
--------------------------------------------------------------------------------
/Standalone/Data/PhysicoChemical.csv:
--------------------------------------------------------------------------------
1 | 0,0,0,0,0,0,1,0,1,0,0,0,0,0,1,0,0,0,0,0
2 | 0,0,1,1,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
3 | 1,1,0,0,1,1,0,1,0,1,1,1,1,1,0,1,1,1,1,1
4 | 0,1,0,0,0,0,0,0,0,0,0,0,0,1,0,1,1,0,0,1
5 | 1,0,0,0,1,1,0,1,0,1,1,0,1,0,0,0,0,1,1,0
6 | 1,0,0,0,0,1,0,1,0,1,0,0,1,0,0,0,0,1,0,0
7 | 0,0,0,0,0,0,0,0,0,0,0,0,1,0,0,0,0,0,0,0
8 | 0,0,0,0,1,0,0,0,0,0,0,0,0,0,0,0,0,0,1,1
9 | 0,0,1,1,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
10 | 0,0,0,0,0,0,1,0,1,0,0,0,0,0,1,0,0,0,0,0
11 | 1,1,0,0,1,1,0,1,0,1,1,1,1,1,0,1,1,1,1,1
12 | 1,1,0,0,1,0,0,1,0,1,1,0,1,0,0,0,1,1,1,0
13 | 0,0,0,0,0,0,1,0,1,0,0,1,1,0,1,0,0,0,0,0
14 | 0,0,1,1,0,1,0,0,0,0,0,0,0,1,0,1,1,0,0,0
15 | 0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,1,1,0,0,0
16 | 0,1,0,0,0,0,0,0,0,0,1,0,0,0,0,0,0,0,0,0
17 | 1,0,0,1,0,0,1,0,1,1,1,0,0,1,1,0,0,0,0,0
18 | 0,1,0,0,1,0,0,1,0,0,0,0,0,0,0,0,1,1,1,1
19 | 0,0,1,0,0,1,0,0,0,0,0,1,1,0,0,1,0,0,0,0
20 | 1,1,0,0,1,1,0,1,0,1,0,0,0,0,0,0,0,1,1,0
21 | 0,0,1,1,0,0,0,0,1,0,0,1,1,1,0,0,0,0,0,0
22 | 0,0,0,0,0,0,1,0,0,0,1,0,1,0,0,1,1,0,0,1
23 | 1,1,0,0,0,1,0,0,0,0,0,0,0,0,0,1,0,0,0,0
24 | 1,1,1,0,0,1,0,0,0,0,0,1,1,0,0,1,1,1,0,0
25 | 0,0,0,1,1,0,1,1,1,1,1,0,0,1,1,0,0,0,1,1
26 | 0.24,0.84,3.98,3.11,-4.22,2.05,2.47,-3.89,2.29,-4.28,-2.85,3.05,-1.66,1.75,3.52,2.39,0.75,-2.59,-4.36,-2.54
27 | -2.32,-1.67,0.93,0.26,1.94,-4.06,1.95,-1.73,0.89,-1.3,-0.22,1.62,0.27,0.5,2.5,-1.07,-2.18,-2.64,3.94,2.44
28 | 0.6,3.71,1.93,-0.11,1.06,0.36,0.26,-1.71,-2.49,-1.49,0.47,1.04,1.84,-1.44,-3.5,1.15,-1.12,-1.54,0.59,0.43
29 | -0.14,0.18,-2.46,-3.04,0.54,-0.82,3.9,-0.84,1.49,-0.72,1.94,-1.15,0.7,-1.34,1.99,-1.39,-1.46,-0.85,3.44,0.04
30 | 1.3,-2.65,0.75,-0.25,-0.62,-0.38,0.09,0.26,0.31,0.84,-0.98,-1.61,2,0.66,-0.17,0.67,-0.4,-0.02,-1.59,-1.47
--------------------------------------------------------------------------------
/Standalone/Data/README.md:
--------------------------------------------------------------------------------
1 | # Standalone Package of Pfeature
2 | ---------------------------------
3 | ## Introduction
4 | Pfeature is a standalone software package for computing wide range of protein and peptides features from their amino acid
5 | sequence. It has the following five major modules for computing protein features based on:
6 |
7 | - Composition
8 | - Binary Profile
9 | - Evolutionary information
10 | - Structure
11 | - Pattern
12 |
13 | We have developed number of forms of Pfeature that include:
14 |
15 | - A web server that uses Pfeature functions via web interface from https://webs.iiitd.edu.in/raghava/pfeature/
16 | - Standalone version of Pfeature
17 | - Library of python for Pfeature
18 | - Python scripts for computing features
19 |
20 |
21 |
--------------------------------------------------------------------------------
/Standalone/Data/Schneider-Wrede.csv:
--------------------------------------------------------------------------------
1 | Name,A,C,D,E,F,G,H,I,K,L,M,N,P,Q,R,S,T,V,W,Y
2 | A,0,0.112,0.819,0.827,0.54,0.208,0.696,0.407,0.891,0.406,0.379,0.318,0.191,0.372,1,0.094,0.22,0.273,0.739,0.552
3 | C,0.114,0,0.847,0.838,0.437,0.32,0.66,0.304,0.887,0.301,0.277,0.324,0.157,0.341,1,0.176,0.233,0.167,0.639,0.457
4 | D,0.729,0.742,0,0.124,0.924,0.697,0.435,0.847,0.249,0.841,0.819,0.56,0.657,0.584,0.295,0.667,0.649,0.797,1,0.836
5 | E,0.79,0.788,0.133,0,0.932,0.779,0.406,0.86,0.143,0.854,0.83,0.599,0.688,0.598,0.234,0.726,0.682,0.824,1,0.837
6 | F,0.508,0.405,0.977,0.918,0,0.69,0.663,0.128,0.903,0.131,0.169,0.541,0.42,0.459,1,0.548,0.499,0.252,0.207,0.179
7 | G,0.206,0.312,0.776,0.807,0.727,0,0.769,0.592,0.894,0.591,0.557,0.381,0.323,0.467,1,0.158,0.272,0.464,0.923,0.728
8 | H,0.896,0.836,0.629,0.547,0.907,1,0,0.848,0.566,0.842,0.825,0.754,0.777,0.716,0.697,0.865,0.834,0.831,0.981,0.821
9 | I,0.403,0.296,0.942,0.891,0.134,0.592,0.652,0,0.892,0.013,0.057,0.457,0.311,0.383,1,0.443,0.396,0.133,0.339,0.213
10 | K,0.889,0.871,0.279,0.149,0.957,0.9,0.438,0.899,0,0.892,0.871,0.667,0.757,0.639,0.154,0.825,0.759,0.882,1,0.848
11 | L,0.405,0.296,0.944,0.892,0.139,0.596,0.653,0.013,0.893,0,0.062,0.452,0.309,0.376,1,0.443,0.397,0.133,0.341,0.205
12 | M,0.383,0.276,0.932,0.879,0.182,0.569,0.648,0.058,0.884,0.062,0,0.447,0.285,0.372,1,0.417,0.358,0.12,0.391,0.255
13 | N,0.424,0.425,0.838,0.835,0.766,0.512,0.78,0.615,0.891,0.603,0.588,0,0.266,0.175,1,0.361,0.368,0.503,0.945,0.641
14 | P,0.22,0.179,0.852,0.831,0.515,0.376,0.696,0.363,0.875,0.357,0.326,0.231,0,0.228,1,0.196,0.161,0.244,0.72,0.481
15 | Q,0.512,0.462,0.903,0.861,0.671,0.648,0.765,0.532,0.881,0.518,0.505,0.181,0.272,0,1,0.461,0.389,0.464,0.831,0.522
16 | R,0.919,0.905,0.305,0.225,0.977,0.928,0.498,0.929,0.141,0.92,0.908,0.69,0.796,0.668,0,0.86,0.808,0.914,1,0.859
17 | S,0.1,0.185,0.801,0.812,0.622,0.17,0.718,0.478,0.883,0.474,0.44,0.289,0.181,0.358,1,0,0.174,0.342,0.827,0.615
18 | T,0.251,0.261,0.83,0.812,0.604,0.312,0.737,0.455,0.866,0.453,0.403,0.315,0.159,0.322,1,0.185,0,0.345,0.816,0.596
19 | V,0.275,0.165,0.9,0.867,0.269,0.471,0.649,0.135,0.889,0.134,0.12,0.38,0.212,0.339,1,0.322,0.305,0,0.472,0.31
20 | W,0.658,0.56,1,0.931,0.196,0.829,0.678,0.305,0.892,0.304,0.344,0.631,0.555,0.538,0.968,0.689,0.638,0.418,0,0.204
21 | Y,0.587,0.478,1,0.932,0.202,0.782,0.678,0.23,0.904,0.219,0.268,0.512,0.444,0.404,0.995,0.612,0.557,0.328,0.244,0
22 |
--------------------------------------------------------------------------------
/Standalone/Data/aa_attr_group.csv:
--------------------------------------------------------------------------------
1 | attr 1 2 3
2 | hydrophobicity R,K,E,D,Q,N G,A,S,T,P,H,Y C,L,V,I,M,F,W
3 | normalized vander Waals volume G,A,S,T,P,D N,V,E,Q,I,L M,H,K,F,R,Y,W
4 | polarity L,I,F,W,C,M,V,Y P,A,T,G,S H,Q,R,K,N,E,D
5 | polarizability G,A,S,D,T C,P,N,V,E,Q,I,L K,M,H,F,R,Y,W
6 | charge K,R A,N,C,Q,G,H,I,L,M,F,P,S,T,W,Y,V D,E
7 | secondary structure E,A,L,M,Q,K,R,H V,I,Y,C,W,F,T G,N,P,S,D
8 | solvent accessibility A,L,F,C,G,I,V,W R,K,Q,E,N,D M,S P,T,H,Y
9 |
--------------------------------------------------------------------------------
/Standalone/Data/aaind.txt:
--------------------------------------------------------------------------------
1 | ANDN920101
2 | ARGP820101
3 | ARGP820102
4 | ARGP820103
5 | AURR980101
6 | AURR980102
7 | AURR980103
8 | AURR980104
9 | AURR980105
10 | AURR980106
11 | AURR980107
12 | AURR980108
13 | AURR980109
14 | AURR980110
15 | AURR980111
16 | AURR980112
17 | AURR980113
18 | AURR980114
19 | AURR980115
20 | AURR980116
21 | AURR980117
22 | AURR980118
23 | AURR980119
24 | AURR980120
25 | BAEK050101
26 | BASU050101
27 | BASU050102
28 | BASU050103
29 | BEGF750101
30 | BEGF750102
31 | BEGF750103
32 | BHAR880101
33 | BIGC670101
34 | BIOV880101
35 | BIOV880102
36 | BLAM930101
37 | BLAS910101
38 | BROC820101
39 | BROC820102
40 | BULH740101
41 | BULH740102
42 | BUNA790101
43 | BUNA790102
44 | BUNA790103
45 | BURA740101
46 | BURA740102
47 | CASG920101
48 | CEDJ970101
49 | CEDJ970102
50 | CEDJ970103
51 | CEDJ970104
52 | CEDJ970105
53 | CHAM810101
54 | CHAM820101
55 | CHAM820102
56 | CHAM830101
57 | CHAM830102
58 | CHAM830103
59 | CHAM830104
60 | CHAM830105
61 | CHAM830106
62 | CHAM830107
63 | CHAM830108
64 | CHOC750101
65 | CHOC760101
66 | CHOC760102
67 | CHOC760103
68 | CHOC760104
69 | CHOP780101
70 | CHOP780201
71 | CHOP780202
72 | CHOP780203
73 | CHOP780204
74 | CHOP780205
75 | CHOP780206
76 | CHOP780207
77 | CHOP780208
78 | CHOP780209
79 | CHOP780210
80 | CHOP780211
81 | CHOP780212
82 | CHOP780213
83 | CHOP780214
84 | CHOP780215
85 | CHOP780216
86 | CIDH920101
87 | CIDH920102
88 | CIDH920103
89 | CIDH920104
90 | CIDH920105
91 | COHE430101
92 | CORJ870101
93 | CORJ870102
94 | CORJ870103
95 | CORJ870104
96 | CORJ870105
97 | CORJ870106
98 | CORJ870107
99 | CORJ870108
100 | COSI940101
101 | COWR900101
102 | CRAJ730101
103 | CRAJ730102
104 | CRAJ730103
105 | DAWD720101
106 | DAYM780101
107 | DAYM780201
108 | DESM900101
109 | DESM900102
110 | DIGM050101
111 | EISD840101
112 | EISD860101
113 | EISD860102
114 | EISD860103
115 | ENGD860101
116 | FASG760101
117 | FASG760102
118 | FASG760103
119 | FASG760104
120 | FASG760105
121 | FASG890101
122 | FAUJ830101
123 | FAUJ880101
124 | FAUJ880102
125 | FAUJ880103
126 | FAUJ880104
127 | FAUJ880105
128 | FAUJ880106
129 | FAUJ880107
130 | FAUJ880108
131 | FAUJ880109
132 | FAUJ880110
133 | FAUJ880111
134 | FAUJ880112
135 | FAUJ880113
136 | FINA770101
137 | FINA910101
138 | FINA910102
139 | FINA910103
140 | FINA910104
141 | FODM020101
142 | FUKS010101
143 | FUKS010102
144 | FUKS010103
145 | FUKS010104
146 | FUKS010105
147 | FUKS010106
148 | FUKS010107
149 | FUKS010108
150 | FUKS010109
151 | FUKS010110
152 | FUKS010111
153 | FUKS010112
154 | GARJ730101
155 | GEIM800101
156 | GEIM800102
157 | GEIM800103
158 | GEIM800104
159 | GEIM800105
160 | GEIM800106
161 | GEIM800107
162 | GEIM800108
163 | GEIM800109
164 | GEIM800110
165 | GEIM800111
166 | GEOR030101
167 | GEOR030102
168 | GEOR030103
169 | GEOR030104
170 | GEOR030105
171 | GEOR030106
172 | GEOR030107
173 | GEOR030108
174 | GEOR030109
175 | GOLD730101
176 | GOLD730102
177 | GRAR740101
178 | GRAR740102
179 | GRAR740103
180 | GUOD860101
181 | GUYH850101
182 | GUYH850102
183 | GUYH850104
184 | GUYH850105
185 | HARY940101
186 | HOPA770101
187 | HOPT810101
188 | HUTJ700101
189 | HUTJ700102
190 | HUTJ700103
191 | ISOY800101
192 | ISOY800102
193 | ISOY800103
194 | ISOY800104
195 | ISOY800105
196 | ISOY800106
197 | ISOY800107
198 | ISOY800108
199 | JACR890101
200 | JANJ780101
201 | JANJ780102
202 | JANJ780103
203 | JANJ790101
204 | JANJ790102
205 | JOND750101
206 | JOND750102
207 | JOND920101
208 | JOND920102
209 | JUKT750101
210 | JUNJ780101
211 | JURD980101
212 | KANM800101
213 | KANM800102
214 | KANM800103
215 | KANM800104
216 | KARP850101
217 | KARP850102
218 | KARP850103
219 | KARS160101
220 | KARS160102
221 | KARS160103
222 | KARS160104
223 | KARS160105
224 | KARS160106
225 | KARS160107
226 | KARS160108
227 | KARS160109
228 | KARS160110
229 | KARS160111
230 | KARS160112
231 | KARS160113
232 | KARS160114
233 | KARS160115
234 | KARS160116
235 | KARS160117
236 | KARS160118
237 | KARS160119
238 | KARS160120
239 | KARS160121
240 | KARS160122
241 | KHAG800101
242 | KIDA850101
243 | KIMC930101
244 | KLEP840101
245 | KOEP990101
246 | KOEP990102
247 | KRIW710101
248 | KRIW790101
249 | KRIW790102
250 | KRIW790103
251 | KUHL950101
252 | KUMS000101
253 | KUMS000102
254 | KUMS000103
255 | KUMS000104
256 | KYTJ820101
257 | LAWE840101
258 | LEVM760101
259 | LEVM760102
260 | LEVM760103
261 | LEVM760104
262 | LEVM760105
263 | LEVM760106
264 | LEVM760107
265 | LEVM780101
266 | LEVM780102
267 | LEVM780103
268 | LEVM780104
269 | LEVM780105
270 | LEVM780106
271 | LEWP710101
272 | LIFS790101
273 | LIFS790102
274 | LIFS790103
275 | MANP780101
276 | MAXF760101
277 | MAXF760102
278 | MAXF760103
279 | MAXF760104
280 | MAXF760105
281 | MAXF760106
282 | MCMT640101
283 | MEEJ800101
284 | MEEJ800102
285 | MEEJ810101
286 | MEEJ810102
287 | MEIH800101
288 | MEIH800102
289 | MEIH800103
290 | MITS020101
291 | MIYS850101
292 | MIYS990101
293 | MIYS990102
294 | MIYS990103
295 | MIYS990104
296 | MIYS990105
297 | MONM990101
298 | MONM990201
299 | MUNV940101
300 | MUNV940102
301 | MUNV940103
302 | MUNV940104
303 | MUNV940105
304 | NADH010101
305 | NADH010102
306 | NADH010103
307 | NADH010104
308 | NADH010105
309 | NADH010106
310 | NADH010107
311 | NAGK730101
312 | NAGK730102
313 | NAGK730103
314 | NAKH900101
315 | NAKH900102
316 | NAKH900103
317 | NAKH900104
318 | NAKH900105
319 | NAKH900106
320 | NAKH900107
321 | NAKH900108
322 | NAKH900109
323 | NAKH900110
324 | NAKH900111
325 | NAKH900112
326 | NAKH900113
327 | NAKH920101
328 | NAKH920102
329 | NAKH920103
330 | NAKH920104
331 | NAKH920105
332 | NAKH920106
333 | NAKH920107
334 | NAKH920108
335 | NISK800101
336 | NISK860101
337 | NOZY710101
338 | OLSK800101
339 | ONEK900101
340 | ONEK900102
341 | OOBM770101
342 | OOBM770102
343 | OOBM770103
344 | OOBM770104
345 | OOBM770105
346 | OOBM850101
347 | OOBM850102
348 | OOBM850103
349 | OOBM850104
350 | OOBM850105
351 | PALJ810101
352 | PALJ810102
353 | PALJ810103
354 | PALJ810104
355 | PALJ810105
356 | PALJ810106
357 | PALJ810107
358 | PALJ810108
359 | PALJ810109
360 | PALJ810110
361 | PALJ810111
362 | PALJ810112
363 | PALJ810113
364 | PALJ810114
365 | PALJ810115
366 | PALJ810116
367 | PARJ860101
368 | PARS000101
369 | PARS000102
370 | PLIV810101
371 | PONJ960101
372 | PONP800101
373 | PONP800102
374 | PONP800103
375 | PONP800104
376 | PONP800105
377 | PONP800106
378 | PONP800107
379 | PONP800108
380 | PONP930101
381 | PRAM820101
382 | PRAM820102
383 | PRAM820103
384 | PRAM900101
385 | PRAM900102
386 | PRAM900103
387 | PRAM900104
388 | PTIO830101
389 | PTIO830102
390 | PUNT030101
391 | PUNT030102
392 | QIAN880101
393 | QIAN880102
394 | QIAN880103
395 | QIAN880104
396 | QIAN880105
397 | QIAN880106
398 | QIAN880107
399 | QIAN880108
400 | QIAN880109
401 | QIAN880110
402 | QIAN880111
403 | QIAN880112
404 | QIAN880113
405 | QIAN880114
406 | QIAN880115
407 | QIAN880116
408 | QIAN880117
409 | QIAN880118
410 | QIAN880119
411 | QIAN880120
412 | QIAN880121
413 | QIAN880122
414 | QIAN880123
415 | QIAN880124
416 | QIAN880125
417 | QIAN880126
418 | QIAN880127
419 | QIAN880128
420 | QIAN880129
421 | QIAN880130
422 | QIAN880131
423 | QIAN880132
424 | QIAN880133
425 | QIAN880134
426 | QIAN880135
427 | QIAN880136
428 | QIAN880137
429 | QIAN880138
430 | QIAN880139
431 | RACS770101
432 | RACS770102
433 | RACS770103
434 | RACS820101
435 | RACS820102
436 | RACS820103
437 | RACS820104
438 | RACS820105
439 | RACS820106
440 | RACS820107
441 | RACS820108
442 | RACS820109
443 | RACS820110
444 | RACS820111
445 | RACS820112
446 | RACS820113
447 | RACS820114
448 | RADA880101
449 | RADA880102
450 | RADA880103
451 | RADA880104
452 | RADA880105
453 | RADA880106
454 | RADA880107
455 | RADA880108
456 | RICJ880101
457 | RICJ880102
458 | RICJ880103
459 | RICJ880104
460 | RICJ880105
461 | RICJ880106
462 | RICJ880107
463 | RICJ880108
464 | RICJ880109
465 | RICJ880110
466 | RICJ880111
467 | RICJ880112
468 | RICJ880113
469 | RICJ880114
470 | RICJ880115
471 | RICJ880116
472 | RICJ880117
473 | ROBB760101
474 | ROBB760102
475 | ROBB760103
476 | ROBB760104
477 | ROBB760105
478 | ROBB760106
479 | ROBB760107
480 | ROBB760108
481 | ROBB760109
482 | ROBB760110
483 | ROBB760111
484 | ROBB760112
485 | ROBB760113
486 | ROBB790101
487 | ROSG850101
488 | ROSG850102
489 | ROSM880101
490 | ROSM880102
491 | ROSM880103
492 | SIMZ760101
493 | SNEP660101
494 | SNEP660102
495 | SNEP660103
496 | SNEP660104
497 | SUEM840101
498 | SUEM840102
499 | SUYM030101
500 | SWER830101
501 | TAKK010101
502 | TANS770101
503 | TANS770102
504 | TANS770103
505 | TANS770104
506 | TANS770105
507 | TANS770106
508 | TANS770107
509 | TANS770108
510 | TANS770109
511 | TANS770110
512 | TSAJ990101
513 | TSAJ990102
514 | VASM830101
515 | VASM830102
516 | VASM830103
517 | VELV850101
518 | VENT840101
519 | VHEG790101
520 | VINM940101
521 | VINM940102
522 | VINM940103
523 | VINM940104
524 | WARP780101
525 | WEBA780101
526 | WERD780101
527 | WERD780102
528 | WERD780103
529 | WERD780104
530 | WILM950101
531 | WILM950102
532 | WILM950103
533 | WILM950104
534 | WIMW960101
535 | WOEC730101
536 | WOLR790101
537 | WOLR810101
538 | WOLS870101
539 | WOLS870102
540 | WOLS870103
541 | YUTK870101
542 | YUTK870102
543 | YUTK870103
544 | YUTK870104
545 | ZASB820101
546 | ZHOH040101
547 | ZHOH040102
548 | ZHOH040103
549 | ZIMJ680101
550 | ZIMJ680102
551 | ZIMJ680103
552 | ZIMJ680104
553 | ZIMJ680105
--------------------------------------------------------------------------------
/Standalone/Data/aaindex.csv:
--------------------------------------------------------------------------------
1 | INDEX,A,C,D,E,F,G,H,I,K,L,M,N,P,Q,R,S,T,V,W,Y
2 | ANDN920101,4.35,4.65,4.76,4.29,4.66,3.97,4.63,3.95,4.36,4.17,4.52,4.75,4.44,4.37,4.38,4.5,4.35,3.95,4.7,4.6
3 | ARGP820101,0.61,1.07,0.46,0.47,2.02,0.07,0.61,2.22,1.15,1.53,1.18,0.06,1.95,0,0.6,0.05,0.05,1.32,2.65,1.88
4 | ARGP820102,1.18,1.89,0.05,0.11,1.96,0.49,0.31,1.45,0.06,3.23,2.67,0.23,0.76,0.72,0.2,0.97,0.84,1.08,0.77,0.39
5 | ARGP820103,1.56,1.23,0.14,0.23,2.03,0.62,0.29,1.67,0.15,2.93,2.96,0.27,0.76,0.51,0.45,0.81,0.91,1.14,1.08,0.68
6 | AURR980101,0.94,0.6,1.19,1.41,1.06,1.18,1.15,1.07,1.03,0.95,0.88,0.79,1.18,0.94,1.15,0.69,0.87,0.9,0.91,1.04
7 | AURR980102,0.98,0.41,1.05,1.04,1.12,1.25,1.01,0.88,1.06,0.8,1.12,1.05,1.31,0.9,1.14,1.02,0.8,0.87,0.9,1.12
8 | AURR980103,1.05,0.6,1.39,1.11,0.95,1.26,1.43,0.95,0.97,0.96,0.99,0.91,1.05,0.87,0.81,0.96,1.03,0.62,1.06,0.94
9 | AURR980104,0.75,0.66,1.72,1.1,0.88,1.14,0.96,0.8,0.66,1.01,1.02,1.24,1.33,1.08,0.9,1.2,1.13,0.58,0.68,0.8
10 | AURR980105,0.67,0.37,1.58,0.94,0.96,0.98,0.83,0.78,0.84,0.79,0.98,1.28,1.12,1.05,0.76,1.25,1.41,0.67,0.94,0.82
11 | AURR980106,1.1,0.26,1.14,2.3,0.9,0.55,0.83,1.06,1.08,0.84,0.9,0.72,1.67,1.31,1.05,0.81,0.77,0.76,1.26,0.99
12 | AURR980107,1.39,0.52,1.64,2.07,1,0.65,1.36,0.64,0.8,0.91,1.1,0.67,0.94,1.6,0.95,0.69,0.92,0.7,1.1,0.73
13 | AURR980108,1.43,0.52,0.9,1.7,1.1,0.56,0.66,1.18,0.82,1.52,1.68,0.55,0.15,1.43,1.33,0.61,0.75,1.14,1.68,0.65
14 | AURR980109,1.55,0.59,0.61,1.34,1.39,0.37,0.89,1.47,1.27,1.36,2.13,0.6,0.03,1.43,1.39,0.44,0.65,1.18,1.1,0.93
15 | AURR980110,1.8,0.55,0.9,1.73,0.96,0.32,0.46,1.09,1.24,1.47,1.64,0.73,0.15,0.97,1.73,0.67,0.7,0.81,0.68,0.91
16 | AURR980111,1.52,0.26,1.04,1.76,1.14,0.3,0.83,1.25,1.1,1.26,1.14,0.58,0.44,1.41,1.49,0.66,0.73,1.03,0.68,1.04
17 | AURR980112,1.49,0.37,0.94,1.55,0.86,0.29,0.96,1.04,1.17,1.4,1.84,0.67,0.2,1.52,1.41,0.68,0.79,0.94,1.52,1.06
18 | AURR980113,1.73,0.63,0.68,1.16,1.35,0.32,0.76,1.15,1.22,1.8,2.21,0.7,0.07,0.88,1.24,0.65,0.46,0.94,1.57,1.1
19 | AURR980114,1.33,0.44,0.6,1.43,1.22,0.2,1.02,1.58,1.71,1.63,1.76,0.64,0.07,1.37,1.39,0.42,0.57,1.08,1,1.02
20 | AURR980115,1.87,0.33,0.91,1.88,0.67,0.33,0.89,0.9,1.63,1.65,1.35,0.7,0.03,1.24,1.66,0.71,0.5,0.51,1,0.73
21 | AURR980116,1.19,0.44,0.72,1.27,1.2,0.74,1.55,0.61,1.45,1.36,1.35,1.33,0.1,1.43,1.45,1.02,0.82,0.46,0.58,1.06
22 | AURR980117,0.77,0.44,0.79,0.92,1.04,2.74,1.65,0.64,1.19,0.66,0.74,1.39,0.66,0.95,1.11,0.64,0.82,0.53,0.58,0.93
23 | AURR980118,0.93,0.67,1.15,1.07,1.05,1.08,1.4,1.14,1.27,1.16,1.11,0.82,1.01,1.02,0.96,0.71,0.84,0.74,1.06,1.15
24 | AURR980119,1.09,0.26,1.17,1.31,0.84,0.97,0.88,0.97,1.13,0.87,0.96,1.03,2.01,1.08,1.29,0.76,0.79,0.77,0.91,0.64
25 | AURR980120,0.71,0.65,1.43,1.19,0.95,1.07,1.13,1.05,1.1,0.84,0.8,0.95,1.7,0.87,1.09,0.65,0.086,1.12,1.25,0.85
26 | BAEK050101,0.0166,0.5724,-0.1278,-0.1794,0.3561,-0.0442,0.1643,0.2758,-0.2134,0.2523,0.0197,-0.0786,-0.4188,-0.1051,-0.0762,-0.1629,-0.0701,0.1782,0.3836,0.25
27 | BASU050101,0.1366,0.2745,-0.1233,-0.0484,0.4076,-0.0464,0.0549,0.4172,-0.0101,0.4251,0.1747,-0.0345,0.0019,0.0325,0.0363,-0.0433,0.0589,0.4084,0.2362,0.3167
28 | BASU050102,0.0728,0.3557,-0.0552,-0.0295,0.4201,-0.0589,0.0874,0.3805,-0.0053,0.3819,0.1613,-0.039,-0.0492,0.0126,0.0394,-0.0282,0.0239,0.2947,0.4114,0.3113
29 | BASU050103,0.151,0.3222,0.0047,-0.0639,0.3455,0.0248,0.1335,0.4238,-0.0158,0.3926,0.216,0.0381,0.0844,0.0246,-0.0103,0.004,0.1462,0.3997,0.2657,0.2998
30 | BEGF750101,1,0.06,0.44,0.73,0.6,0.35,0.6,0.73,0.6,1,1,0.35,0.06,0.44,0.52,0.35,0.44,0.82,0.73,0.44
31 | BEGF750102,0.77,0.65,0.65,0.55,0.98,0.65,0.83,0.98,0.55,0.83,0.98,0.55,0.55,0.72,0.72,0.55,0.83,0.98,0.77,0.83
32 | BEGF750103,0.37,0.84,0.97,0.53,0.53,0.97,0.75,0.37,0.75,0.53,0.64,0.97,0.97,0.64,0.84,0.84,0.75,0.37,0.97,0.84
33 | BHAR880101,0.357,0.346,0.511,0.497,0.314,0.544,0.323,0.462,0.466,0.365,0.295,0.463,0.509,0.493,0.529,0.507,0.444,0.386,0.305,0.42
34 | BIGC670101,52.6,68.3,68.4,84.7,113.9,36.3,91.9,102,105.1,102,97.7,75.7,73.6,89.7,109.1,54.9,71.2,85.1,135.4,116.2
35 | BIOV880101,16,168,-78,-106,189,-13,50,151,-141,145,124,-74,-20,-73,-70,-70,-38,123,145,53
36 | BIOV880102,44,90,-91,-139,148,-8,47,100,-188,108,121,-72,-36,-117,-68,-60,-54,117,163,22
37 | BLAM930101,0.96,0.42,0.42,0.53,0.59,0,0.57,0.84,0.73,0.92,0.86,0.39,-2.5,0.8,0.77,0.53,0.54,0.63,0.58,0.72
38 | BLAS910101,0.616,0.68,0.028,0.043,1,0.501,0.165,0.943,0.283,0.943,0.738,0.236,0.711,0.251,0,0.359,0.45,0.825,0.878,0.88
39 | BROC820101,7.3,-9.2,-2.9,-7.1,19.2,-1.2,-2.1,6.6,-3.7,20,5.6,-5.7,5.1,-0.3,-3.6,-4.1,0.8,3.5,16.3,5.9
40 | BROC820102,3.9,-14.3,-2.8,-7.5,14.7,-2.3,2,11,-2.5,15,4.1,-2.8,5.6,1.8,3.2,-3.5,1.1,2.1,17.8,3.8
41 | BULH740101,-0.2,-0.45,-0.2,-0.3,-2.33,0,-0.12,-2.26,-0.35,-2.46,-1.47,0.08,-0.98,0.16,-0.12,-0.39,-0.52,-1.56,-2.01,-2.24
42 | BULH740102,0.691,0.624,0.558,0.632,0.756,0.592,0.646,0.809,0.767,0.842,0.709,0.596,0.73,0.649,0.728,0.594,0.655,0.777,0.743,0.743
43 | BUNA790101,8.249,8.312,8.41,8.368,8.228,8.391,8.415,8.195,8.408,8.423,8.418,8.747,0,8.411,8.274,8.38,8.236,8.436,8.094,8.183
44 | BUNA790102,4.349,4.686,4.765,4.295,4.663,3.972,4.63,4.224,4.358,4.385,4.513,4.755,4.471,4.373,4.396,4.498,4.346,4.184,4.702,4.604
45 | BUNA790103,6.5,7.7,7,7,9.4,5.6,8,7,6.5,6.5,0,7.5,0,6,6.9,6.5,6.9,7,0,6.8
46 | BURA740101,0.486,0.2,0.288,0.538,0.318,0.12,0.4,0.37,0.402,0.42,0.417,0.193,0.208,0.418,0.262,0.2,0.272,0.379,0.462,0.161
47 | BURA740102,0.288,0.533,0.271,0.262,0.318,0.312,0.2,0.411,0.265,0.4,0.375,0.229,0.34,0.327,0.362,0.354,0.388,0.495,0.231,0.429
48 | CASG920101,0.2,1.9,-1.4,-1.3,1,-0.1,0.4,1.4,-1.6,0.5,0.5,-0.5,-1,-1.1,-0.7,-0.7,-0.4,0.7,1.6,0.5
49 | CEDJ970101,8.6,2.9,4.9,5.1,3.7,7.8,2.1,4.6,6.3,8.8,2.5,4.6,4.9,4,4.2,7.3,6,6.7,1.4,3.6
50 | CEDJ970102,7.6,2.2,5.2,6.2,4,6.9,2.1,5.1,5.8,9.4,2.1,4.4,5.4,4.1,5,7.2,6.1,6.7,1.4,3.2
51 | CEDJ970103,8.1,2,3.8,4.6,5.6,7,2,6.7,4.4,11,2.8,3.7,4.7,3.1,4.6,7.3,5.6,7.7,1.8,3.3
52 | CEDJ970104,7.9,1.9,5.5,7.1,3.9,7.1,2.1,5.2,6.7,8.6,2.4,4,5.3,4.4,4.9,6.6,5.3,6.8,1.2,3.1
53 | CEDJ970105,8.3,1.6,4.7,6.5,2.7,6.3,2.1,3.7,7.9,7.4,2.3,3.7,6.9,4.7,8.7,8.8,5.1,5.3,0.7,2.4
54 | CHAM810101,0.52,0.62,0.76,0.68,0.7,0,0.7,1.02,0.68,0.98,0.78,0.76,0.36,0.68,0.68,0.53,0.5,0.76,0.7,0.7
55 | CHAM820101,0.046,0.128,0.105,0.151,0.29,0,0.23,0.186,0.219,0.186,0.221,0.134,0.131,0.18,0.291,0.062,0.108,0.14,0.409,0.298
56 | CHAM820102,-0.368,4.53,2.06,1.77,1.06,-0.525,0,0.791,0,1.07,0.656,0,-2.24,0.731,-1.03,-0.524,0,0.401,1.6,4.91
57 | CHAM830101,0.71,1.19,1.21,0.84,0.71,1.52,1.07,0.66,0.99,0.69,0.59,1.37,1.61,0.87,1.06,1.34,1.08,0.63,0.76,1.07
58 | CHAM830102,-0.118,0.083,0.048,-0.245,0.015,0.104,0.138,0.23,0.032,-0.052,-0.258,0.289,0,-0.105,0.124,0.225,0.166,0.513,0.158,0.094
59 | CHAM830103,0,1,1,1,1,0,1,2,1,1,1,1,0,1,1,1,2,2,1,1
60 | CHAM830104,0,0,1,1,1,0,1,1,1,2,1,1,0,1,1,0,0,0,1,1
61 | CHAM830105,0,0,0,1,1,0,1,0,1,0,1,0,0,1,1,0,0,0,1.5,1
62 | CHAM830106,0,1,2,3,4,0,3,2,4,2,3,2,0,3,5,1,1,1,5,5
63 | CHAM830107,0,0,1,1,0,1,0,0,0,0,0,1,0,0,0,0,0,0,0,0
64 | CHAM830108,0,1,0,0,1,0,1,0,1,0,1,1,0,1,1,0,0,0,1,1
65 | CHOC750101,91.5,117.7,124.5,155.1,203.4,66.4,167.3,168.8,171.3,167.9,170.8,135.2,129.3,161.1,202,99.1,122.1,141.7,237.6,203.6
66 | CHOC760101,115,135,150,190,210,75,195,175,200,170,185,160,145,180,225,115,140,155,255,230
67 | CHOC760102,25,19,50,49,24,23,43,18,97,23,31,63,50,71,90,44,47,18,32,60
68 | CHOC760103,0.38,0.45,0.15,0.18,0.5,0.36,0.17,0.6,0.03,0.45,0.4,0.12,0.18,0.07,0.01,0.22,0.23,0.54,0.27,0.15
69 | CHOC760104,0.2,0.22,0.04,0.03,0.14,0.18,0.02,0.19,0,0.16,0.11,0.03,0.04,0.01,0,0.08,0.08,0.18,0.04,0.03
70 | CHOP780101,0.66,1.19,1.46,0.74,0.6,1.56,0.95,0.47,1.01,0.59,0.6,1.56,1.52,0.98,0.95,1.43,0.96,0.5,0.96,1.14
71 | CHOP780201,1.42,0.7,1.01,1.51,1.13,0.57,1,1.08,1.16,1.21,1.45,0.67,0.57,1.11,0.98,0.77,0.83,1.06,1.08,0.69
72 | CHOP780202,0.83,1.19,0.54,0.37,1.38,0.75,0.87,1.6,0.74,1.3,1.05,0.89,0.55,1.1,0.93,0.75,1.19,1.7,1.37,1.47
73 | CHOP780203,0.74,0.96,1.52,0.95,0.66,1.56,0.95,0.47,1.19,0.5,0.6,1.46,1.56,0.96,1.01,1.43,0.98,0.59,0.6,1.14
74 | CHOP780204,1.29,0.66,2.02,2.44,0.61,0.76,0.73,0.67,0.66,0.58,0.71,0.81,2.01,1.22,0.44,0.74,1.08,0.61,1.47,0.68
75 | CHOP780205,1.2,1.11,0.61,1.24,1.1,0.42,1.77,0.98,1.83,1.13,1.57,0.59,0,1.22,1.25,0.96,0.75,1.25,0.4,0.73
76 | CHOP780206,0.7,0.65,0.98,1.04,0.93,1.41,1.22,0.78,1.01,0.85,0.83,1.42,1.1,0.75,0.34,1.55,1.09,0.75,0.62,0.99
77 | CHOP780207,0.52,0.94,1.06,0.59,1.04,1.64,1.86,0.87,1.49,0.84,0.52,1.64,1.58,0.7,1.24,0.93,0.86,0.32,0.16,0.96
78 | CHOP780208,0.86,0.87,0.38,0.35,1.5,0.63,0.54,1.94,1,1.3,1.43,0.66,0.66,1.65,0.9,0.63,1.17,1.69,1.49,1.07
79 | CHOP780209,0.75,1.11,0.85,0.55,1.5,0.74,0.9,1.35,0.74,1.27,0.95,1.21,0.4,0.65,0.9,0.79,0.75,1.79,1.19,1.96
80 | CHOP780210,0.67,1.34,1.39,0.92,0.3,1.46,0.78,0.59,1.09,0.46,0.52,1.86,1.58,1.09,0.89,1.41,1.09,0.42,0.48,1.23
81 | CHOP780211,0.74,0.53,1.32,0.85,0.44,1.68,0.96,0.53,0.82,0.59,0.85,1.13,1.69,0.77,1.05,1.49,1.16,0.59,1.59,1.01
82 | CHOP780212,0.06,0.149,0.147,0.056,0.059,0.102,0.14,0.043,0.055,0.061,0.068,0.161,0.102,0.074,0.07,0.12,0.086,0.062,0.077,0.082
83 | CHOP780213,0.076,0.053,0.11,0.06,0.041,0.085,0.047,0.034,0.115,0.025,0.082,0.083,0.301,0.098,0.106,0.139,0.108,0.048,0.013,0.065
84 | CHOP780214,0.035,0.117,0.179,0.077,0.065,0.19,0.093,0.013,0.072,0.036,0.014,0.191,0.034,0.037,0.099,0.125,0.065,0.028,0.064,0.114
85 | CHOP780215,0.058,0.128,0.081,0.064,0.065,0.152,0.054,0.056,0.095,0.07,0.055,0.091,0.068,0.098,0.085,0.106,0.079,0.053,0.167,0.125
86 | CHOP780216,0.64,0.92,1.61,0.8,0.62,1.63,0.77,0.29,1.13,0.36,0.51,1.56,2.04,0.84,1.05,1.52,0.98,0.43,0.48,1.08
87 | CIDH920101,-0.45,0.79,-1.52,-0.8,1.48,-1,1.07,0.76,-0.36,1.29,1.37,-0.2,-0.12,-0.99,-0.24,-0.98,-0.7,1.26,1.38,1.49
88 | CIDH920102,-0.08,0.76,-0.71,-1.31,1.53,-0.84,0.43,1.39,-0.09,1.24,1.27,-0.7,-0.01,-0.4,-0.09,-0.93,-0.59,1.09,2.25,1.53
89 | CIDH920103,0.36,0.7,-1.09,-0.83,1.01,-0.82,0.16,2.17,-0.56,1.18,1.21,-0.9,-0.06,-1.05,-0.52,-0.6,-1.2,1.21,1.31,1.05
90 | CIDH920104,0.17,1.24,-1.05,-1.19,1.29,-0.57,-0.25,2.06,-0.62,0.96,0.6,-0.9,-0.21,-1.2,-0.7,-0.83,-0.62,1.21,1.51,0.66
91 | CIDH920105,0.02,0.77,-1.04,-1.14,1.35,-0.8,0.26,1.81,-0.41,1.14,1,-0.77,-0.09,-1.1,-0.42,-0.97,-0.77,1.13,1.71,1.11
92 | COHE430101,0.75,0.61,0.6,0.66,0.77,0.64,0.67,0.9,0.82,0.9,0.75,0.61,0.76,0.67,0.7,0.68,0.7,0.86,0.74,0.71
93 | CORJ870101,50.76,58.74,43.17,43.48,53.45,50.27,49.33,57.3,42.92,53.89,52.75,45.8,45.39,46.09,48.66,47.24,49.26,56.12,53.59,51.79
94 | CORJ870102,-0.414,0.162,-1.31,-1.218,1.938,-0.684,-0.63,1.237,-0.67,1.215,1.02,-0.916,-0.503,-0.905,-0.584,-0.563,-0.289,0.899,0.514,1.699
95 | CORJ870103,-0.96,4.54,-5.68,-3.86,5.06,-1.28,-0.62,5.54,-5.62,6.81,4.76,-1.94,-4.47,-5.3,0.75,-1.92,-3.99,5.39,0.21,3.34
96 | CORJ870104,-0.26,0.83,-1.3,-0.73,1.09,-0.4,-0.18,1.1,-1.01,1.52,1.09,-0.46,-0.62,-0.83,0.08,-0.55,-0.71,1.15,-0.13,0.69
97 | CORJ870105,-0.73,0.64,-6.13,-2.9,5.2,-2.67,3.03,5.04,-5.99,4.91,3.34,-5.29,-4.32,-0.96,-1.03,-3,-1.91,3.98,0.51,2.87
98 | CORJ870106,-1.35,4.37,-11.88,-4.56,11.35,-5.82,6.54,10.93,-11.92,9.88,7.47,-10.96,-10.86,-1.34,-3.89,-6.21,-4.83,8.2,1.8,7.61
99 | CORJ870107,-0.56,1.78,-4.31,-2.35,3.67,-1.35,0.81,3.83,-4.08,4.09,3.11,-2.87,-3.22,-2.31,-0.26,-1.85,-1.97,3.31,-0.11,2.17
100 | CORJ870108,1.37,-4.47,8.93,4.04,-7.96,3.39,-1.65,-7.92,7.7,-8.68,-7.13,6.29,6.25,3.88,1.33,4.08,4.02,-6.94,0.79,-4.73
101 | COSI940101,0.0373,0.0829,0.1263,0.0058,0.0946,0.005,0.0242,0,0.0371,0,0.0823,0.0036,0.0198,0.0761,0.0959,0.0829,0.0941,0.0057,0.0548,0.0516
102 | COWR900101,0.42,0.84,-0.51,-0.37,1.74,0,-2.28,1.81,-2.03,1.8,1.18,-1.03,0.86,-0.96,-1.56,-0.64,-0.26,1.34,1.46,0.51
103 | CRAJ730101,1.33,0.93,0.97,1.66,1.15,0.58,1.49,0.99,1.03,1.29,1.4,0.72,0.49,1.42,0.79,0.83,0.94,0.96,1.33,0.49
104 | CRAJ730102,1,0.99,0.89,0.37,1.26,0.56,0.36,1.75,1.18,1.53,1.4,0.75,0.36,0.87,0.74,0.65,1.15,1.61,0.84,1.41
105 | CRAJ730103,0.6,1.29,1.24,0.64,1.05,1.38,0.95,0.67,1.1,0.7,0.67,1.42,1.47,0.92,0.79,1.26,1.05,0.48,1.23,1.35
106 | DAWD720101,2.5,3,2.5,5,6.5,0.5,6,5.5,7,5.5,6,5,5.5,6,7.5,3,5,5,7,7
107 | DAYM780101,8.6,2.9,5.5,6,3.6,8.4,2,4.5,6.6,7.4,1.7,4.3,5.2,3.9,4.9,7,6.1,6.6,1.3,3.4
108 | DAYM780201,100,20,106,102,41,49,66,96,56,40,94,134,56,93,65,120,97,74,18,41
109 | DESM900101,1.56,1.8,0.23,0.19,1.42,1.03,1,1.27,0.15,1.38,1.93,0.51,0.27,0.39,0.59,0.96,1.11,1.58,0.91,1.1
110 | DESM900102,1.26,1.6,0.27,0.23,1.46,1.08,1,1.44,0.33,1.36,1.52,0.59,0.54,0.39,0.38,0.98,1.01,1.33,1.06,0.89
111 | DIGM050101,1.076,0.753,1.29,1.118,0.869,1.346,0.985,0.926,1.105,1.054,0.974,1.056,0.82,0.729,1.361,1.342,0.871,1.131,0.666,0.531
112 | EISD840101,0.25,0.04,-0.72,-0.62,0.61,0.16,-0.4,0.73,-1.1,0.53,0.26,-0.64,-0.07,-0.69,-1.76,-0.26,-0.18,0.54,0.37,0.02
113 | EISD860101,0.67,0.38,-1.2,-0.76,2.3,0,0.64,1.9,-0.57,1.9,2.4,-0.6,1.2,-0.22,-2.1,0.01,0.52,1.5,2.6,1.6
114 | EISD860102,0,0.17,1.9,3,1.1,0,0.99,1.2,5.7,1,1.9,1.3,0.18,1.9,10,0.73,1.5,0.48,1.6,1.8
115 | EISD860103,0,0.76,-0.98,-0.89,0.92,0,-0.75,0.99,-0.99,0.89,0.94,-0.86,0.22,-1,-0.96,-0.67,0.09,0.84,0.67,-0.93
116 | ENGD860101,-1.6,-2,9.2,8.2,-3.7,-1,3,-3.1,8.8,-2.8,-3.4,4.8,0.2,4.1,12.3,-0.6,-1.2,-2.6,-1.9,0.7
117 | FASG760101,89.09,121.15,133.1,147.13,165.19,75.07,155.16,131.17,146.19,131.17,149.21,132.12,115.13,146.15,174.2,105.09,119.12,117.15,204.24,181.19
118 | FASG760102,297,178,270,249,284,290,277,284,224,337,283,236,222,185,238,228,253,293,282,344
119 | FASG760103,1.8,-16.5,5.05,12,-34.5,0,-38.5,12.4,14.6,-11,-10,-5.6,-86.2,6.3,12.5,-7.5,-28,5.63,-33.7,-10
120 | FASG760104,9.69,8.35,9.6,9.67,9.18,9.78,9.17,9.68,9.18,9.6,9.21,8.8,10.64,9.13,8.99,9.21,9.1,9.62,9.44,9.11
121 | FASG760105,2.34,1.92,1.88,2.1,2.16,2.35,1.82,2.36,2.16,2.36,2.28,2.02,1.95,2.17,1.82,2.19,2.09,2.32,2.43,2.2
122 | FASG890101,-0.21,-6.04,1.36,2.3,-4.65,0,-1.23,-4.81,3.88,-4.68,-3.66,0.96,0.75,1.52,2.11,1.74,0.78,-3.5,-3.32,-1.01
123 | FAUJ830101,0.31,1.54,-0.77,-0.64,1.79,0,0.13,1.8,-0.99,1.7,1.23,-0.6,0.72,-0.22,-1.01,-0.04,0.26,1.22,2.25,0.96
124 | FAUJ880101,1.28,1.77,1.6,1.56,2.94,0,2.99,4.19,1.89,2.59,2.35,1.6,2.67,1.56,2.34,1.31,3.03,3.67,3.21,2.94
125 | FAUJ880102,0.53,0.66,0.59,0.72,0.71,0,0.64,0.96,0.78,0.92,0.77,0.58,0,0.71,0.69,0.55,0.63,0.89,0.84,0.71
126 | FAUJ880103,1,2.43,2.78,3.78,5.89,0,4.66,4,4.77,4,4.43,2.95,2.72,3.95,6.13,1.6,2.6,3,8.08,6.47
127 | FAUJ880104,2.87,4.47,4.74,5.97,4.62,2.06,5.23,4.92,6.89,4.92,6.36,4.58,4.11,6.11,7.82,3.97,4.11,4.11,7.68,4.73
128 | FAUJ880105,1.52,1.52,1.52,1.52,1.52,1,1.52,1.9,1.52,1.52,1.52,1.52,1.52,1.52,1.52,1.52,1.73,1.9,1.52,1.52
129 | FAUJ880106,2.04,3.41,3.78,3.31,6.02,1,5.66,3.49,4.87,4.45,4.8,4.37,4.31,3.53,6.24,2.7,3.17,3.17,5.9,6.72
130 | FAUJ880107,7.3,14.4,9.2,11.4,13.9,0,10.2,16.1,10.9,10.1,10.4,8,17.8,10.6,11.1,13.1,16.7,17.2,13.2,13.9
131 | FAUJ880108,-0.01,0.12,0.15,0.07,0.03,0,0.08,-0.01,0,-0.01,0.04,0.06,0,0.05,0.04,0.11,0.04,0.01,0,0.03
132 | FAUJ880109,0,0,1,1,0,0,1,0,2,0,0,2,0,2,4,1,1,0,1,1
133 | FAUJ880110,0,0,4,4,0,0,1,0,1,0,0,3,0,3,3,2,2,0,0,2
134 | FAUJ880111,0,0,0,0,0,0,1,0,1,0,0,0,0,0,1,0,0,0,0,0
135 | FAUJ880112,0,0,1,1,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0,0
136 | FAUJ880113,4.76,3.67,5.69,5.48,4.31,3.77,2.84,4.81,4.27,4.79,4.25,3.64,0,4.54,4.3,3.83,3.87,4.86,4.75,4.3
137 | FINA770101,1.08,0.95,0.85,1.15,1.1,0.55,1,1.05,1.15,1.25,1.15,0.85,0.71,0.95,1.05,0.75,0.75,0.95,1.1,1.1
138 | FINA910101,1,1,3.2,1.7,1,1,1,0.6,0.7,1,1,1.7,1,1,0.7,1.7,1.7,0.6,1,1
139 | FINA910102,1,1,1.7,1.7,1,1.3,1,1,0.7,1,1,1,13,1,0.7,1,1,1,1,1
140 | FINA910103,1.2,1,0.7,0.7,1,0.8,1.2,0.8,1.7,1,1,1.2,1,1,1.7,1.5,1,0.8,1,1
141 | FINA910104,1,1,0.7,0.7,1,1.5,1,1,1.7,1,1,1,0.1,1,1.7,1,1,1,1,1
142 | FODM020101,0.7,1.17,0.87,0.96,1.34,0.64,1.39,1.29,0.91,1.44,0.91,1.47,0.12,0.73,0.95,0.84,0.74,1.2,1.8,1.68
143 | FUKS010101,4.47,0.29,7.05,16.56,2.32,8.29,1.74,3.3,12.98,5.06,1.71,3.89,5.41,2.87,8.48,4.27,3.83,4.05,0.67,2.75
144 | FUKS010102,6.77,0.31,8.57,12.93,1.92,7.95,2.8,2.72,10.2,4.43,1.87,5.5,4.79,5.24,6.87,5.41,5.36,3.57,0.54,2.26
145 | FUKS010103,7.43,0.42,8.71,5.86,1.18,9.4,1.49,1.76,9.67,2.74,0.6,9.12,5.6,5.42,4.51,9.6,8.95,3.1,1.18,3.26
146 | FUKS010104,5.22,1.01,7.91,10.66,1.68,5.81,2.27,2.36,12.68,4.52,1.85,6.06,5.7,6,7.3,6.99,5.16,4.1,0.56,2.16
147 | FUKS010105,9.88,1.12,3.5,4.02,5.27,6.88,1.88,10.08,3.39,13.21,2.44,2.35,3.8,1.66,3.71,4.1,4.98,12.53,1.11,4.07
148 | FUKS010106,10.98,1.47,3.37,3.51,4.97,7.48,2.2,9.74,2.54,12.79,3.1,2.85,3.42,2.3,3.26,4.93,5.55,10.69,1.28,3.55
149 | FUKS010107,9.95,1.3,4.46,2.58,5.41,8.87,1.99,7.73,2,9.66,2.45,4.84,3.2,2.64,3.05,6.03,5.62,9.46,2.6,6.15
150 | FUKS010108,8.26,2.67,2.8,2.67,7.32,5.62,1.98,8.95,1.89,16.46,2.67,2.54,3.3,2.86,2.8,6,5,10.24,2.01,3.96
151 | FUKS010109,7.39,0.74,5.14,9.8,3.91,7.53,1.82,6.96,7.81,9.45,2.1,3.06,4.54,2.22,5.91,4.18,4.45,8.62,0.9,3.46
152 | FUKS010110,9.07,0.95,5.73,7.77,3.59,7.69,2.47,6.56,6.01,9,2.54,4.05,4.04,3.63,4.9,5.15,5.46,7.47,0.95,2.96
153 | FUKS010111,8.82,0.9,6.38,4.05,3.51,9.11,1.77,5.05,5.45,6.54,1.62,6.77,4.28,3.89,3.71,7.64,7.12,6.6,1.96,4.85
154 | FUKS010112,6.65,1.79,5.5,6.89,4.34,5.72,2.13,5.47,7.59,10.15,2.24,4.4,4.56,4.52,5.17,6.52,5.08,7,1.24,3.01
155 | GARJ730101,0.28,0.28,0.21,0.33,2.18,0.17,0.21,0.82,0.09,1,0.74,0.25,0.39,0.35,0.1,0.12,0.21,0.6,5.7,1.26
156 | GEIM800101,1.29,0.79,1.1,1.49,1.13,0.63,1.33,1.05,1.33,1.31,1.54,0.81,0.63,1.07,1,0.78,0.77,0.81,1.18,0.71
157 | GEIM800102,1.13,1.32,0.94,1.2,1.01,0.83,1.09,1.05,1.08,1.13,1.23,1.06,0.82,0.93,1.09,1.01,1.17,1.13,1.32,0.88
158 | GEIM800103,1.55,1.44,1.55,1.67,0.4,0.59,1.21,1.27,1.2,1.25,1.37,1.2,0.21,1.13,0.2,1.01,0.55,0.64,1.86,1.08
159 | GEIM800104,1.19,0.95,1.07,1.64,1.02,0.6,1.03,1.12,1.27,1.18,1.49,0.94,0.68,1.32,1,0.81,0.85,0.74,1.18,0.77
160 | GEIM800105,0.84,1.27,0.59,0.57,1.15,0.94,0.81,1.29,0.86,1.1,0.88,0.66,0.8,1.02,1.04,1.05,1.2,1.56,1.15,1.39
161 | GEIM800106,0.86,0.91,0.66,0.37,1.34,0.86,1.07,1.17,1.01,1.28,1.15,0.6,0.61,1.11,1.15,0.91,1.14,1.31,1.13,1.37
162 | GEIM800107,0.91,1.12,0.74,0.41,1.26,0.91,1.01,1.29,0.86,1.23,0.96,0.72,0.65,0.9,0.99,0.93,1.05,1.58,1.15,1.21
163 | GEIM800108,0.91,0.93,1.4,0.97,0.72,1.51,0.9,0.65,0.82,0.59,0.58,1.64,1.66,0.94,1,1.23,1.04,0.6,0.67,0.92
164 | GEIM800109,0.8,0,1.6,0.4,1.2,2,0.96,0.85,0.94,0.8,0.39,1.1,2.1,1.6,0.96,1.3,0.6,0.8,0,1.8
165 | GEIM800110,1.1,1.05,1.41,1.4,0.6,1.3,0.85,0.67,0.94,0.52,0.69,1.57,1.77,0.81,0.93,1.13,0.88,0.58,0.62,0.41
166 | GEIM800111,0.93,0.92,1.22,1.05,0.71,1.45,0.96,0.58,0.91,0.59,0.6,1.36,1.67,0.83,1.01,1.25,1.08,0.62,0.68,0.98
167 | GEOR030101,0.964,0.778,0.916,1.051,1.119,0.835,1.014,0.922,0.944,1.085,1.032,0.944,1.299,1.047,1.143,0.947,1.017,0.955,0.895,1
168 | GEOR030102,0.974,0.972,0.892,1.054,1.122,0.845,0.949,0.928,0.946,1.11,0.923,0.988,1.362,1.092,1.129,0.932,1.023,0.923,0.879,0.902
169 | GEOR030103,0.938,0.6856,0.857,1.139,1.11,0.892,1.109,0.986,0.952,1,1.077,0.902,1.266,0.916,1.137,0.956,1.018,0.959,0.971,1.157
170 | GEOR030104,1.042,0.5,0.97,0.992,0.981,0.743,1.034,0.852,0.979,1.193,0.998,0.828,1.332,1.111,1.069,0.984,0.992,1.001,0.96,1.12
171 | GEOR030105,1.065,1.015,0.836,0.736,1.368,1.022,0.973,1.189,0.478,1.192,1.369,0.762,1.241,0.861,1.131,1.097,0.822,1.14,1.017,0.836
172 | GEOR030106,0.99,0.644,0.915,1.053,1.121,0.785,1.054,0.95,1.003,1.106,1.093,0.873,1.314,0.999,1.132,0.911,0.988,0.957,0.939,1.09
173 | GEOR030107,0.892,1.035,0.925,1.115,1.058,0.917,0.992,0.817,0.944,0.994,0.782,1.144,1.309,1.2,1.154,0.986,1.11,0.9,0.841,0.866
174 | GEOR030108,1.092,0.662,0.919,1.199,1.09,0.698,1.012,0.912,1.008,1.276,1.171,0.927,0.8,1.124,1.239,0.886,0.832,0.908,0.981,1.075
175 | GEOR030109,0.843,0.896,0.906,0.9,1.151,0.978,1.05,0.946,0.893,0.885,0.878,0.956,1.816,0.968,1.038,1.003,1.189,0.999,0.852,0.945
176 | GOLD730101,0.75,1,0,0,2.65,0,0,2.95,1.5,2.4,1.3,0.69,2.6,0.59,0.75,0,0.45,1.7,3,2.85
177 | GOLD730102,88.3,112.4,110.8,140.5,189,60,152.6,168.5,175.6,168.5,162.2,125.1,122.2,148.7,181.2,88.7,118.2,141.4,227,193
178 | GRAR740101,0,2.75,1.38,0.92,0,0.74,0.58,0,0.33,0,0,1.33,0.39,0.89,0.65,1.42,0.71,0,0.13,0.2
179 | GRAR740102,8.1,5.5,13,12.3,5.2,9,10.4,5.2,11.3,4.9,5.7,11.6,8,10.5,10.5,9.2,8.6,5.9,5.4,6.2
180 | GRAR740103,31,55,54,83,132,3,96,111,119,111,105,56,32.5,85,124,32,61,84,170,136
181 | GUOD860101,25,32,2,14,100,-2,-26,91,-26,100,68,-7,25,0,-7,-2,7,62,109,56
182 | GUYH850101,0.1,-1.42,0.78,0.83,-2.12,0.33,-0.5,-1.13,1.4,-1.18,-1.59,0.48,0.73,0.95,1.91,0.52,0.07,-1.27,-0.51,-0.21
183 | GUYH850102,0.05,-0.84,0.41,0.38,-0.45,0.31,-0.41,-0.69,0.57,-0.62,-0.38,0.29,0.46,0.46,0.12,0.12,0.38,-0.46,-0.98,-0.25
184 | GUYH850104,-0.31,-0.87,0.58,0.68,-0.45,-0.33,0.13,-0.66,1.79,-0.53,-0.38,0.49,0.34,0.7,1.3,0.1,0.21,-0.62,-0.27,0.4
185 | GUYH850105,-0.27,-0.23,0.5,0.33,-0.55,-0.22,0.37,-0.8,1.17,-0.44,-0.31,0.61,0.36,1,2,0.17,0.18,-0.65,0.05,0.48
186 | HARY940101,90.1,113.2,117.1,140.8,193.5,63.8,159.3,164.9,170,164.6,167.7,127.5,123.1,149.4,192.8,94.2,120,139.1,197.1,231.7
187 | HOPA770101,1,0.1,6.5,6.2,1.4,1.1,2.8,0.8,5.3,0.8,0.7,2.2,0.9,2.1,2.3,1.7,1.5,0.9,1.9,2.1
188 | HOPT810101,-0.5,-1,3,3,-2.5,0,-0.5,-1.8,3,-1.8,-1.3,0.2,0,0.2,3,0.3,-0.4,-1.5,-3.4,-2.3
189 | HUTJ700101,29.22,50.7,37.09,41.84,48.52,23.71,59.64,45,57.1,48.03,69.32,38.3,36.13,44.02,26.37,32.4,35.2,40.35,56.92,51.73
190 | HUTJ700102,30.88,53.83,40.66,44.98,51.06,24.74,65.99,49.71,63.21,50.62,55.32,41.7,39.21,46.62,68.43,35.65,36.5,42.75,60,51.15
191 | HUTJ700103,154.33,219.79,194.91,223.16,204.74,127.9,242.54,233.21,300.46,232.3,202.65,207.9,179.93,235.51,341.01,174.06,205.8,207.6,237.01,229.15
192 | ISOY800101,1.53,0.89,1,1.63,1.22,0.44,1.03,1.07,1.26,1.32,1.66,0.6,0.25,1.27,1.17,0.65,0.86,0.93,1.05,0.7
193 | ISOY800102,0.86,1.39,0.69,0.66,1.16,0.7,1.06,1.31,0.77,1.01,1.06,0.74,1.16,0.89,0.98,1.09,1.24,1.4,1.17,1.28
194 | ISOY800103,0.78,0.6,1.5,0.97,0.67,1.73,0.83,0.4,1.01,0.57,0.3,1.56,1.55,0.78,1.06,1.19,1.09,0.44,0.74,1.14
195 | ISOY800104,1.09,0.5,0.77,0.92,0.5,1.25,0.67,0.66,1.25,0.44,0.45,1.14,2.96,0.83,0.97,1.21,1.33,0.56,0.62,0.94
196 | ISOY800105,0.35,0.5,2.16,0.65,0.89,2.4,1.19,0.12,0.83,0.58,0.22,2.12,0.43,0.73,0.75,1.24,0.85,0.43,0.62,1.44
197 | ISOY800106,1.09,1.04,1.24,1.14,0.8,0.27,1.07,0.97,1.2,1.3,0.55,0.88,1.78,1.09,1.07,1.2,0.99,0.77,1.03,0.69
198 | ISOY800107,1.34,1.44,1.77,2.54,0.43,0.95,0,0.52,0.79,1.05,0,0.92,0.37,0.79,2.78,0.87,1.14,0,1.79,0.73
199 | ISOY800108,0.47,0.41,1.15,0.64,0.61,3.03,0.89,0.62,0.98,0.53,0.68,2.16,0.63,0.95,0.52,1.03,0.39,0.76,0.63,0.83
200 | JACR890101,0.18,0.27,-2.36,-2.1,0.5,0.09,-1.48,0.37,-2.53,0.41,0.44,-1.3,-0.2,-1.22,-5.4,-0.4,-0.34,0.32,-0.01,-0.08
201 | JANJ780101,27.8,15.5,60.6,68.2,25.5,24.5,50.7,22.8,103,27.6,33.5,60.1,51.5,68.7,94.7,42,45,23.7,34.7,55.2
202 | JANJ780102,51,74,19,16,58,52,34,66,3,60,52,22,25,16,5,35,30,64,49,24
203 | JANJ780103,15,5,50,55,10,10,34,13,85,16,20,49,45,56,67,32,32,14,17,41
204 | JANJ790101,1.7,4.6,0.4,0.3,2.2,1.8,0.8,3.1,0.05,2.4,1.9,0.4,0.6,0.3,0.1,0.8,0.7,2.9,1.6,0.5
205 | JANJ790102,0.3,0.9,-0.6,-0.7,0.5,0.3,-0.1,0.7,-1.8,0.5,0.4,-0.5,-0.3,-0.7,-1.4,-0.1,-0.2,0.6,0.3,-0.4
206 | JOND750101,0.87,1.52,0.66,0.67,2.87,0.1,0.87,3.15,1.64,2.17,1.67,0.09,2.77,0,0.85,0.07,0.07,1.87,3.77,2.67
207 | JOND750102,2.34,1.65,2.01,2.19,1.83,2.34,1.82,2.36,2.18,2.36,2.28,2.02,1.99,2.17,1.18,2.21,2.1,2.32,2.38,2.2
208 | JOND920101,0.077,0.02,0.052,0.062,0.04,0.074,0.023,0.053,0.059,0.091,0.024,0.043,0.051,0.041,0.051,0.069,0.059,0.066,0.014,0.032
209 | JOND920102,100,44,86,77,51,50,91,103,72,54,93,104,58,84,83,117,107,98,25,50
210 | JUKT750101,5.3,1.3,3.6,3.3,2.3,4.8,1.4,3.1,4.1,4.7,1.1,3,2.5,2.4,2.6,4.5,3.7,4.2,0.8,2.3
211 | JUNJ780101,685,241,400,427,303,707,155,394,575,581,132,397,366,313,382,593,490,553,99,292
212 | JURD980101,1.1,2.5,-3.6,-3.2,2.8,-0.64,-3.2,4.5,-4.11,3.8,1.9,-3.5,-1.9,-3.68,-5.1,-0.5,-0.7,4.2,-0.46,-1.3
213 | KANM800101,1.36,0.82,1.04,1.48,1.05,0.63,1.11,1.08,1.22,1.21,1.45,0.89,0.52,1.14,1,0.74,0.81,0.94,0.97,0.79
214 | KANM800102,0.81,1.17,0.71,0.53,1.2,0.88,0.92,1.48,0.77,1.24,1.05,0.62,0.61,0.98,0.85,0.92,1.18,1.66,1.18,1.23
215 | KANM800103,1.45,0.7,0.91,1.29,1.2,0.53,1.13,1.23,1.27,1.56,1.83,0.64,0.21,1.14,1.15,0.48,0.77,1.1,1.17,0.74
216 | KANM800104,0.75,1.46,0.31,0.46,1.37,0.83,0.83,1.87,0.66,1.56,0.86,0.33,0.52,0.75,0.79,0.82,1.36,2,0.79,1.08
217 | KARP850101,1.041,0.96,1.033,1.094,0.93,1.142,0.982,1.002,1.093,0.967,0.947,1.117,1.055,1.165,1.038,1.169,1.073,0.982,0.925,0.961
218 | KARP850102,0.946,0.878,1.089,1.036,0.912,1.042,0.952,0.892,1.082,0.961,0.862,1.006,1.085,1.025,1.028,1.048,1.051,0.927,0.917,0.93
219 | KARP850103,0.892,0.925,0.932,0.933,0.914,0.923,0.894,0.872,1.057,0.921,0.804,0.93,0.932,0.885,0.901,0.923,0.934,0.913,0.803,0.837
220 | KARS160101,-0.21,-6.04,1.36,2.3,-4.65,0,-1.23,-4.81,3.88,-4.68,-3.66,0.96,0.75,1.52,2.11,1.74,0.78,-3.5,-3.32,-1.01
221 | KARS160102,1,2,4,5,8,0,6,4,5,4,4,4,4,5,7,2,3,3,12,9
222 | KARS160103,2,4,8,10,14,0,14,8,10,8,8,8,8,10,12,4,6,6,24,18
223 | KARS160104,1,2,4,5,6,1,6,4,4,4,4,4,4,4,6,2,3,3,8,7
224 | KARS160105,1,2.33,5.17,6,7,0,6.71,3.25,7,5,5.4,5,4,5.86,8.12,1.67,3.25,3.25,11.1,8.88
225 | KARS160106,1,1,3,4,6,0,6,3,5,3,3,3,4,4,6,2,1,1,9,6
226 | KARS160107,1,3,6,8,11,0,9,6,9,6,7,6,4,8,12,3,4,4,14,13
227 | KARS160108,1,1.33,1.6,1.66,1.75,0,2,1.6,1.66,1.6,1.6,1.6,2,1.66,1.5,1.33,1.5,1.5,2.182,2
228 | KARS160109,2,6.243,11.539,11.53,14.851,0,12.876,10.851,10.363,11.029,9.49,11.539,12,12.207,12.499,5,9.928,9.928,13.511,12.868
229 | KARS160110,0,-2.243,-4.178,-3.425,-4.801,0,-3.721,-6.085,-3.151,-4.729,-2.812,-4.178,-4,-4.255,-4.307,1,-3.928,-3.928,-6.324,-4.793
230 | KARS160111,1,2,3,3.33,4.25,0,4.286,1.8,3,3.2,2.8,3.2,4,3.33,3.5,2,3,3,4,4.33
231 | KARS160112,2,2,0.528,-0.538,-1.672,0,-1.185,-1.517,-0.536,1.052,0.678,0.528,4,-1.043,-2.59,2,3,3,-2.576,-2.054
232 | KARS160113,6,6,12,12,18,1,15,12,12,12,18,12,12,12,19,6,6,6,24,18
233 | KARS160114,6,16.67,16.4,21,23.25,3.5,23.1,15.6,24.5,15.6,27.2,16.5,12,21.167,31.44,31.33,12.4,10.5,27.5,27.78
234 | KARS160115,6,12,12,14,18,1,18,12,18,12,18,14,12,15,20,8,8,6,18,20
235 | KARS160116,6,22,20,26,24,6,31,18,31,18,34,20,12,24,38,20,14,12,36,38
236 | KARS160117,12,28,34,40,48,7,47,30,37,30,40,33.007,24,39,45,22,27,24.007,68,56
237 | KARS160118,6,9.33,6.8,6.67,6,3.5,4.7,6,6.17,6,8,6.6,6,6.5,5,7.33,5.4,6,5.667,6.22
238 | KARS160119,12,28,28.634,28.731,26.993,7,24.243,24.841,22.739,25.021,31.344,27.708,24,27.831,23.343,20,23.819,24,29.778,28.252
239 | KARS160120,0,0,0,0,0,0,-1.734,-1.641,-0.179,0,0,0,0,0,0,0,-4.227,0,0.211,-0.96
240 | KARS160121,6,11.33,10.4,10.66,12,3.5,10.4,9.6,10.167,9.6,13.6,10,12,10.5,10.667,8.667,9,9,12.75,12.222
241 | KARS160122,0,6,2.969,1.822,2.026,0,1.605,3.373,1.372,3.113,2.656,3,12,1.849,4.2,6,6,6,2.044,1.599
242 | KHAG800101,49.1,0,0,0,54.7,64.6,75.7,18.9,0,15.6,6.8,-3.6,43.8,20,133,44.4,31,29.5,70.5,0
243 | KIDA850101,-0.27,-1.05,0.81,1.17,-1.43,-0.16,0.28,-0.77,1.7,-1.1,-0.73,0.81,-0.75,1.1,1.87,0.42,0.63,-0.4,-1.57,-0.56
244 | KIMC930101,-0.35,-0.47,-0.41,-0.41,-0.55,0,-0.46,-0.56,-0.41,-0.48,-0.46,-0.38,-0.23,-0.4,-0.44,-0.39,-0.48,-0.53,-0.48,-0.5
245 | KLEP840101,0,0,-1,-1,0,0,0,0,1,0,0,0,0,0,1,0,0,0,0,0
246 | KOEP990101,-0.04,0.57,0.27,-0.33,-0.01,1.24,-0.11,-0.26,-0.18,-0.38,-0.09,0.25,0,-0.02,-0.3,0.15,0.39,-0.06,0.21,0.05
247 | KOEP990102,-0.12,-0.63,1.12,0.91,-0.67,0.76,1.34,-0.77,0.29,0.15,-0.71,1.05,0,1.67,0.34,1.45,-0.7,-0.7,-0.14,-0.49
248 | KRIW710101,4.6,-1,5.7,5.6,3.2,7.6,4.5,2.6,7.9,3.25,1.4,5.9,7,6.1,6.5,5.25,4.8,3.4,4,4.35
249 | KRIW790101,4.32,1.73,6.04,6.17,2.59,6.09,5.66,2.31,7.92,3.93,2.44,6.24,7.19,6.13,6.55,5.37,5.16,3.31,2.78,3.58
250 | KRIW790102,0.28,0.11,0.33,0.37,0.1,0.28,0.23,0.12,0.59,0.16,0.08,0.31,0.46,0.39,0.34,0.27,0.26,0.22,0.15,0.25
251 | KRIW790103,27.5,44.6,40,62,115.5,0,79,93.5,100,93.5,94.1,58.7,41.9,80.7,105,29.3,51.3,71.5,145.5,117.3
252 | KUHL950101,0.78,0.55,1.35,1.45,0.47,0.68,0.99,0.47,1.1,0.56,0.66,1.2,0.69,1.19,1.58,1,1.05,0.51,0.7,1
253 | KUMS000101,8.9,0.6,6.3,6.9,3.3,9.4,2.2,7,6.1,7.4,2.3,4.4,4.2,2.8,4.6,4,5.7,8.2,1.3,4.5
254 | KUMS000102,9.2,1,6,6,3.4,9.4,2.1,6,6.5,7.7,2.4,5.1,4.2,2.9,3.6,5.5,5.7,8.2,1.2,3.7
255 | KUMS000103,14.1,0.1,5.7,8.8,5,4.1,2,7.1,7.7,9.1,3.3,3.2,0.7,3.7,5.5,3.9,4.4,5.9,1.2,4.5
256 | KUMS000104,13.4,0.8,4.6,7.8,4.5,4.6,3.3,6.5,7.5,10.6,3,3.7,1.3,4.8,3.9,3.8,4.6,7.1,1,3.3
257 | KYTJ820101,1.8,2.5,-3.5,-3.5,2.8,-0.4,-3.2,4.5,-3.9,3.8,1.9,-3.5,-1.6,-3.5,-4.5,-0.8,-0.7,4.2,-0.9,-1.3
258 | LAWE840101,-0.48,-0.32,-0.75,-0.71,1.03,0,-0.51,0.81,-0.09,1.02,0.81,-0.87,2.03,-0.32,-0.06,0.05,-0.35,0.56,0.66,1.24
259 | LEVM760101,-0.5,-1,2.5,2.5,-2.5,0,-0.5,-1.8,3,-1.8,-1.3,0.2,-1.4,0.2,3,0.3,-0.4,-1.5,-3.4,-2.3
260 | LEVM760102,0.77,1.38,1.99,2.63,2.97,0,2.76,1.83,2.94,2.08,2.34,1.98,1.42,2.58,3.72,1.28,1.43,1.49,3.58,3.36
261 | LEVM760103,121.9,113.7,121.2,118.2,118.2,0,118.2,118.9,122,118.1,113.1,117.5,81.9,118,121.4,117.9,117.1,121.7,118.4,110
262 | LEVM760104,243.2,209.4,215,213.6,203.7,300,219.9,217.9,210.9,205.6,204,207.1,237.4,205.4,206.6,232,226.7,220.3,203.7,195.6
263 | LEVM760105,0.77,1.22,1.43,1.77,1.9,0.58,1.78,1.56,2.08,1.54,1.8,1.45,1.25,1.75,2.38,1.08,1.24,1.29,2.21,2.13
264 | LEVM760106,5.2,6.1,5,6,7.1,4.2,6,7,6,7,6.8,5,6.2,6,6,4.9,5,6.4,7.6,7.1
265 | LEVM760107,0.025,0.1,0.1,0.1,0.39,0.025,0.1,0.19,0.2,0.19,0.19,0.1,0.17,0.1,0.2,0.025,0.1,0.15,0.56,0.39
266 | LEVM780101,1.29,1.11,1.04,1.44,1.07,0.56,1.22,0.97,1.23,1.3,1.47,0.9,0.52,1.27,0.96,0.82,0.82,0.91,0.99,0.72
267 | LEVM780102,0.9,0.74,0.72,0.75,1.32,0.92,1.08,1.45,0.77,1.02,0.97,0.76,0.64,0.8,0.99,0.95,1.21,1.49,1.14,1.25
268 | LEVM780103,0.77,0.81,1.41,0.99,0.59,1.64,0.68,0.51,0.96,0.58,0.41,1.28,1.91,0.98,0.88,1.32,1.04,0.47,0.76,1.05
269 | LEVM780104,1.32,0.92,1.03,1.44,1.02,0.61,1.31,0.93,1.25,1.31,1.39,0.95,0.58,1.1,0.98,0.76,0.79,0.93,0.97,0.73
270 | LEVM780105,0.86,1.04,0.69,0.66,1.21,0.89,0.85,1.47,0.77,1.04,0.93,0.73,0.68,1,0.97,1.02,1.27,1.43,1.26,1.31
271 | LEVM780106,0.79,0.79,1.47,1.02,0.77,1.67,0.81,0.5,0.99,0.57,0.51,1.25,1.78,0.92,0.9,1.3,0.97,0.46,0.79,0.93
272 | LEWP710101,0.22,0.2,0.73,0.08,0.08,0.58,0.14,0.22,0.27,0.19,0.38,0.42,0.46,0.26,0.28,0.55,0.49,0.08,0.43,0.46
273 | LIFS790101,0.92,1.16,0.48,0.61,1.25,0.61,0.93,1.81,0.7,1.3,1.19,0.6,0.4,0.95,0.93,0.82,1.12,1.81,1.54,1.53
274 | LIFS790102,1,0.91,0.5,0.59,1.3,0.79,0.38,2.6,0.59,1.42,1.49,0.54,0.35,0.28,0.68,0.7,0.59,2.63,0.89,1.08
275 | LIFS790103,0.9,1.24,0.47,0.62,1.23,0.56,1.12,1.54,0.74,1.26,1.09,0.62,0.42,1.18,1.02,0.87,1.3,1.53,1.75,1.68
276 | MANP780101,12.97,14.63,10.85,11.89,14,12.43,12.16,15.67,11.36,14.9,14.39,11.42,11.37,11.76,11.72,11.23,11.69,15.71,13.93,13.42
277 | MAXF760101,1.43,0.94,0.92,1.67,1.19,0.46,0.98,1.04,1.27,1.36,1.53,0.64,0.49,1.22,1.18,0.7,0.78,0.98,1.01,0.69
278 | MAXF760102,0.86,1.17,0.72,0.62,1.16,0.97,1.06,1.24,0.79,0.98,1.08,0.74,1.22,0.89,0.94,1.04,1.18,1.33,1.07,1.25
279 | MAXF760103,0.64,0.32,1.92,1.01,0.86,0.63,2.05,0.92,0.89,0.37,1.07,3.14,0.5,0.8,0.62,1.01,0.92,0.87,1,1.31
280 | MAXF760104,0.17,0.95,1.08,0.28,0.28,5.02,0.57,0.26,1.17,0.21,0,2.62,0.12,0.91,0.76,0.57,0.23,0.24,0,0.97
281 | MAXF760105,1.13,0.38,1.18,1.02,0.45,3.84,0.3,0.4,1.13,0.65,0,1.11,0,0.41,0.48,0.81,0.71,0.48,0.93,0.38
282 | MAXF760106,1,1.09,1.39,1.04,0.65,0.46,0.71,0.68,1.05,1.01,0.36,0.87,1.95,1.13,1.18,1.56,1.23,0.58,1.1,0.87
283 | MCMT640101,4.34,35.77,12,17.26,29.4,0,21.81,19.06,21.29,18.78,21.64,13.28,10.93,17.56,26.66,6.35,11.01,13.92,42.53,31.53
284 | MEEJ800101,0.5,-6.8,-8.2,-16.9,13.2,0,-3.5,13.9,0.1,8.8,4.8,0.8,6.1,-4.8,0.8,1.2,2.7,2.7,14.9,6.1
285 | MEEJ800102,-0.1,-2.2,-2.8,-7.5,13.9,-0.5,0.8,11.8,-3.2,10,7.1,-1.6,8,-2.5,-4.5,-3.7,1.5,3.3,18.1,8.2
286 | MEEJ810101,1.1,7.1,-1.6,0.7,13.4,-0.2,-0.7,8.5,-1.9,11,5.4,-4.2,4.4,-2.9,-0.4,-3.2,-1.7,5.9,17.1,7.4
287 | MEEJ810102,1,4.6,-0.5,1.1,12.6,0.2,-2.2,7,-3,9.6,4,-3,3.1,-2,-2,-2.9,-0.6,4.6,15.1,6.7
288 | MEIH800101,0.93,0.88,1.01,1.02,0.78,1.01,0.89,0.79,1.05,0.85,0.84,0.98,1,1.02,0.98,1.02,0.99,0.81,0.83,0.93
289 | MEIH800102,0.94,0.84,1.08,1.12,0.73,1.01,0.92,0.76,1.23,0.82,0.83,1.04,1.04,1.11,1.09,1.04,1.02,0.81,0.87,1.03
290 | MEIH800103,87,104,71,72,108,90,90,105,65,104,100,70,78,66,81,83,83,94,94,83
291 | MITS020101,0,0,0,1.27,0,0,1.45,0,3.67,0,0,0,0,1.25,2.45,0,0,0,6.93,5.06
292 | MIYS850101,2.36,3.36,1.67,1.74,4.37,2.06,2.41,4.17,1.23,3.93,4.22,1.7,1.89,1.75,1.92,1.81,2.04,3.49,3.82,2.91
293 | MIYS990101,-0.02,-0.96,0.72,0.74,-2.22,0.38,0,-1.89,1.01,-2.29,-1.36,0.63,0.47,0.56,0.44,0.55,0.25,-1.34,-1.28,-0.88
294 | MIYS990102,0,-0.16,0.12,0.12,-0.36,0.06,0,-0.31,0.17,-0.37,-0.22,0.1,0.08,0.09,0.07,0.09,0.04,-0.22,-0.21,-0.14
295 | MIYS990103,-0.03,-0.36,0.17,0.23,-0.34,0.09,-0.04,-0.33,0.32,-0.38,-0.3,0.13,0.2,0.13,0.09,0.1,0.01,-0.29,-0.24,-0.23
296 | MIYS990104,-0.04,-0.38,0.19,0.23,-0.38,0.09,-0.04,-0.34,0.33,-0.37,-0.3,0.13,0.19,0.14,0.07,0.12,0.03,-0.29,-0.33,-0.29
297 | MIYS990105,-0.02,-0.32,0.19,0.21,-0.33,-0.02,-0.02,-0.28,0.3,-0.32,-0.25,0.1,0.11,0.15,0.08,0.11,0.05,-0.23,-0.27,-0.23
298 | MONM990101,0.5,0.6,1.6,1.6,0.4,1.3,1.6,0.6,1.6,0.4,0.5,1.7,1.7,1.6,1.7,0.7,0.4,0.5,0.7,0.6
299 | MONM990201,0.4,0.7,1.5,1.3,0.3,1.1,1.4,0.5,1.4,0.3,0.5,1.6,1.6,1.4,1.5,0.9,0.7,0.4,0.9,0.9
300 | MUNV940101,0.423,0.877,0.87,0.167,0.706,1.162,0.802,0.566,0.615,0.494,0.444,0.906,1.945,0.594,0.503,0.928,0.884,0.706,0.69,0.778
301 | MUNV940102,0.619,1.107,0.932,0.675,0.968,1.361,1.034,0.876,0.784,0.74,0.736,1.089,1.78,0.77,0.753,0.969,1.053,0.939,0.91,1.009
302 | MUNV940103,1.08,0.733,1.266,1.085,0.685,1.104,0.906,0.583,1.026,0.789,0.812,1.197,1.412,1.05,0.976,0.987,0.784,0.546,0.755,0.665
303 | MUNV940104,0.978,0.573,1.038,0.962,0.585,1.405,0.724,0.502,0.841,0.766,0.729,0.915,2.613,0.863,0.784,0.784,0.569,0.444,0.671,0.56
304 | MUNV940105,1.4,1.14,1.89,1.42,1.07,2.06,1.25,1.02,1.34,1.33,1.12,1.61,3.9,1.33,1.23,1.2,0.99,0.87,1.1,0.98
305 | NADH010101,58,116,-97,-131,92,-11,-73,107,-24,95,78,-93,-79,-139,-184,-34,-7,100,59,-11
306 | NADH010102,51,137,-78,-115,108,-13,-55,106,-205,103,73,-84,-79,-128,-144,-26,-3,108,69,11
307 | NADH010103,41,169,-47,-90,128,-18,-35,104,-148,103,77,-74,-81,-104,-109,-31,10,116,102,36
308 | NADH010104,32,182,-29,-74,132,-22,-25,106,-124,104,82,-73,-82,-95,-95,-34,20,113,118,44
309 | NADH010105,24,194,0,-57,131,-28,-31,102,-9,103,90,-76,-85,-87,-79,-36,34,111,116,43
310 | NADH010106,5,224,45,-8,117,-47,-50,83,-38,82,83,-77,-103,-67,-57,-41,79,117,130,27
311 | NADH010107,-2,329,248,117,120,-66,-70,28,115,36,62,-97,-132,-37,-41,-52,174,114,179,-7
312 | NAGK730101,1.29,0.94,1,1.54,1.23,0.72,1.29,0.94,1.23,1.23,1.23,0.77,0.7,1.1,0.83,0.78,0.87,0.97,1.06,0.63
313 | NAGK730102,0.96,1.13,0.9,0.33,1.37,0.9,0.87,1.54,0.81,1.26,1.29,0.72,0.75,1.18,0.67,0.77,1.23,1.41,1.13,1.07
314 | NAGK730103,0.72,1.01,1.04,0.75,0.58,1.35,0.76,0.8,0.84,0.63,0.62,1.38,1.43,0.81,1.33,1.34,1.03,0.83,0.87,1.35
315 | NAKH900101,7.99,1.81,5.14,6.1,3.83,6.91,2.17,5.48,6.01,9.16,2.5,4.33,4.95,3.98,5.86,6.84,5.77,6.65,1.34,3.15
316 | NAKH900102,3.73,2.3,2.23,3,1.94,3.36,1.55,2.52,3.36,3.4,1.37,2.33,3.18,2.36,3.34,2.83,2.63,2.53,1.15,1.76
317 | NAKH900103,5.74,1.03,2.11,2.63,6.51,5.66,2.3,9.12,3.2,15.36,5.3,5.25,4.79,2.3,1.92,7.55,7.51,5.12,2.51,4.08
318 | NAKH900104,-0.6,-0.34,-1.36,-1.16,1.38,-0.37,0.08,1.44,-0.84,1.82,2.04,0.39,-0.05,-0.71,-1.18,0.25,0.66,-0.6,1.02,0.53
319 | NAKH900105,5.88,1.11,1.7,2.6,6.58,5.29,2.33,8.78,2.58,16.52,6,4.38,5.29,2.3,1.54,7.68,8.38,4.66,2.89,3.51
320 | NAKH900106,-0.57,-0.3,-1.54,-1.17,1.42,-0.48,0.1,1.31,-1.02,2.16,2.55,0.02,0.11,-0.71,-1.29,0.3,0.99,-0.79,1.35,0.2
321 | NAKH900107,5.39,0.86,3.07,2.7,6.34,6.52,2.23,9.94,4.67,12.64,3.68,7.31,3.62,2.31,2.81,7.24,5.44,6.18,1.64,5.42
322 | NAKH900108,-0.7,-0.41,-0.93,-1.13,1.29,-0.12,0.04,1.77,-0.4,1.02,0.86,1.28,-0.42,-0.71,-0.91,0.14,-0.13,-0.19,0.26,1.29
323 | NAKH900109,9.25,1.07,3.89,4.8,6.36,8.51,1.88,6.47,3.5,10.94,3.14,3.71,4.36,3.17,3.96,6.26,5.66,7.55,2.22,3.28
324 | NAKH900110,0.34,-0.32,-0.56,-0.43,1.3,0.48,-0.19,0.39,-0.75,0.52,0.47,-0.27,-0.19,-0.34,-0.57,-0.2,-0.04,0.36,0.77,0.07
325 | NAKH900111,10.17,1.48,1.18,1.15,9.6,8.87,1.07,10.91,1.04,16.22,4.12,1.36,2.24,1.57,1.21,5.38,5.61,11.44,2.67,2.68
326 | NAKH900112,6.61,0.83,0.59,1.63,7.76,4.88,1.14,12.91,1.15,21.66,7.17,1.84,3.51,1.2,0.41,6.84,8.89,6.3,2.11,2.57
327 | NAKH900113,1.61,0.37,0.75,1.5,1.24,3.12,0.46,1.61,0.62,1.37,1.59,0.73,0.67,0.61,0.4,0.68,0.92,1.3,1.63,0.67
328 | NAKH920101,8.63,1.03,6.24,7.82,2.73,6.8,2.7,3.48,6.25,8.44,2.14,4.18,6.28,4.76,6.75,8.53,4.43,5.44,0.8,2.54
329 | NAKH920102,10.88,0.69,6.13,9.34,2.93,7.72,2.15,1.8,6.11,8.03,3.79,5.75,7.21,4.68,6.01,7.25,3.51,4.57,0.47,1.01
330 | NAKH920103,5.15,3.24,5.75,7.05,3.52,6.38,2.69,4.4,5.25,8.11,1.6,4.81,5.65,4.45,4.38,8.04,7.41,7,1.68,3.42
331 | NAKH920104,5.04,2.2,5.26,6.07,3.72,7.09,2.99,4.32,6.31,9.88,1.85,5.94,6.22,4.5,3.73,8.05,5.2,6.19,2.1,3.32
332 | NAKH920105,9.9,2.55,0.35,0.08,6.47,8.14,0.2,15.25,0.16,22.28,1.85,0.94,2.38,0.87,0.09,4.17,4.33,14.34,2.21,3.42
333 | NAKH920106,6.69,1.7,4.97,7.76,3.59,6.32,2.11,4.51,8.36,8.23,2.46,4.49,5.2,5.39,6.65,7.4,5.18,5.27,1.06,2.75
334 | NAKH920107,5.08,2.95,5.96,6.04,4.36,8.2,2.1,4.95,4.93,8.03,2.61,5.75,4.84,4.24,4.75,6.41,5.87,6.07,2.31,4.55
335 | NAKH920108,9.36,2.56,0.94,0.94,10.99,6.17,0.47,13.73,0.58,16.64,3.93,2.31,1.96,1.14,0.27,5.58,4.68,12.43,2.2,3.13
336 | NISK800101,0.23,1.78,-1.13,-0.75,0.48,-0.07,0.11,1.19,-1.05,1.03,0.66,-0.94,-0.76,-0.57,-0.26,-0.67,-0.36,1.24,0.9,0.59
337 | NISK860101,-0.22,4.66,-4.12,-3.64,5.27,-1.62,1.28,5.58,-4.18,5.01,3.51,-2.65,-3.03,-2.76,-0.93,-2.84,-1.2,4.45,5.2,2.15
338 | NOZY710101,0.5,0,0,0,2.5,0,0.5,1.8,0,1.8,1.3,0,0,0,0,0,0.4,1.5,3.4,2.3
339 | OLSK800101,1.38,1.43,0.52,0.71,1.72,1.34,0.66,2.32,0.15,1.47,1.78,0.37,0.85,0.22,0,0.86,0.89,1.99,0.82,0.47
340 | ONEK900101,13.4,11.6,11.7,12.2,12.1,11.3,11.6,12,13,13,12.8,12,6.5,12.8,13.3,12.2,11.7,11.9,12.4,12.1
341 | ONEK900102,-0.77,-0.23,-0.15,-0.27,-0.41,0,-0.06,-0.23,-0.65,-0.62,-0.5,-0.07,3,-0.33,-0.68,-0.35,-0.11,-0.14,-0.45,-0.17
342 | OOBM770101,-1.895,-2.035,-1.518,-1.535,-1.864,-1.898,-1.755,-1.951,-1.374,-1.966,-1.963,-1.56,-1.699,-1.521,-1.475,-1.753,-1.767,-1.981,-1.869,-1.686
343 | OOBM770102,-1.404,-1.365,-1.162,-1.163,-1.135,-1.364,-1.215,-1.189,-1.074,-1.315,-1.303,-1.178,-1.236,-1.116,-0.921,-1.297,-1.252,-1.254,-1.03,-1.03
344 | OOBM770103,-0.491,-0.67,-0.356,-0.371,-0.729,-0.534,-0.54,-0.762,-0.3,-0.65,-0.659,-0.382,-0.463,-0.405,-0.554,-0.455,-0.515,-0.728,-0.839,-0.656
345 | OOBM770104,-9.475,-12.21,-12.144,-13.815,-20.504,-7.592,-17.55,-15.608,-12.366,-15.728,-15.704,-12.48,-11.893,-13.689,-16.225,-10.518,-12.369,-13.867,-26.166,-20.232
346 | OOBM770105,-7.02,-8.19,-9.296,-10.467,-12.485,-5.456,-12.15,-9.512,-9.666,-10.52,-10.424,-9.424,-8.652,-10.044,-10.131,-7.782,-8.764,-8.778,-14.42,-12.36
347 | OOBM850101,2.01,1.98,-2.05,0.93,2.68,0.12,-0.14,3.7,2.55,2.73,1.75,0.03,0.41,1.02,0.84,1.47,2.39,3.5,2.49,2.23
348 | OOBM850102,1.34,1.07,3.32,2.2,0.8,2.07,1.27,0.66,0.61,0.54,0.7,2.49,2.12,1.49,0.95,0.94,1.09,1.32,-4.65,-0.17
349 | OOBM850103,0.46,0.2,-0.33,0.48,0.52,0.64,-1.31,3.28,-1.71,0.43,0.15,1.31,-0.58,-1.12,-1.54,-0.83,-1.52,0.54,1.25,-2.21
350 | OOBM850104,-2.49,-3.13,8.86,4.04,-6.64,-0.56,4.22,-10.87,-9.97,-7.16,-4.96,2.27,5.19,1.79,2.55,-1.6,-4.75,-3.97,-17.84,9.25
351 | OOBM850105,4.55,-0.78,2.85,5.16,4.37,9.14,4.48,2.1,10.68,3.24,2.18,5.56,5.14,4.15,5.97,6.78,8.6,3.81,1.97,2.4
352 | PALJ810101,1.3,0.92,1.02,1.43,1.09,0.63,1.33,0.87,1.23,1.3,1.32,0.9,0.63,1.04,0.93,0.78,0.8,0.95,1.03,0.71
353 | PALJ810102,1.32,0.7,0.97,1.48,1.1,0.59,1.06,1.01,1.13,1.22,1.47,0.74,0.57,1.25,1.04,0.77,0.86,1.05,1.02,0.72
354 | PALJ810103,0.81,1.12,0.71,0.59,1.13,0.94,0.85,1.47,0.77,1.03,0.96,0.81,0.75,1.03,1.03,1.02,1.19,1.44,1.24,1.35
355 | PALJ810104,0.9,1.12,0.75,0.44,1.41,0.83,0.86,1.59,0.75,1.24,0.94,0.82,0.46,0.95,0.75,0.7,1.2,1.73,1.28,1.45
356 | PALJ810105,0.84,0.69,1.28,0.78,0.88,1.76,0.53,0.55,0.95,0.49,0.52,1.48,1.47,1,0.91,1.29,1.05,0.51,0.88,1.28
357 | PALJ810106,0.65,1.43,1.47,0.75,0.72,1.53,0.96,0.57,0.95,0.56,0.71,1.45,1.51,0.94,0.93,1.46,0.96,0.55,0.9,1.12
358 | PALJ810107,1.08,1.22,0.86,1.09,0.96,0.85,1.02,0.98,1.01,1.04,1.11,1.05,0.91,0.95,0.93,0.95,1.15,1.03,1.17,0.8
359 | PALJ810108,1.34,1.27,1.06,1.69,1.02,0.47,1.11,0.84,1.08,1.39,0.9,0.83,0.48,1.13,0.91,1.05,0.74,1.18,0.64,0.73
360 | PALJ810109,1.15,1.03,1,1.37,0.92,0.64,0.95,0.99,1.2,1.22,1.45,0.87,0.72,1.43,1.06,0.84,0.97,0.82,1.11,0.72
361 | PALJ810110,0.89,1.04,0.71,0.72,1.32,0.87,1.04,1.14,1,1.02,1.41,0.67,0.69,1.06,1.06,0.86,1.15,1.66,1.06,1.35
362 | PALJ810111,0.82,0.71,0.98,0.54,1.56,0.94,1.26,1.67,0.73,0.94,1.3,1.27,0.69,1.01,0.99,0.65,0.98,1.22,1.25,1.26
363 | PALJ810112,0.98,1.01,0.74,0.59,1.23,0.9,1.17,1.38,0.83,1.05,0.82,0.66,0.73,0.63,1.03,0.98,1.2,1.62,1.26,1.23
364 | PALJ810113,0.69,0,2.42,0.63,2.2,2.64,0.22,0.43,1.18,0,0.88,1.52,1.34,1.44,0,1.43,0.28,0.14,0,1.53
365 | PALJ810114,0.87,0.83,1.24,0.91,0.47,1.69,0.91,0.27,0.66,0.67,0,1.36,1.54,1.06,1.3,1.08,1.12,0.69,1.24,0.54
366 | PALJ810115,0.91,0.5,0.9,0.53,0.37,1.61,1.08,0.36,1.27,0.77,0.76,1.32,1.62,1.06,0.77,1.34,0.87,0.52,1.1,1.24
367 | PALJ810116,0.92,0.62,1.22,0.92,0.96,1.61,0.39,0.79,0.86,0.5,0.5,1.57,1.3,0.66,0.9,1.4,1.11,0.5,0.57,1.78
368 | PARJ860101,2.1,1.4,10,7.8,-9.2,5.7,2.1,-8,5.7,-9.2,-4.2,7,2.1,6,4.2,6.5,5.2,-3.7,-10,-1.9
369 | PARS000101,0.343,0.319,0.429,0.405,0.292,0.389,0.307,0.296,0.429,0.287,0.293,0.409,0.432,0.395,0.353,0.416,0.362,0.307,0.268,0.22
370 | PARS000102,0.32,0.198,0.424,0.514,0.314,0.374,0.299,0.306,0.446,0.34,0.313,0.384,0.354,0.436,0.327,0.376,0.339,0.294,0.291,0.287
371 | PLIV810101,-2.89,-2.49,-3.38,-2.94,-1.63,-3.25,-2.84,-1.72,-3.31,-1.61,-1.84,-3.41,-2.5,-3.15,-3.3,-3.3,-2.91,-2.08,-1.75,-2.42
372 | PONJ960101,91.5,114.4,135.2,154.6,198.8,67.5,163.2,162.6,162.5,163.4,165.9,138.3,123.4,156.4,196.1,102,126,138.4,209.8,237.2
373 | PONP800101,12.28,14.93,10.97,11.19,13.43,12.01,12.84,14.77,10.8,14.1,14.33,11,11.19,11.28,11.49,11.26,11.65,15.07,12.95,13.29
374 | PONP800102,7.62,10.93,6.18,6.38,8.99,7.31,7.85,9.99,5.72,9.37,9.83,6.17,6.64,6.67,6.81,6.93,7.08,10.38,8.41,8.53
375 | PONP800103,2.63,3.36,2.29,2.31,3.02,2.55,2.57,3.08,2.12,2.98,3.18,2.27,2.46,2.45,2.45,2.6,2.55,3.21,2.85,2.79
376 | PONP800104,13.65,14.49,10.98,12.55,14.08,15.36,11.59,14.63,11.96,14.01,13.4,12.24,11.51,11.3,11.28,11.26,13,12.88,12.06,12.64
377 | PONP800105,14.6,15.9,13.78,13.59,14.18,14.18,15.35,14.1,13.28,16.49,16.23,11.79,14.1,12.02,13.24,13.36,14.5,16.3,13.9,14.76
378 | PONP800106,10.67,14.15,10.21,11.71,13.27,10.95,12.07,12.95,9.93,13.07,15,10.85,10.62,11.71,11.05,11.18,10.53,13.86,11.41,11.52
379 | PONP800107,3.7,3.03,2.6,3.3,6.6,3.13,3.57,7.69,1.79,5.88,5.21,2.12,2.12,2.7,2.53,2.43,2.6,7.14,6.25,3.03
380 | PONP800108,6.05,7.86,4.95,5.1,6.62,6.16,5.8,7.51,4.88,7.37,6.39,5.04,5.65,5.45,5.7,5.53,5.81,7.62,6.98,6.73
381 | PONP930101,0.85,2.1,-1.1,-0.79,1.69,0,0.22,3.14,-1.19,1.99,1.42,-0.48,-1.14,-0.42,0.2,-0.52,-0.08,2.53,1.76,1.37
382 | PRAM820101,0.305,0.339,0.335,0.282,0.195,0.352,0.215,0.278,0.391,0.262,0.28,0.322,0.346,0.306,0.227,0.326,0.251,0.291,0.291,0.293
383 | PRAM820102,0.175,0.074,0.14,0.135,0.104,0.201,0.125,0.1,0.058,0.104,0.054,0.09,0.136,0.093,0.083,0.155,0.152,0.096,0.092,0.081
384 | PRAM820103,0.687,0.263,0.632,0.669,0.577,0.67,0.594,0.564,0.407,0.541,0.328,0.489,0.6,0.527,0.59,0.692,0.713,0.529,0.632,0.495
385 | PRAM900101,-6.7,-8.4,38.5,34.3,-15.5,-4.2,12.6,-13,36.8,-11.7,-14.2,20.1,0.8,17.2,51.5,-2.5,-5,-10.9,-7.9,2.9
386 | PRAM900102,1.29,1.11,1.04,1.44,1.07,0.56,1.22,0.97,1.23,1.3,1.47,0.9,0.52,1.27,0.96,0.82,0.82,0.91,0.99,0.72
387 | PRAM900103,0.9,0.74,0.72,0.75,1.32,0.92,1.08,1.45,0.77,1.02,0.97,0.76,0.64,0.8,0.99,0.95,1.21,1.49,1.14,1.25
388 | PRAM900104,0.78,0.8,1.41,1,0.58,1.64,0.69,0.51,0.96,0.59,0.39,1.28,1.91,0.97,0.88,1.33,1.03,0.47,0.75,1.05
389 | PTIO830101,1.1,0.95,0.65,1,1.1,0.6,0.85,1.1,1,1.25,1.15,0.8,0.1,1,0.95,0.75,0.75,0.95,1.1,1.1
390 | PTIO830102,1,1.9,0.5,0.7,3.1,0.3,0.8,4,0.7,2,1.9,0.6,0.2,1,0.7,0.9,1.7,4,2.2,2.8
391 | PUNT030101,-0.17,-0.06,0.37,0.15,-0.41,0.01,-0.02,-0.28,0.32,-0.28,-0.26,0.18,0.13,0.26,0.37,0.05,0.02,-0.17,-0.15,-0.09
392 | PUNT030102,-0.15,-0.15,0.41,0.3,-0.22,0.08,0.06,-0.29,0.24,-0.36,-0.19,0.22,0.15,0.03,0.32,0.16,-0.08,-0.24,-0.28,-0.03
393 | QIAN880101,0.12,-0.25,0.01,-0.02,0.05,-0.02,-0.06,-0.07,0.26,0.05,0,-0.1,-0.19,-0.03,0.04,-0.19,-0.04,-0.03,-0.06,-0.14
394 | QIAN880102,0.26,-0.15,0.15,0.21,0.12,-0.37,0.1,-0.03,0.12,-0.02,0,-0.03,-0.08,-0.13,-0.14,0.01,-0.34,0.02,-0.01,-0.29
395 | QIAN880103,0.64,0.03,0.33,0.51,-0.03,-0.09,-0.23,-0.22,-0.17,0.41,0.13,0.09,-0.43,-0.23,-0.1,-0.1,-0.07,-0.01,-0.02,-0.38
396 | QIAN880104,0.29,-0.05,0.11,0.28,0.24,-0.67,-0.26,0,-0.19,0.47,0.27,-0.04,-0.34,0.26,-0.03,-0.17,-0.2,-0.01,0.25,-0.3
397 | QIAN880105,0.68,-0.15,-0.02,0.44,0.06,-0.73,-0.14,-0.08,0.03,0.61,0.39,-0.09,-0.76,-0.15,-0.22,-0.26,-0.1,0.12,0.2,-0.04
398 | QIAN880106,0.34,-0.18,0.06,0.2,0.15,-0.88,-0.09,-0.03,-0.11,0.2,0.43,-0.33,-0.81,0.01,0.22,-0.35,-0.37,0.13,0.07,-0.31
399 | QIAN880107,0.57,-0.15,-0.46,0.26,0.03,-0.71,-0.05,0,0.16,0.48,0.41,-0.36,-1.12,0.15,0.23,-0.47,-0.54,0.31,-0.1,-0.35
400 | QIAN880108,0.33,-0.03,-0.44,0.21,0.48,-0.46,0.27,-0.33,0.23,0.57,0.79,-0.19,-1.86,0.19,0.1,-0.23,-0.33,0.24,0.15,-0.19
401 | QIAN880109,0.13,-0.09,-0.71,0.13,0.15,-0.39,0.32,0,0.37,0.5,0.63,-0.07,-1.4,0.12,0.08,-0.28,-0.21,0.17,0.02,-0.1
402 | QIAN880110,0.31,-0.26,-0.81,-0.06,0.1,-0.42,0.51,-0.15,0.47,0.56,0.58,-0.1,-1.33,0.41,0.18,-0.49,-0.44,-0.01,0.14,-0.08
403 | QIAN880111,0.21,-0.12,-0.58,-0.23,-0.06,-0.15,0.37,0.31,0.28,0.7,0.61,-0.04,-1.03,0.13,0.07,-0.28,-0.25,0,0.21,0.16
404 | QIAN880112,0.18,-0.29,-0.32,-0.25,0.05,-0.4,0.28,-0.03,0.41,0.62,0.21,-0.03,-0.84,-0.27,0.21,-0.05,-0.16,0.06,0.32,0.11
405 | QIAN880113,-0.08,-0.25,-0.24,-0.19,0,-0.1,0.29,-0.01,0.45,0.28,0.11,-0.08,-0.42,-0.28,0.05,0.07,-0.33,-0.13,0.36,0
406 | QIAN880114,-0.18,-0.26,0.05,-0.06,-0.18,0.23,0.24,-0.42,0.03,-0.23,-0.42,0.28,-0.13,0.21,-0.13,0.41,0.33,-0.07,-0.1,-0.1
407 | QIAN880115,-0.01,-0.27,-0.09,0.09,-0.12,0.13,0.22,-0.27,0.08,-0.25,-0.57,0.41,0.26,0.01,0.02,0.44,0.35,-0.09,-0.15,0.15
408 | QIAN880116,-0.19,-0.29,-0.06,-0.1,-0.32,0.19,-0.16,-0.08,-0.09,-0.42,-0.38,0.02,0.05,0.02,0.03,0.25,0.22,-0.15,-0.19,0.05
409 | QIAN880117,-0.14,-0.64,-0.1,-0.39,0.08,0.46,-0.04,0.16,0.04,-0.57,0.24,-0.27,0.02,-0.11,0.14,-0.12,0,0.29,-0.1,0.18
410 | QIAN880118,-0.31,-0.06,-0.54,-0.52,0.24,0.37,-0.32,0.57,-0.29,0.09,0.29,-0.53,-0.31,0.07,0.25,0.11,0.03,0.48,0.15,0.29
411 | QIAN880119,-0.1,0.13,-0.89,-0.34,0.36,-0.45,-0.34,0.95,-0.46,0.32,0.43,-0.89,-0.91,-0.04,0.19,-0.12,0.49,0.76,0.34,0.42
412 | QIAN880120,-0.25,0.13,-1.01,-0.62,0.48,-0.72,-0.16,1.1,-0.59,0.23,0.32,-0.77,-1.24,-0.12,-0.02,-0.31,0.17,0.69,0.45,0.77
413 | QIAN880121,-0.26,0.47,-0.55,-0.75,0.2,-0.56,-0.04,0.94,-0.55,0.25,-0.05,-0.34,-1.28,-0.33,-0.09,-0.28,0.08,0.67,0.22,0.53
414 | QIAN880122,0.05,0.36,-0.11,-0.35,0.2,0.14,0.02,0.47,-0.51,0.32,-0.1,-0.4,-0.79,-0.67,-0.11,0.03,-0.15,0.58,0.09,0.34
415 | QIAN880123,-0.44,0.13,-0.2,-0.28,-0.13,0.08,0.09,-0.04,-0.33,-0.12,-0.21,0.05,-0.48,-0.58,-0.13,0.27,0.47,0.06,-0.22,-0.11
416 | QIAN880124,-0.31,-0.11,0.13,-0.05,-0.04,0.45,-0.06,-0.25,-0.44,-0.44,-0.28,0.06,-0.29,-0.47,-0.1,0.34,0.27,0.11,-0.08,0.06
417 | QIAN880125,-0.02,-0.02,0.11,0.1,-0.03,0.38,-0.09,-0.48,-0.39,-0.26,-0.14,0.03,-0.04,-0.17,0.04,0.41,0.36,-0.18,-0.01,-0.08
418 | QIAN880126,-0.06,-0.19,0.24,-0.04,-0.33,0.17,0.19,-0.2,-0.43,-0.46,-0.52,0.1,0.37,-0.04,0.02,0.43,0.5,0,-0.32,0.35
419 | QIAN880127,-0.05,0.3,0.15,-0.02,0.09,-0.14,-0.07,0.26,-0.42,0.04,0.25,0,0.31,-0.08,0.06,-0.11,-0.06,0.04,0.19,0.33
420 | QIAN880128,-0.19,0.41,0.09,-0.2,0.07,0.28,-0.19,-0.06,-0.2,0.34,0.45,-0.38,0.04,0.04,0.17,-0.23,-0.02,0.05,0.16,0.22
421 | QIAN880129,-0.43,0.19,-0.31,-0.41,0.25,-0.21,0.21,0.29,0.33,-0.1,-0.01,0,0.28,0.14,0.06,-0.23,-0.26,-0.1,0.15,0.09
422 | QIAN880130,-0.19,0.42,-0.27,-0.22,-0.31,0.17,0.17,-0.34,0,-0.22,-0.53,0.17,0.14,-0.29,-0.07,0.22,0.1,-0.33,-0.15,-0.02
423 | QIAN880131,-0.25,0.18,0.6,-0.12,-0.29,0.09,0.42,-0.54,0.14,-0.55,-0.47,0.61,0.89,0.09,0.12,0.24,0.16,-0.45,-0.44,-0.19
424 | QIAN880132,-0.27,0,0.54,-0.12,-0.47,1.14,0.18,-0.74,0.45,-0.54,-0.76,0.71,1.4,-0.08,-0.4,0.4,-0.1,-0.86,-0.46,-0.05
425 | QIAN880133,-0.42,-0.18,0.95,-0.09,-0.39,1.24,0.05,-1.17,0.09,-0.69,-0.86,0.81,1.77,-0.01,-0.23,0.63,0.29,-1.32,-0.37,-0.41
426 | QIAN880134,-0.24,-0.38,0.65,0.07,-0.61,0.85,-0.21,-0.65,0.17,-0.8,-0.71,0.45,2.27,0.01,-0.04,0.33,0.13,-0.99,-0.44,-0.49
427 | QIAN880135,-0.14,-0.09,0.66,0.06,-0.25,0.36,-0.31,-0.51,-0.14,-0.8,-0.56,0.35,1.59,0.11,0.21,0.32,0.21,-0.7,-0.17,-0.35
428 | QIAN880136,0.01,-0.31,0.78,0.09,-0.2,0.14,-0.56,-0.09,-0.43,-0.81,-0.49,-0.11,1.14,-0.13,-0.13,0.13,-0.02,-0.11,-0.2,0.1
429 | QIAN880137,-0.3,0.03,0.44,0.18,0.11,-0.12,-0.2,-0.07,0.06,-0.18,-0.44,-0.12,0.77,0.24,-0.09,-0.09,-0.27,-0.06,-0.09,-0.25
430 | QIAN880138,-0.23,0.19,0.34,0.28,-0.02,0.14,-0.22,0.42,-0.15,-0.36,-0.19,0.06,0.78,0.47,-0.2,-0.29,-0.3,0.29,-0.18,0.07
431 | QIAN880139,0.08,0.37,0.04,0.36,0.34,-0.02,-0.45,0.09,-0.27,0.24,0.16,-0.06,0.16,0.48,-0.01,-0.35,-0.04,0.18,-0.06,-0.2
432 | RACS770101,0.934,0.9,0.994,0.986,0.773,1.015,0.882,0.766,1.04,0.825,0.804,0.986,1.047,1.047,0.962,1.056,1.008,0.825,0.848,0.931
433 | RACS770102,0.941,0.866,1.071,1.1,0.723,1.055,0.911,0.742,1.232,0.798,0.781,1.038,1.093,1.15,1.112,1.082,1.043,0.817,0.867,1.05
434 | RACS770103,1.16,0.5,2.66,2.4,0.43,1.63,0.86,0.57,3.9,0.51,0.4,1.97,2.04,3.87,1.72,1.61,1.48,0.59,0.75,1.72
435 | RACS820101,0.85,0.9,1.5,1.79,0.85,1.54,1.59,0.67,0.88,1.03,1.17,0.88,1.47,1.71,2.02,1.5,1.96,0.89,0.83,1.34
436 | RACS820102,1.58,1.04,0.98,1.49,1,0.66,0.99,1.09,1.27,1.21,1.41,0.77,1.46,1.24,1.14,1.05,0.87,0.88,1.23,0.68
437 | RACS820103,0.82,0,2.64,2.62,0,1.63,0,2.32,2.86,0,0,2.07,0,0,2.6,1.23,2.48,1.62,0,1.9
438 | RACS820104,0.78,3.14,1.25,0.94,1.07,1.13,1.03,1.26,0.85,0.91,0.41,1.32,1.73,0.93,1.75,1.31,1.57,1.11,0.98,1.31
439 | RACS820105,0.88,1.14,1.16,1.01,1.52,0.7,1.87,1.61,0.83,1.09,1.71,1.02,0.87,0.93,0.99,1.14,0.96,1.56,1.96,1.68
440 | RACS820106,0.3,0.72,1.26,1.33,1.2,3.09,1.33,0.45,0.71,0.96,1.89,2.73,0.83,0.97,0.9,1.16,0.97,0.64,1.58,0.86
441 | RACS820107,0.4,2.98,1.59,1.26,1.27,1.89,2.71,1.31,0.87,0.57,0,1.24,0.38,0.5,1.2,0.92,1.38,0.95,1.53,1.79
442 | RACS820108,1.48,0.86,1.19,1.43,1.3,0.46,1.27,1.12,1.36,1.33,1.41,0.99,0.25,1.42,1.02,0.89,0.81,0.93,1.27,0.91
443 | RACS820109,0,0,2.15,0,2.11,6.49,0,0,0,0,0,4.14,1.99,0,0,0,1.24,0,0,1.9
444 | RACS820110,1.02,1.05,1.76,0.83,0.41,2.39,0.4,0.83,0.94,1.06,1.33,1.31,2.73,1.05,1,1.18,0.77,0.88,1.22,1.09
445 | RACS820111,0.93,1.08,0.6,0.73,1.51,0.78,1.08,1.74,1,1.03,1.31,0.92,1.37,0.94,1.52,0.97,1.38,1.7,1.12,1.65
446 | RACS820112,0.99,2.32,1.18,1.36,1.25,1.4,1.06,0.81,0.91,1.26,1,1.15,0,1.52,1.19,1.5,1.18,1.01,1.33,1.09
447 | RACS820113,17.05,28.84,19.27,20.12,16.26,38.14,23.07,16.66,16.46,10.89,20.61,34.81,23.94,15.42,21.25,19.95,18.92,17.06,23.36,26.49
448 | RACS820114,14.53,30.57,19.78,18.19,19.61,37.16,22.63,20.28,14.07,14.3,20.61,13.59,52.63,22.18,17.82,18.56,21.09,21.87,19.78,26.36
449 | RADA880101,1.81,1.28,-8.72,-6.81,2.98,0.94,-4.66,4.92,-5.55,4.92,2.35,-6.64,0,-5.54,-14.92,-3.4,-2.57,4.04,2.33,-0.14
450 | RADA880102,0.52,0,0,-0.79,2.09,0,0.95,2.04,0.08,1.76,1.32,-0.01,0,-0.07,-1.32,0.04,0.27,1.18,2.51,1.63
451 | RADA880103,0.13,-2.52,-2.23,-3.43,-3.74,1.45,-5.61,-2.77,-3.97,-2.64,-3.83,-3.04,0,-3.84,-5,-1.66,-2.31,-2.05,-8.21,-5.97
452 | RADA880104,1.29,0,0,-6.02,0.89,0.94,-5.61,2.88,-5.63,3.16,1.03,-6.63,0,-5.47,-13.6,-3.44,-2.84,2.86,-0.18,-1.77
453 | RADA880105,1.42,0,0,-9.45,-2.85,2.39,-11.22,0.11,-9.6,0.52,-2.8,-9.67,0,-9.31,-18.6,-5.1,-5.15,0.81,-8.39,-7.74
454 | RADA880106,93.7,135.2,142.6,182.9,228.6,52.6,188.1,182.2,215.2,173.7,197.6,146.3,0,177.7,250.4,109.5,142.1,157.2,271.6,239.9
455 | RADA880107,-0.29,0,-1.02,-0.9,0,-0.34,-0.94,0.24,-2.05,-0.12,-0.24,-1.18,0,-1.53,-2.71,-0.75,-0.71,0.09,-0.59,-1.02
456 | RADA880108,-0.06,1.36,-0.8,-0.77,1.27,-0.41,0.49,1.31,-1.18,1.21,1.27,-0.48,0,-0.73,-0.84,-0.5,-0.27,1.09,0.88,0.33
457 | RICJ880101,0.7,0.6,1.4,1,1.2,1.6,1.2,0.9,1,0.9,0.3,1.2,0.7,1,0.4,1.6,0.3,0.7,1.1,1.9
458 | RICJ880102,0.7,0.6,1.4,1,1.2,1.6,1.2,0.9,1,0.9,0.3,1.2,0.7,1,0.4,1.6,0.3,0.7,1.1,1.9
459 | RICJ880103,0.5,0.6,2.1,0.4,0.2,1.8,1.1,0.2,0.7,0.2,0.8,3.5,0.8,0.4,0.4,2.3,1.6,0.1,0.3,0.8
460 | RICJ880104,1.2,0.8,0.8,2.2,0.5,0.3,0.7,0.9,0.6,0.9,0.3,0.7,2.6,0.7,0.7,0.7,0.8,1.1,2.1,1.8
461 | RICJ880105,1.6,1.2,2.6,2,0.9,0.9,0.7,0.7,1,0.3,1,0.7,0.5,0.8,0.9,0.8,0.7,0.6,1.7,0.4
462 | RICJ880106,1,0.6,2.2,3.3,0.6,0.6,0.7,0.4,0.8,0.6,1,0.7,0.4,1.5,0.4,0.4,1,1.1,1.4,1.2
463 | RICJ880107,1.1,1.1,0.3,0.5,1.9,0.4,1.5,1.1,0.8,2.6,1.7,0,0.1,1.3,1.5,0.4,0.5,1.5,3.1,0.6
464 | RICJ880108,1.4,1.6,0.6,0.9,1,0.6,0.9,0.9,1.9,1.1,1.7,1.2,0.3,1.4,1.2,1.1,0.6,0.8,1.4,0.2
465 | RICJ880109,1.8,0.7,1,0.8,1.3,0.5,1,1.2,1.1,1.2,1.5,0.9,0.3,1.3,1.3,0.6,1,1.2,1.5,0.8
466 | RICJ880110,1.8,0,0.7,1.1,1.9,0.5,2.4,1.3,1.4,1.2,2.7,0.6,0.3,1,1,0.5,0.5,0.4,1.1,1.3
467 | RICJ880111,1.3,0.7,0.5,0.7,2.9,0.5,1.9,1.6,1,1.4,2.8,0.6,0,0.2,0.8,0.5,0.6,1.4,2.1,0.8
468 | RICJ880112,0.7,0.2,0.6,1.6,1.8,0.1,1.1,1.4,2.2,1.9,1,0.8,0,1.3,0.8,0.6,0.7,1.3,0.4,1.1
469 | RICJ880113,1.4,1.2,0.7,1.7,0.3,0.2,1.8,0.4,1.9,0.8,1.3,0.9,0.2,1.6,2.1,1.6,0.9,0.7,0.4,0.3
470 | RICJ880114,1.1,1.6,0.4,0.8,0.7,0.2,3.4,0.7,2,0.7,1,1.2,0,2.1,1,1.7,1,0.7,0,1.2
471 | RICJ880115,0.8,0.4,0.7,0.3,0.5,3.9,1.3,0.7,1.3,0.7,0.8,1.6,0.7,0.9,0.9,0.8,0.3,0.2,0,0.8
472 | RICJ880116,1,0.8,1.4,0.8,0.1,1.2,1.2,1.1,1.2,0.9,0.8,0.9,1.9,1.4,1.4,0.7,0.8,0.6,0.4,0.9
473 | RICJ880117,0.7,0.4,1.4,0.7,1.2,0.6,1,0.7,1.3,0.5,0,1.5,1.5,1.1,1.1,0.9,2.1,1,2.7,0.5
474 | ROBB760101,6.5,-1.3,0.5,7.8,1.6,-8.6,1.2,0.6,2.3,3.2,5.3,-5.1,-7.7,1,-0.9,-3.9,-2.6,1.4,1.2,-4.5
475 | ROBB760102,2.3,0.8,7.4,10.3,-1.1,-5.2,-2.8,-4,-4.1,-2.1,-3.5,0.3,8.1,-0.7,-5.2,-3.5,2.3,-4.4,-0.9,-3.7
476 | ROBB760103,6.7,-4.9,-3.1,2.2,2.8,-6.8,-1,3.2,0.5,5.5,7.2,-6.1,-22.8,0.6,0.3,-3,-4,2.5,4,-4.6
477 | ROBB760104,2.3,6.1,-4.4,2.5,1.6,-8.3,5.9,-0.5,7.3,0.1,3.5,-3.3,-24.4,2.7,1.4,-1.9,-3.7,2.3,-0.9,-0.6
478 | ROBB760105,-2.3,4.4,-4.4,-5,2.6,-4.2,-2.5,6.7,-3.3,2.3,2.3,-4.1,-1.8,1.2,0.4,-1.7,1.3,6.8,-1,4
479 | ROBB760106,-2.7,3.7,-4.4,-8.1,3,-3.9,-3,7.7,-2.9,3.7,3.7,-4.2,-6.6,0.8,0.4,-2.4,1.7,7.1,0.3,3.3
480 | ROBB760107,0,5.4,-2.6,3.1,0.7,-3.4,0.8,-0.1,-3.1,-3.7,-2.1,-2,7.4,2.4,1.1,1.3,0,2.7,-3.4,4.8
481 | ROBB760108,-5,4.4,3.1,-4.7,-1.8,5.7,-0.3,-4.6,1,-5.6,-4.8,4.2,2.6,0.4,2.1,2.6,0.3,-6,3.4,2.9
482 | ROBB760109,-3.3,-0.3,3.9,-1.8,0.8,-1.2,3,-0.5,-1.2,-2.3,-4.3,5.4,6.5,-0.4,0,1.8,-0.7,-3.5,-0.8,3.1
483 | ROBB760110,-4.7,6.2,1.9,-4.2,-3.7,5.7,-2.6,-7,2.8,-6.2,-4.8,3.9,3.6,-2,2,2.1,0.6,-6.2,3.3,3.8
484 | ROBB760111,-3.7,4,-0.6,-4.3,1.6,5.9,-0.8,-0.5,1.3,-2.8,-1.6,-0.6,-6,3.4,1,1.5,1.2,-4.6,6.5,1.3
485 | ROBB760112,-2.5,-4.7,0,-4.4,-4.1,4.9,1.6,-3.3,-0.8,-2,-4.1,4.6,5.8,-0.5,-1.2,2.5,1.7,-3.5,1.2,-0.6
486 | ROBB760113,-5.1,3.8,3.1,-5.2,-2.4,5.6,-0.9,-4.5,1,-5.4,-5.3,4.7,3.5,0.2,2.6,3.2,0,-6.3,2.9,3.2
487 | ROBB790101,-1,2.1,-1.2,-0.7,2.8,0.3,1.1,4,-0.9,2,1.8,-0.7,0.4,-0.1,0.3,-1.2,-0.5,1.4,3,2.1
488 | ROSG850101,86.6,132.3,97.8,113.9,194.1,62.9,155.8,158,115.5,164.1,172.9,103.3,92.9,119.2,162.2,85.6,106.5,141,224.6,177.7
489 | ROSG850102,0.74,0.91,0.62,0.62,0.88,0.72,0.78,0.88,0.52,0.85,0.85,0.63,0.64,0.62,0.64,0.66,0.7,0.86,0.85,0.76
490 | ROSM880101,-0.67,-0.34,8.72,7.35,-3.24,0,3.82,-3.02,6.13,-3.02,-1.3,7.23,-1.75,6.39,12.1,4.35,3.86,-2.18,-2.86,0.98
491 | ROSM880102,-0.67,-2,1.57,1.78,-3.24,0,1.09,-3.02,2.46,-3.02,-1.67,2.27,-1.75,2.12,3.89,0.1,-0.42,-2.18,-2.86,0.98
492 | ROSM880103,0.4,0.5,0.8,1.3,0.7,0,1,0.4,0.4,0.6,0.3,0.9,0.9,0.7,0.3,0.4,0.4,0.4,0.6,1.2
493 | SIMZ760101,0.73,0.7,0.54,0.55,2.65,0,1.1,2.97,1.5,2.49,1.3,-0.01,2.6,-0.1,0.73,0.04,0.44,1.69,3,2.97
494 | SNEP660101,0.239,0.22,0.171,0.187,0.234,0.16,0.205,0.273,0.228,0.281,0.253,0.249,0.165,0.26,0.211,0.236,0.213,0.255,0.183,0.193
495 | SNEP660102,0.33,0.074,-0.371,-0.409,-0.011,0.37,-0.078,0.149,-0.075,0.129,-0.092,-0.233,0.37,-0.254,-0.176,0.022,0.136,0.245,-0.011,-0.138
496 | SNEP660103,-0.11,-0.184,-0.285,-0.246,0.438,-0.073,0.32,0.001,0.049,-0.008,-0.041,-0.136,-0.016,-0.067,0.079,-0.153,-0.208,-0.155,0.493,0.381
497 | SNEP660104,-0.062,0.38,-0.079,-0.184,0.074,-0.017,0.056,-0.309,-0.371,-0.264,0.077,0.166,-0.036,-0.025,-0.167,0.47,0.348,-0.212,0.05,0.22
498 | SUEM840101,1.071,0.922,0.68,0.97,1.086,0.591,0.85,1.14,0.939,1.14,1.2,0.784,0.659,0.977,1.033,0.76,0.817,0.95,1.107,1.02
499 | SUEM840102,8,26,70,6,18,0.1,0.1,55,1,33,54,0.1,42,33,0.1,0.1,0.1,0.1,77,66
500 | SUYM030101,-0.058,0.447,0.016,-0.128,0.24,0.331,0.195,0.06,-0.112,0.138,0.275,0.027,-0.478,-0.073,0,-0.177,-0.163,-0.052,0.564,0.322
501 | SWER830101,-0.4,0.17,-1.31,-1.22,1.92,-0.67,-0.64,1.25,-0.67,1.22,1.02,-0.92,-0.49,-0.91,-0.59,-0.55,-0.28,0.91,0.5,1.67
502 | TAKK010101,9.8,3,4.9,4.4,23,0,11.9,17.2,10.5,17,11.9,3.6,15,2.4,7.3,2.6,6.9,15.3,24.2,17.2
503 | TANS770101,1.42,0.73,1.01,1.63,1.16,0.5,1.2,1.12,1.24,1.29,1.21,0.71,0.65,1.02,1.06,0.71,0.78,0.99,1.05,0.67
504 | TANS770102,0.946,0.481,1.311,0.698,0.963,0.36,2.168,1.283,1.203,1.192,0,0.432,2.093,1.615,1.128,0.523,1.961,0.409,1.925,0.802
505 | TANS770103,0.79,1.268,0.53,0.643,1.052,0.725,0.864,1.361,0.735,1.111,1.092,0.832,1.249,1.038,1.087,1.093,1.214,1.428,1.114,1.34
506 | TANS770104,1.194,0.678,1.056,0.928,0.377,1.015,0.611,0.603,1.06,0.595,0.831,0.659,3.159,1.29,0.795,1.444,1.172,0.64,0.452,0.816
507 | TANS770105,0.497,1.348,1.498,0.651,1.348,1.848,1.474,0.471,0.932,0.656,0.425,2.072,0.179,0.711,0.677,1.151,0.749,0.654,1.283,1.283
508 | TANS770106,0.937,1.004,1.64,0.679,0.803,0.901,1.085,0.178,1.254,0.808,0.886,1.08,0.748,1.078,1.725,1.145,1.487,0.625,0.803,1.227
509 | TANS770107,0.289,1.767,0.917,0.285,0.393,4.259,1.061,0.262,1.288,0,0,3.169,0,2.372,1.38,0.16,0.218,0.167,0,0.654
510 | TANS770108,0.328,0,3.379,0,1.336,0.5,1.204,2.078,0.835,0.414,0.982,1.498,0.415,0,2.088,1.089,1.732,0.946,1.781,0
511 | TANS770109,0.945,0.932,1.315,1.014,0.622,2.355,0.525,0.673,0.947,0.758,1.028,1.202,0.579,0.704,0.364,1.14,0.863,0.561,0.777,0.907
512 | TANS770110,0.842,1.032,1.366,0.758,0.881,1.349,1.079,0.459,1.045,0.665,0.668,1.352,1.385,0.998,0.936,1.257,1.055,0.643,0.881,1.101
513 | TSAJ990101,89.3,102.5,114.4,138.8,190.8,63.8,157.5,163,165.1,163.1,165.8,122.4,121.6,146.9,190.3,94.2,119.6,138.2,226.4,194.6
514 | TSAJ990102,90,103.3,117.3,142.2,191.9,64.9,160,163.9,167.3,164,167,124.7,122.9,149.4,194,95.4,121.5,139,228.2,197
515 | VASM830101,0.135,0.159,0.289,0.184,0.087,0.051,0.223,0.173,0.17,0.215,0.239,0.196,0.151,0.236,0.296,0.01,0.1,0.285,0.166,0.066
516 | VASM830102,0.507,0.592,0.223,0.445,0.077,0.39,0.31,0.111,0.559,0.619,0.431,0.287,0.739,0.383,0.459,0.689,0.785,0.356,0.16,0.06
517 | VASM830103,0.159,0.187,0.283,0.206,0.682,0.049,0.233,0.581,0.159,0.083,0.198,0.385,0.366,0.236,0.194,0.15,0.074,0.301,0.463,0.737
518 | VELV850101,0.03731,0.08292,0.1263,0.0058,0.0946,0.00499,0.02415,0,0.0371,0,0.08226,0.00359,0.01979,0.07606,0.09593,0.08292,0.09408,0.00569,0.05481,0.05159
519 | VENT840101,0,0,0,0,1,0,0,1,0,1,0,0,0,0,0,0,0,1,1,1
520 | VHEG790101,-12.04,3.95,23.22,16.81,-21.98,-7.85,6.28,-18.32,9.71,-17.79,-8.86,4.25,5.82,2.16,39.23,-1.54,-4.15,-16.22,-16.19,-1.51
521 | VINM940101,0.984,0.906,1.068,1.094,0.915,1.031,0.95,0.927,1.102,0.935,0.952,1.048,1.049,1.037,1.008,1.046,0.997,0.931,0.904,0.929
522 | VINM940102,1.315,1.196,1.372,1.376,1.247,1.382,1.279,1.241,1.367,1.234,1.269,1.38,1.342,1.342,1.31,1.381,1.324,1.235,1.186,1.199
523 | VINM940103,0.994,0.939,1.022,1.052,0.934,1.018,0.967,0.977,1.029,0.982,0.963,1.022,1.05,1.041,1.026,1.025,0.998,0.968,0.938,0.981
524 | VINM940104,0.783,0.785,0.822,0.826,0.774,0.784,0.777,0.776,0.834,0.783,0.806,0.799,0.809,0.817,0.807,0.811,0.795,0.781,0.796,0.788
525 | WARP780101,10.04,8.89,5.76,5.37,7.98,7.99,7.49,8.72,4.4,8.79,9.15,5.63,7.79,5.41,6.18,7.08,7,8.88,8.07,6.9
526 | WEBA780101,0.89,0.85,0.87,0.84,0.52,0.92,0.83,0.76,0.97,0.73,0.74,0.89,0.82,0.82,0.88,0.96,0.92,0.85,0.2,0.49
527 | WERD780101,0.52,0.83,0.37,0.38,0.87,0.41,0.7,0.79,0.31,0.77,0.76,0.42,0.35,0.35,0.49,0.49,0.38,0.72,0.86,0.64
528 | WERD780102,0.16,-0.12,-0.24,-0.45,-0.25,-0.16,-0.18,-0.19,-0.12,-0.44,-0.79,1.03,-0.59,-0.55,-0.2,-0.01,0.05,-0.46,-0.33,-0.42
529 | WERD780103,0.15,-0.19,-0.22,0.14,1.18,0.36,-0.25,0.02,-0.16,0.06,0.11,0.69,0.11,-0.06,-0.37,0.13,0.28,-0.08,-0.12,0.19
530 | WERD780104,-0.07,0.17,-0.8,-0.63,0.4,0.27,-0.49,0.06,-0.45,-0.17,0.03,-0.57,-0.47,-0.26,-0.4,-0.11,0.09,-0.11,-0.61,-0.61
531 | WILM950101,0.06,0.49,-0.2,-0.1,4.8,0.21,-2.24,3.48,-1.62,3.5,0.21,0.25,0.71,0.31,-0.85,-0.62,0.65,1.59,2.29,1.89
532 | WILM950102,2.62,0.73,-2.84,-0.45,9.14,-1.15,-0.74,4.38,-2.78,6.57,-3.12,-1.27,-0.12,-1.69,1.26,-1.39,1.81,2.3,5.91,1.39
533 | WILM950103,-1.64,9.3,0.7,1.18,-1.36,-1.85,7.17,3.02,-2.36,0.83,4.26,0.83,3.12,-0.04,-3.28,1.59,2.31,0.52,2.61,2.37
534 | WILM950104,-2.34,5.03,-0.48,1.3,2.57,-1.06,-3,7.26,1.56,1.09,0.62,2.81,-0.15,0.16,1.6,1.93,0.19,2.06,3.59,-2.58
535 | WIMW960101,4.08,4.49,3.02,2.23,5.38,4.24,4.08,4.52,3.77,4.81,4.48,3.83,3.8,3.67,3.91,4.12,4.11,4.18,6.1,5.19
536 | WOEC730101,7,5.5,13,12.5,5,7.9,8.4,4.9,10.1,4.9,5.3,10,6.6,8.6,9.1,7.5,6.6,5.6,5.3,5.7
537 | WOLR790101,1.12,0.59,-0.83,-0.92,0.67,1.2,-0.93,1.16,-0.8,1.18,0.55,-0.83,0.54,-0.78,-2.55,-0.05,-0.02,1.13,-0.19,-0.23
538 | WOLR810101,1.94,-1.24,-10.95,-10.2,-0.76,2.39,-10.27,2.15,-9.52,2.28,-1.48,-9.68,-3.68,-9.38,-19.92,-5.06,-4.88,1.99,-5.88,-6.11
539 | WOLS870101,0.07,0.71,3.64,3.08,-4.92,2.23,2.41,-4.44,2.84,-4.19,-2.49,3.22,-1.22,2.18,2.88,1.96,0.92,-2.69,-4.75,-1.39
540 | WOLS870102,-1.73,-0.97,1.13,0.39,1.3,-5.36,1.74,-1.68,1.41,-1.03,-0.27,1.45,0.88,0.53,2.52,-1.63,-2.09,-2.53,3.65,2.32
541 | WOLS870103,0.09,4.13,2.36,-0.07,0.45,0.3,1.11,-1.03,-3.14,-0.98,-0.41,0.84,2.23,-1.14,-3.44,0.57,-1.4,-1.29,0.85,0.01
542 | YUTK870101,8.5,11,8.5,8.8,11.2,7.1,10.1,16.8,7.9,15,13.3,8.2,8.2,6.3,0,7.4,8.8,12,9.9,8.8
543 | YUTK870102,6.8,8.3,7,4.9,8.3,6.4,9.2,10,7.5,12.2,8.4,6.2,6.9,8.5,0,8,7,9.4,5.7,6.8
544 | YUTK870103,18.08,18.17,17.36,18.16,17.3,18.24,18.49,18.62,17.96,18.6,18.11,17.47,18.16,17.93,0,17.57,17.54,18.3,17.19,17.99
545 | YUTK870104,18.56,17.84,17.94,17.97,17.95,18.57,18.64,19.21,18.36,19.01,18.49,18.24,18.77,18.51,0,18.06,17.71,18.98,16.87,18.23
546 | ZASB820101,-0.152,0,-0.355,-0.411,0.001,-0.19,0,-0.086,-0.062,-0.102,-0.107,-0.203,-0.181,-0.181,-0.089,-0.203,-0.17,-0.125,0.275,0
547 | ZHOH040101,2.18,3.89,1.75,1.89,5.88,1.17,2.51,4.5,2.12,4.71,3.63,1.85,2.09,2.16,2.71,1.66,2.18,3.77,6.46,5.01
548 | ZHOH040102,1.79,2.22,2.33,2.52,4.84,0.7,3.06,4.59,2.5,4.72,3.91,2.83,2.45,2.37,3.2,1.82,2.45,3.67,5.64,4.46
549 | ZHOH040103,13.4,22.6,8.2,7.3,23.9,7,11.3,20.3,6.1,20.8,15.7,7.6,9.9,8.5,8.5,8.2,10.3,19.5,24.5,19.5
550 | ZIMJ680101,0.83,1.48,0.64,0.65,2.75,0.1,1.1,3.07,1.6,2.52,1.4,0.09,2.7,0,0.83,0.14,0.54,1.79,0.31,2.97
551 | ZIMJ680102,11.5,13.46,11.68,13.57,19.8,3.4,13.69,21.4,15.71,21.4,16.25,12.82,17.43,14.45,14.28,9.47,15.77,21.57,21.67,18.03
552 | ZIMJ680103,0,1.48,49.7,49.9,0.35,0,51.6,0.13,49.5,0.13,1.43,3.38,1.58,3.53,52,1.67,1.66,0.13,2.1,1.61
553 | ZIMJ680104,6,5.05,2.77,3.22,5.48,5.97,7.59,6.02,9.74,5.98,5.74,5.41,6.3,5.65,10.76,5.68,5.66,5.96,5.89,5.66
554 | ZIMJ680105,9.9,2.8,2.8,3.2,18.8,5.6,8.2,17.1,3.5,17.6,14.9,5.4,14.8,9,4.6,6.9,9.5,14.3,17.1,15
555 |
--------------------------------------------------------------------------------
/Standalone/Data/aaindices.csv:
--------------------------------------------------------------------------------
1 | ANDN920101,ARGP820101,ARGP820102,ARGP820103,AURR980101,AURR980102,AURR980103,AURR980104,AURR980105,AURR980106,AURR980107,AURR980108,AURR980109,AURR980110,AURR980111,AURR980112,AURR980113,AURR980114,AURR980115,AURR980116,AURR980117,AURR980118,AURR980119,AURR980120,BAEK050101,BASU050101,BASU050102,BASU050103,BEGF750101,BEGF750102,BEGF750103,BHAR880101,BIGC670101,BIOV880101,BIOV880102,BLAM930101,BLAS910101,BROC820101,BROC820102,BULH740101,BULH740102,BUNA790101,BUNA790102,BUNA790103,BURA740101,BURA740102,CASG920101,CEDJ970101,CEDJ970102,CEDJ970103,CEDJ970104,CEDJ970105,CHAM810101,CHAM820101,CHAM820102,CHAM830101,CHAM830102,CHAM830103,CHAM830104,CHAM830105,CHAM830106,CHAM830107,CHAM830108,CHOC750101,CHOC760101,CHOC760102,CHOC760103,CHOC760104,CHOP780101,CHOP780201,CHOP780202,CHOP780203,CHOP780204,CHOP780205,CHOP780206,CHOP780207,CHOP780208,CHOP780209,CHOP780210,CHOP780211,CHOP780212,CHOP780213,CHOP780214,CHOP780215,CHOP780216,CIDH920101,CIDH920102,CIDH920103,CIDH920104,CIDH920105,COHE430101,CORJ870101,CORJ870102,CORJ870103,CORJ870104,CORJ870105,CORJ870106,CORJ870107,CORJ870108,COSI940101,COWR900101,CRAJ730101,CRAJ730102,CRAJ730103,DAWD720101,DAYM780101,DAYM780201,DESM900101,DESM900102,DIGM050101,EISD840101,EISD860101,EISD860102,EISD860103,ENGD860101,FASG760101,FASG760102,FASG760103,FASG760104,FASG760105,FASG890101,FAUJ830101,FAUJ880101,FAUJ880102,FAUJ880103,FAUJ880104,FAUJ880105,FAUJ880106,FAUJ880107,FAUJ880108,FAUJ880109,FAUJ880110,FAUJ880111,FAUJ880112,FAUJ880113,FINA770101,FINA910101,FINA910102,FINA910103,FINA910104,FODM020101,FUKS010101,FUKS010102,FUKS010103,FUKS010104,FUKS010105,FUKS010106,FUKS010107,FUKS010108,FUKS010109,FUKS010110,FUKS010111,FUKS010112,GARJ730101,GEIM800101,GEIM800102,GEIM800103,GEIM800104,GEIM800105,GEIM800106,GEIM800107,GEIM800108,GEIM800109,GEIM800110,GEIM800111,GEOR030101,GEOR030102,GEOR030103,GEOR030104,GEOR030105,GEOR030106,GEOR030107,GEOR030108,GEOR030109,GOLD730101,GOLD730102,GRAR740101,GRAR740102,GRAR740103,GUOD860101,GUYH850101,GUYH850102,GUYH850104,GUYH850105,HARY940101,HOPA770101,HOPT810101,HUTJ700101,HUTJ700102,HUTJ700103,ISOY800101,ISOY800102,ISOY800103,ISOY800104,ISOY800105,ISOY800106,ISOY800107,ISOY800108,JACR890101,JANJ780101,JANJ780102,JANJ780103,JANJ790101,JANJ790102,JOND750101,JOND750102,JOND920101,JOND920102,JUKT750101,JUNJ780101,JURD980101,KANM800101,KANM800102,KANM800103,KANM800104,KARP850101,KARP850102,KARP850103,KARS160101,KARS160102,KARS160103,KARS160104,KARS160105,KARS160106,KARS160107,KARS160108,KARS160109,KARS160110,KARS160111,KARS160112,KARS160113,KARS160114,KARS160115,KARS160116,KARS160117,KARS160118,KARS160119,KARS160120,KARS160121,KARS160122,KHAG800101,KIDA850101,KIMC930101,KLEP840101,KOEP990101,KOEP990102,KRIW710101,KRIW790101,KRIW790102,KRIW790103,KUHL950101,KUMS000101,KUMS000102,KUMS000103,KUMS000104,KYTJ820101,LAWE840101,LEVM760101,LEVM760102,LEVM760103,LEVM760104,LEVM760105,LEVM760106,LEVM760107,LEVM780101,LEVM780102,LEVM780103,LEVM780104,LEVM780105,LEVM780106,LEWP710101,LIFS790101,LIFS790102,LIFS790103,MANP780101,MAXF760101,MAXF760102,MAXF760103,MAXF760104,MAXF760105,MAXF760106,MCMT640101,MEEJ800101,MEEJ800102,MEEJ810101,MEEJ810102,MEIH800101,MEIH800102,MEIH800103,MITS020101,MIYS850101,MIYS990101,MIYS990102,MIYS990103,MIYS990104,MIYS990105,MONM990101,MONM990201,MUNV940101,MUNV940102,MUNV940103,MUNV940104,MUNV940105,NADH010101,NADH010102,NADH010103,NADH010104,NADH010105,NADH010106,NADH010107,NAGK730101,NAGK730102,NAGK730103,NAKH900101,NAKH900102,NAKH900103,NAKH900104,NAKH900105,NAKH900106,NAKH900107,NAKH900108,NAKH900109,NAKH900110,NAKH900111,NAKH900112,NAKH900113,NAKH920101,NAKH920102,NAKH920103,NAKH920104,NAKH920105,NAKH920106,NAKH920107,NAKH920108,NISK800101,NISK860101,NOZY710101,OLSK800101,ONEK900101,ONEK900102,OOBM770101,OOBM770102,OOBM770103,OOBM770104,OOBM770105,OOBM850101,OOBM850102,OOBM850103,OOBM850104,OOBM850105,PALJ810101,PALJ810102,PALJ810103,PALJ810104,PALJ810105,PALJ810106,PALJ810107,PALJ810108,PALJ810109,PALJ810110,PALJ810111,PALJ810112,PALJ810113,PALJ810114,PALJ810115,PALJ810116,PARJ860101,PARS000101,PARS000102,PLIV810101,PONJ960101,PONP800101,PONP800102,PONP800103,PONP800104,PONP800105,PONP800106,PONP800107,PONP800108,PONP930101,PRAM820101,PRAM820102,PRAM820103,PRAM900101,PRAM900102,PRAM900103,PRAM900104,PTIO830101,PTIO830102,PUNT030101,PUNT030102,QIAN880101,QIAN880102,QIAN880103,QIAN880104,QIAN880105,QIAN880106,QIAN880107,QIAN880108,QIAN880109,QIAN880110,QIAN880111,QIAN880112,QIAN880113,QIAN880114,QIAN880115,QIAN880116,QIAN880117,QIAN880118,QIAN880119,QIAN880120,QIAN880121,QIAN880122,QIAN880123,QIAN880124,QIAN880125,QIAN880126,QIAN880127,QIAN880128,QIAN880129,QIAN880130,QIAN880131,QIAN880132,QIAN880133,QIAN880134,QIAN880135,QIAN880136,QIAN880137,QIAN880138,QIAN880139,RACS770101,RACS770102,RACS770103,RACS820101,RACS820102,RACS820103,RACS820104,RACS820105,RACS820106,RACS820107,RACS820108,RACS820109,RACS820110,RACS820111,RACS820112,RACS820113,RACS820114,RADA880101,RADA880102,RADA880103,RADA880104,RADA880105,RADA880106,RADA880107,RADA880108,RICJ880101,RICJ880102,RICJ880103,RICJ880104,RICJ880105,RICJ880106,RICJ880107,RICJ880108,RICJ880109,RICJ880110,RICJ880111,RICJ880112,RICJ880113,RICJ880114,RICJ880115,RICJ880116,RICJ880117,ROBB760101,ROBB760102,ROBB760103,ROBB760104,ROBB760105,ROBB760106,ROBB760107,ROBB760108,ROBB760109,ROBB760110,ROBB760111,ROBB760112,ROBB760113,ROBB790101,ROSG850101,ROSG850102,ROSM880101,ROSM880102,ROSM880103,SIMZ760101,SNEP660101,SNEP660102,SNEP660103,SNEP660104,SUEM840101,SUEM840102,SUYM030101,SWER830101,TAKK010101,TANS770101,TANS770102,TANS770103,TANS770104,TANS770105,TANS770106,TANS770107,TANS770108,TANS770109,TANS770110,TSAJ990101,TSAJ990102,VASM830101,VASM830102,VASM830103,VELV850101,VENT840101,VHEG790101,VINM940101,VINM940102,VINM940103,VINM940104,WARP780101,WEBA780101,WERD780101,WERD780102,WERD780103,WERD780104,WILM950101,WILM950102,WILM950103,WILM950104,WIMW960101,WOEC730101,WOLR790101,WOLR810101,WOLS870101,WOLS870102,WOLS870103,YUTK870101,YUTK870102,YUTK870103,YUTK870104,ZASB820101,ZHOH040101,ZHOH040102,ZHOH040103,ZIMJ680101,ZIMJ680102,ZIMJ680103,ZIMJ680104,ZIMJ680105
--------------------------------------------------------------------------------
/Standalone/Data/atom.csv:
--------------------------------------------------------------------------------
1 | A,CHHHCHNHHCOOH
2 | R,HNCNHHNHCHHCHHCHHCHNHHCOOH
3 | N,HHNCOCHHCHNHHCOOH
4 | D,HOOCCHHCHNHHCOOH
5 | C,HSCHHCHNHHCOOH
6 | Q,HHNCOCHHCHHCHNHHCOOH
7 | E,HOOCCHHCHHCHNHHCOOH
8 | G,NHHCHHCOOH
9 | H,NHCHNCHCCHHCHNHHCOOH
10 | I,CHHHCHHCHCHHHCHNHHCOOH
11 | L,CHHHCHHHCHCHHCHNHHCOOH
12 | K,HHNCHHCHHCHHCHHCHNHHCOOH
13 | M,CHHHSCHHCHHCHNHHCOOH
14 | F,CCCCCCHHHHHCHHCHNHHCOOH
15 | P,NHCHHCHHCHHCHCOOH
16 | S,HOCHHCHNHHCOOH
17 | T,CHHHCHOHCHNHHCOOH
18 | W,CCCCCCHHHHHNHCHCCHHCHNHHCOOH
19 | Y,HOCCCCCCHHHHHCHHCHNHHCOOH
20 | V,CHHHCHHHCHCHNHHCOOH
21 |
--------------------------------------------------------------------------------
/Standalone/Data/bonds.csv:
--------------------------------------------------------------------------------
1 | Name,nBonds_tot,Hydrogen_bonds,nBondsS,nBondsD
2 | G,9,5,8,1
3 | S,13,7,12,1
4 | A,12,7,11,1
5 | D,15,7,13,2
6 | N,16,8,14,2
7 | T,16,9,15,1
8 | P,17,9,16,1
9 | E,18,9,16,2
10 | V,18,11,17,1
11 | Q,19,10,17,2
12 | M,19,11,18,1
13 | H,20,9,17,3
14 | I,21,13,20,1
15 | Y,24,11,20,4
16 | L,21,13,20,1
17 | K,23,14,22,1
18 | W,28,12,23,5
19 | F,23,11,19,4
20 | C,25,12,23,2
21 | R,25,14,23,2
22 |
--------------------------------------------------------------------------------
/Standalone/Data/can_pat.csv:
--------------------------------------------------------------------------------
1 | Name,canonical_pattern
2 | G,--=--
3 | S,---=---
4 | A,---=--
5 | D,---=----=-
6 | N,---=----=-
7 | T,----=---
8 | P,c--=-
9 | E,---=----=--
10 | V,-----=--
11 | Q,---=----=--
12 | M,------=--
13 | H,c----=--
14 | I,------=--
15 | Y,b----=---
16 | L,------=--
17 | K,------=--
18 | W,c----=--
19 | F,b----=--
20 | C,---=--------=--
21 | R,---=---=--
22 |
--------------------------------------------------------------------------------
/Standalone/Data/data:
--------------------------------------------------------------------------------
1 | # A C D E F G H I K L M N P Q R S T V W Y
2 | Hydrophobicity 0.62 0.29 -0.9 -0.74 1.19 0.48 -0.4 1.38 -1.5 1.06 0.64 -0.78 0.12 -0.85 -2.53 -0.18 -0.05 1.08 0.81 0.26
3 | Hydrophilicity -0.5 -1 3 3 -2.5 0 -0.5 -1.8 3 -1.8 -1.3 0.2 0 0.2 3 0.3 -0.4 -1.5 -3.4 -2.3
4 | SideChainMass 15 47 59 73 91 1 82 57 73 57 75 58 42 72 101 31 45 43 130 107
5 |
--------------------------------------------------------------------------------
/Standalone/LICENSE:
--------------------------------------------------------------------------------
1 | GNU GENERAL PUBLIC LICENSE
2 | Version 3, 29 June 2007
3 |
4 | Copyright (C) 2007 Free Software Foundation, Inc.
5 | Everyone is permitted to copy and distribute verbatim copies
6 | of this license document, but changing it is not allowed.
7 |
8 | Preamble
9 |
10 | The GNU General Public License is a free, copyleft license for
11 | software and other kinds of works.
12 |
13 | The licenses for most software and other practical works are designed
14 | to take away your freedom to share and change the works. By contrast,
15 | the GNU General Public License is intended to guarantee your freedom to
16 | share and change all versions of a program--to make sure it remains free
17 | software for all its users. We, the Free Software Foundation, use the
18 | GNU General Public License for most of our software; it applies also to
19 | any other work released this way by its authors. You can apply it to
20 | your programs, too.
21 |
22 | When we speak of free software, we are referring to freedom, not
23 | price. Our General Public Licenses are designed to make sure that you
24 | have the freedom to distribute copies of free software (and charge for
25 | them if you wish), that you receive source code or can get it if you
26 | want it, that you can change the software or use pieces of it in new
27 | free programs, and that you know you can do these things.
28 |
29 | To protect your rights, we need to prevent others from denying you
30 | these rights or asking you to surrender the rights. Therefore, you have
31 | certain responsibilities if you distribute copies of the software, or if
32 | you modify it: responsibilities to respect the freedom of others.
33 |
34 | For example, if you distribute copies of such a program, whether
35 | gratis or for a fee, you must pass on to the recipients the same
36 | freedoms that you received. You must make sure that they, too, receive
37 | or can get the source code. And you must show them these terms so they
38 | know their rights.
39 |
40 | Developers that use the GNU GPL protect your rights with two steps:
41 | (1) assert copyright on the software, and (2) offer you this License
42 | giving you legal permission to copy, distribute and/or modify it.
43 |
44 | For the developers' and authors' protection, the GPL clearly explains
45 | that there is no warranty for this free software. For both users' and
46 | authors' sake, the GPL requires that modified versions be marked as
47 | changed, so that their problems will not be attributed erroneously to
48 | authors of previous versions.
49 |
50 | Some devices are designed to deny users access to install or run
51 | modified versions of the software inside them, although the manufacturer
52 | can do so. This is fundamentally incompatible with the aim of
53 | protecting users' freedom to change the software. The systematic
54 | pattern of such abuse occurs in the area of products for individuals to
55 | use, which is precisely where it is most unacceptable. Therefore, we
56 | have designed this version of the GPL to prohibit the practice for those
57 | products. If such problems arise substantially in other domains, we
58 | stand ready to extend this provision to those domains in future versions
59 | of the GPL, as needed to protect the freedom of users.
60 |
61 | Finally, every program is threatened constantly by software patents.
62 | States should not allow patents to restrict development and use of
63 | software on general-purpose computers, but in those that do, we wish to
64 | avoid the special danger that patents applied to a free program could
65 | make it effectively proprietary. To prevent this, the GPL assures that
66 | patents cannot be used to render the program non-free.
67 |
68 | The precise terms and conditions for copying, distribution and
69 | modification follow.
70 |
71 | TERMS AND CONDITIONS
72 |
73 | 0. Definitions.
74 |
75 | "This License" refers to version 3 of the GNU General Public License.
76 |
77 | "Copyright" also means copyright-like laws that apply to other kinds of
78 | works, such as semiconductor masks.
79 |
80 | "The Program" refers to any copyrightable work licensed under this
81 | License. Each licensee is addressed as "you". "Licensees" and
82 | "recipients" may be individuals or organizations.
83 |
84 | To "modify" a work means to copy from or adapt all or part of the work
85 | in a fashion requiring copyright permission, other than the making of an
86 | exact copy. The resulting work is called a "modified version" of the
87 | earlier work or a work "based on" the earlier work.
88 |
89 | A "covered work" means either the unmodified Program or a work based
90 | on the Program.
91 |
92 | To "propagate" a work means to do anything with it that, without
93 | permission, would make you directly or secondarily liable for
94 | infringement under applicable copyright law, except executing it on a
95 | computer or modifying a private copy. Propagation includes copying,
96 | distribution (with or without modification), making available to the
97 | public, and in some countries other activities as well.
98 |
99 | To "convey" a work means any kind of propagation that enables other
100 | parties to make or receive copies. Mere interaction with a user through
101 | a computer network, with no transfer of a copy, is not conveying.
102 |
103 | An interactive user interface displays "Appropriate Legal Notices"
104 | to the extent that it includes a convenient and prominently visible
105 | feature that (1) displays an appropriate copyright notice, and (2)
106 | tells the user that there is no warranty for the work (except to the
107 | extent that warranties are provided), that licensees may convey the
108 | work under this License, and how to view a copy of this License. If
109 | the interface presents a list of user commands or options, such as a
110 | menu, a prominent item in the list meets this criterion.
111 |
112 | 1. Source Code.
113 |
114 | The "source code" for a work means the preferred form of the work
115 | for making modifications to it. "Object code" means any non-source
116 | form of a work.
117 |
118 | A "Standard Interface" means an interface that either is an official
119 | standard defined by a recognized standards body, or, in the case of
120 | interfaces specified for a particular programming language, one that
121 | is widely used among developers working in that language.
122 |
123 | The "System Libraries" of an executable work include anything, other
124 | than the work as a whole, that (a) is included in the normal form of
125 | packaging a Major Component, but which is not part of that Major
126 | Component, and (b) serves only to enable use of the work with that
127 | Major Component, or to implement a Standard Interface for which an
128 | implementation is available to the public in source code form. A
129 | "Major Component", in this context, means a major essential component
130 | (kernel, window system, and so on) of the specific operating system
131 | (if any) on which the executable work runs, or a compiler used to
132 | produce the work, or an object code interpreter used to run it.
133 |
134 | The "Corresponding Source" for a work in object code form means all
135 | the source code needed to generate, install, and (for an executable
136 | work) run the object code and to modify the work, including scripts to
137 | control those activities. However, it does not include the work's
138 | System Libraries, or general-purpose tools or generally available free
139 | programs which are used unmodified in performing those activities but
140 | which are not part of the work. For example, Corresponding Source
141 | includes interface definition files associated with source files for
142 | the work, and the source code for shared libraries and dynamically
143 | linked subprograms that the work is specifically designed to require,
144 | such as by intimate data communication or control flow between those
145 | subprograms and other parts of the work.
146 |
147 | The Corresponding Source need not include anything that users
148 | can regenerate automatically from other parts of the Corresponding
149 | Source.
150 |
151 | The Corresponding Source for a work in source code form is that
152 | same work.
153 |
154 | 2. Basic Permissions.
155 |
156 | All rights granted under this License are granted for the term of
157 | copyright on the Program, and are irrevocable provided the stated
158 | conditions are met. This License explicitly affirms your unlimited
159 | permission to run the unmodified Program. The output from running a
160 | covered work is covered by this License only if the output, given its
161 | content, constitutes a covered work. This License acknowledges your
162 | rights of fair use or other equivalent, as provided by copyright law.
163 |
164 | You may make, run and propagate covered works that you do not
165 | convey, without conditions so long as your license otherwise remains
166 | in force. You may convey covered works to others for the sole purpose
167 | of having them make modifications exclusively for you, or provide you
168 | with facilities for running those works, provided that you comply with
169 | the terms of this License in conveying all material for which you do
170 | not control copyright. Those thus making or running the covered works
171 | for you must do so exclusively on your behalf, under your direction
172 | and control, on terms that prohibit them from making any copies of
173 | your copyrighted material outside their relationship with you.
174 |
175 | Conveying under any other circumstances is permitted solely under
176 | the conditions stated below. Sublicensing is not allowed; section 10
177 | makes it unnecessary.
178 |
179 | 3. Protecting Users' Legal Rights From Anti-Circumvention Law.
180 |
181 | No covered work shall be deemed part of an effective technological
182 | measure under any applicable law fulfilling obligations under article
183 | 11 of the WIPO copyright treaty adopted on 20 December 1996, or
184 | similar laws prohibiting or restricting circumvention of such
185 | measures.
186 |
187 | When you convey a covered work, you waive any legal power to forbid
188 | circumvention of technological measures to the extent such circumvention
189 | is effected by exercising rights under this License with respect to
190 | the covered work, and you disclaim any intention to limit operation or
191 | modification of the work as a means of enforcing, against the work's
192 | users, your or third parties' legal rights to forbid circumvention of
193 | technological measures.
194 |
195 | 4. Conveying Verbatim Copies.
196 |
197 | You may convey verbatim copies of the Program's source code as you
198 | receive it, in any medium, provided that you conspicuously and
199 | appropriately publish on each copy an appropriate copyright notice;
200 | keep intact all notices stating that this License and any
201 | non-permissive terms added in accord with section 7 apply to the code;
202 | keep intact all notices of the absence of any warranty; and give all
203 | recipients a copy of this License along with the Program.
204 |
205 | You may charge any price or no price for each copy that you convey,
206 | and you may offer support or warranty protection for a fee.
207 |
208 | 5. Conveying Modified Source Versions.
209 |
210 | You may convey a work based on the Program, or the modifications to
211 | produce it from the Program, in the form of source code under the
212 | terms of section 4, provided that you also meet all of these conditions:
213 |
214 | a) The work must carry prominent notices stating that you modified
215 | it, and giving a relevant date.
216 |
217 | b) The work must carry prominent notices stating that it is
218 | released under this License and any conditions added under section
219 | 7. This requirement modifies the requirement in section 4 to
220 | "keep intact all notices".
221 |
222 | c) You must license the entire work, as a whole, under this
223 | License to anyone who comes into possession of a copy. This
224 | License will therefore apply, along with any applicable section 7
225 | additional terms, to the whole of the work, and all its parts,
226 | regardless of how they are packaged. This License gives no
227 | permission to license the work in any other way, but it does not
228 | invalidate such permission if you have separately received it.
229 |
230 | d) If the work has interactive user interfaces, each must display
231 | Appropriate Legal Notices; however, if the Program has interactive
232 | interfaces that do not display Appropriate Legal Notices, your
233 | work need not make them do so.
234 |
235 | A compilation of a covered work with other separate and independent
236 | works, which are not by their nature extensions of the covered work,
237 | and which are not combined with it such as to form a larger program,
238 | in or on a volume of a storage or distribution medium, is called an
239 | "aggregate" if the compilation and its resulting copyright are not
240 | used to limit the access or legal rights of the compilation's users
241 | beyond what the individual works permit. Inclusion of a covered work
242 | in an aggregate does not cause this License to apply to the other
243 | parts of the aggregate.
244 |
245 | 6. Conveying Non-Source Forms.
246 |
247 | You may convey a covered work in object code form under the terms
248 | of sections 4 and 5, provided that you also convey the
249 | machine-readable Corresponding Source under the terms of this License,
250 | in one of these ways:
251 |
252 | a) Convey the object code in, or embodied in, a physical product
253 | (including a physical distribution medium), accompanied by the
254 | Corresponding Source fixed on a durable physical medium
255 | customarily used for software interchange.
256 |
257 | b) Convey the object code in, or embodied in, a physical product
258 | (including a physical distribution medium), accompanied by a
259 | written offer, valid for at least three years and valid for as
260 | long as you offer spare parts or customer support for that product
261 | model, to give anyone who possesses the object code either (1) a
262 | copy of the Corresponding Source for all the software in the
263 | product that is covered by this License, on a durable physical
264 | medium customarily used for software interchange, for a price no
265 | more than your reasonable cost of physically performing this
266 | conveying of source, or (2) access to copy the
267 | Corresponding Source from a network server at no charge.
268 |
269 | c) Convey individual copies of the object code with a copy of the
270 | written offer to provide the Corresponding Source. This
271 | alternative is allowed only occasionally and noncommercially, and
272 | only if you received the object code with such an offer, in accord
273 | with subsection 6b.
274 |
275 | d) Convey the object code by offering access from a designated
276 | place (gratis or for a charge), and offer equivalent access to the
277 | Corresponding Source in the same way through the same place at no
278 | further charge. You need not require recipients to copy the
279 | Corresponding Source along with the object code. If the place to
280 | copy the object code is a network server, the Corresponding Source
281 | may be on a different server (operated by you or a third party)
282 | that supports equivalent copying facilities, provided you maintain
283 | clear directions next to the object code saying where to find the
284 | Corresponding Source. Regardless of what server hosts the
285 | Corresponding Source, you remain obligated to ensure that it is
286 | available for as long as needed to satisfy these requirements.
287 |
288 | e) Convey the object code using peer-to-peer transmission, provided
289 | you inform other peers where the object code and Corresponding
290 | Source of the work are being offered to the general public at no
291 | charge under subsection 6d.
292 |
293 | A separable portion of the object code, whose source code is excluded
294 | from the Corresponding Source as a System Library, need not be
295 | included in conveying the object code work.
296 |
297 | A "User Product" is either (1) a "consumer product", which means any
298 | tangible personal property which is normally used for personal, family,
299 | or household purposes, or (2) anything designed or sold for incorporation
300 | into a dwelling. In determining whether a product is a consumer product,
301 | doubtful cases shall be resolved in favor of coverage. For a particular
302 | product received by a particular user, "normally used" refers to a
303 | typical or common use of that class of product, regardless of the status
304 | of the particular user or of the way in which the particular user
305 | actually uses, or expects or is expected to use, the product. A product
306 | is a consumer product regardless of whether the product has substantial
307 | commercial, industrial or non-consumer uses, unless such uses represent
308 | the only significant mode of use of the product.
309 |
310 | "Installation Information" for a User Product means any methods,
311 | procedures, authorization keys, or other information required to install
312 | and execute modified versions of a covered work in that User Product from
313 | a modified version of its Corresponding Source. The information must
314 | suffice to ensure that the continued functioning of the modified object
315 | code is in no case prevented or interfered with solely because
316 | modification has been made.
317 |
318 | If you convey an object code work under this section in, or with, or
319 | specifically for use in, a User Product, and the conveying occurs as
320 | part of a transaction in which the right of possession and use of the
321 | User Product is transferred to the recipient in perpetuity or for a
322 | fixed term (regardless of how the transaction is characterized), the
323 | Corresponding Source conveyed under this section must be accompanied
324 | by the Installation Information. But this requirement does not apply
325 | if neither you nor any third party retains the ability to install
326 | modified object code on the User Product (for example, the work has
327 | been installed in ROM).
328 |
329 | The requirement to provide Installation Information does not include a
330 | requirement to continue to provide support service, warranty, or updates
331 | for a work that has been modified or installed by the recipient, or for
332 | the User Product in which it has been modified or installed. Access to a
333 | network may be denied when the modification itself materially and
334 | adversely affects the operation of the network or violates the rules and
335 | protocols for communication across the network.
336 |
337 | Corresponding Source conveyed, and Installation Information provided,
338 | in accord with this section must be in a format that is publicly
339 | documented (and with an implementation available to the public in
340 | source code form), and must require no special password or key for
341 | unpacking, reading or copying.
342 |
343 | 7. Additional Terms.
344 |
345 | "Additional permissions" are terms that supplement the terms of this
346 | License by making exceptions from one or more of its conditions.
347 | Additional permissions that are applicable to the entire Program shall
348 | be treated as though they were included in this License, to the extent
349 | that they are valid under applicable law. If additional permissions
350 | apply only to part of the Program, that part may be used separately
351 | under those permissions, but the entire Program remains governed by
352 | this License without regard to the additional permissions.
353 |
354 | When you convey a copy of a covered work, you may at your option
355 | remove any additional permissions from that copy, or from any part of
356 | it. (Additional permissions may be written to require their own
357 | removal in certain cases when you modify the work.) You may place
358 | additional permissions on material, added by you to a covered work,
359 | for which you have or can give appropriate copyright permission.
360 |
361 | Notwithstanding any other provision of this License, for material you
362 | add to a covered work, you may (if authorized by the copyright holders of
363 | that material) supplement the terms of this License with terms:
364 |
365 | a) Disclaiming warranty or limiting liability differently from the
366 | terms of sections 15 and 16 of this License; or
367 |
368 | b) Requiring preservation of specified reasonable legal notices or
369 | author attributions in that material or in the Appropriate Legal
370 | Notices displayed by works containing it; or
371 |
372 | c) Prohibiting misrepresentation of the origin of that material, or
373 | requiring that modified versions of such material be marked in
374 | reasonable ways as different from the original version; or
375 |
376 | d) Limiting the use for publicity purposes of names of licensors or
377 | authors of the material; or
378 |
379 | e) Declining to grant rights under trademark law for use of some
380 | trade names, trademarks, or service marks; or
381 |
382 | f) Requiring indemnification of licensors and authors of that
383 | material by anyone who conveys the material (or modified versions of
384 | it) with contractual assumptions of liability to the recipient, for
385 | any liability that these contractual assumptions directly impose on
386 | those licensors and authors.
387 |
388 | All other non-permissive additional terms are considered "further
389 | restrictions" within the meaning of section 10. If the Program as you
390 | received it, or any part of it, contains a notice stating that it is
391 | governed by this License along with a term that is a further
392 | restriction, you may remove that term. If a license document contains
393 | a further restriction but permits relicensing or conveying under this
394 | License, you may add to a covered work material governed by the terms
395 | of that license document, provided that the further restriction does
396 | not survive such relicensing or conveying.
397 |
398 | If you add terms to a covered work in accord with this section, you
399 | must place, in the relevant source files, a statement of the
400 | additional terms that apply to those files, or a notice indicating
401 | where to find the applicable terms.
402 |
403 | Additional terms, permissive or non-permissive, may be stated in the
404 | form of a separately written license, or stated as exceptions;
405 | the above requirements apply either way.
406 |
407 | 8. Termination.
408 |
409 | You may not propagate or modify a covered work except as expressly
410 | provided under this License. Any attempt otherwise to propagate or
411 | modify it is void, and will automatically terminate your rights under
412 | this License (including any patent licenses granted under the third
413 | paragraph of section 11).
414 |
415 | However, if you cease all violation of this License, then your
416 | license from a particular copyright holder is reinstated (a)
417 | provisionally, unless and until the copyright holder explicitly and
418 | finally terminates your license, and (b) permanently, if the copyright
419 | holder fails to notify you of the violation by some reasonable means
420 | prior to 60 days after the cessation.
421 |
422 | Moreover, your license from a particular copyright holder is
423 | reinstated permanently if the copyright holder notifies you of the
424 | violation by some reasonable means, this is the first time you have
425 | received notice of violation of this License (for any work) from that
426 | copyright holder, and you cure the violation prior to 30 days after
427 | your receipt of the notice.
428 |
429 | Termination of your rights under this section does not terminate the
430 | licenses of parties who have received copies or rights from you under
431 | this License. If your rights have been terminated and not permanently
432 | reinstated, you do not qualify to receive new licenses for the same
433 | material under section 10.
434 |
435 | 9. Acceptance Not Required for Having Copies.
436 |
437 | You are not required to accept this License in order to receive or
438 | run a copy of the Program. Ancillary propagation of a covered work
439 | occurring solely as a consequence of using peer-to-peer transmission
440 | to receive a copy likewise does not require acceptance. However,
441 | nothing other than this License grants you permission to propagate or
442 | modify any covered work. These actions infringe copyright if you do
443 | not accept this License. Therefore, by modifying or propagating a
444 | covered work, you indicate your acceptance of this License to do so.
445 |
446 | 10. Automatic Licensing of Downstream Recipients.
447 |
448 | Each time you convey a covered work, the recipient automatically
449 | receives a license from the original licensors, to run, modify and
450 | propagate that work, subject to this License. You are not responsible
451 | for enforcing compliance by third parties with this License.
452 |
453 | An "entity transaction" is a transaction transferring control of an
454 | organization, or substantially all assets of one, or subdividing an
455 | organization, or merging organizations. If propagation of a covered
456 | work results from an entity transaction, each party to that
457 | transaction who receives a copy of the work also receives whatever
458 | licenses to the work the party's predecessor in interest had or could
459 | give under the previous paragraph, plus a right to possession of the
460 | Corresponding Source of the work from the predecessor in interest, if
461 | the predecessor has it or can get it with reasonable efforts.
462 |
463 | You may not impose any further restrictions on the exercise of the
464 | rights granted or affirmed under this License. For example, you may
465 | not impose a license fee, royalty, or other charge for exercise of
466 | rights granted under this License, and you may not initiate litigation
467 | (including a cross-claim or counterclaim in a lawsuit) alleging that
468 | any patent claim is infringed by making, using, selling, offering for
469 | sale, or importing the Program or any portion of it.
470 |
471 | 11. Patents.
472 |
473 | A "contributor" is a copyright holder who authorizes use under this
474 | License of the Program or a work on which the Program is based. The
475 | work thus licensed is called the contributor's "contributor version".
476 |
477 | A contributor's "essential patent claims" are all patent claims
478 | owned or controlled by the contributor, whether already acquired or
479 | hereafter acquired, that would be infringed by some manner, permitted
480 | by this License, of making, using, or selling its contributor version,
481 | but do not include claims that would be infringed only as a
482 | consequence of further modification of the contributor version. For
483 | purposes of this definition, "control" includes the right to grant
484 | patent sublicenses in a manner consistent with the requirements of
485 | this License.
486 |
487 | Each contributor grants you a non-exclusive, worldwide, royalty-free
488 | patent license under the contributor's essential patent claims, to
489 | make, use, sell, offer for sale, import and otherwise run, modify and
490 | propagate the contents of its contributor version.
491 |
492 | In the following three paragraphs, a "patent license" is any express
493 | agreement or commitment, however denominated, not to enforce a patent
494 | (such as an express permission to practice a patent or covenant not to
495 | sue for patent infringement). To "grant" such a patent license to a
496 | party means to make such an agreement or commitment not to enforce a
497 | patent against the party.
498 |
499 | If you convey a covered work, knowingly relying on a patent license,
500 | and the Corresponding Source of the work is not available for anyone
501 | to copy, free of charge and under the terms of this License, through a
502 | publicly available network server or other readily accessible means,
503 | then you must either (1) cause the Corresponding Source to be so
504 | available, or (2) arrange to deprive yourself of the benefit of the
505 | patent license for this particular work, or (3) arrange, in a manner
506 | consistent with the requirements of this License, to extend the patent
507 | license to downstream recipients. "Knowingly relying" means you have
508 | actual knowledge that, but for the patent license, your conveying the
509 | covered work in a country, or your recipient's use of the covered work
510 | in a country, would infringe one or more identifiable patents in that
511 | country that you have reason to believe are valid.
512 |
513 | If, pursuant to or in connection with a single transaction or
514 | arrangement, you convey, or propagate by procuring conveyance of, a
515 | covered work, and grant a patent license to some of the parties
516 | receiving the covered work authorizing them to use, propagate, modify
517 | or convey a specific copy of the covered work, then the patent license
518 | you grant is automatically extended to all recipients of the covered
519 | work and works based on it.
520 |
521 | A patent license is "discriminatory" if it does not include within
522 | the scope of its coverage, prohibits the exercise of, or is
523 | conditioned on the non-exercise of one or more of the rights that are
524 | specifically granted under this License. You may not convey a covered
525 | work if you are a party to an arrangement with a third party that is
526 | in the business of distributing software, under which you make payment
527 | to the third party based on the extent of your activity of conveying
528 | the work, and under which the third party grants, to any of the
529 | parties who would receive the covered work from you, a discriminatory
530 | patent license (a) in connection with copies of the covered work
531 | conveyed by you (or copies made from those copies), or (b) primarily
532 | for and in connection with specific products or compilations that
533 | contain the covered work, unless you entered into that arrangement,
534 | or that patent license was granted, prior to 28 March 2007.
535 |
536 | Nothing in this License shall be construed as excluding or limiting
537 | any implied license or other defenses to infringement that may
538 | otherwise be available to you under applicable patent law.
539 |
540 | 12. No Surrender of Others' Freedom.
541 |
542 | If conditions are imposed on you (whether by court order, agreement or
543 | otherwise) that contradict the conditions of this License, they do not
544 | excuse you from the conditions of this License. If you cannot convey a
545 | covered work so as to satisfy simultaneously your obligations under this
546 | License and any other pertinent obligations, then as a consequence you may
547 | not convey it at all. For example, if you agree to terms that obligate you
548 | to collect a royalty for further conveying from those to whom you convey
549 | the Program, the only way you could satisfy both those terms and this
550 | License would be to refrain entirely from conveying the Program.
551 |
552 | 13. Use with the GNU Affero General Public License.
553 |
554 | Notwithstanding any other provision of this License, you have
555 | permission to link or combine any covered work with a work licensed
556 | under version 3 of the GNU Affero General Public License into a single
557 | combined work, and to convey the resulting work. The terms of this
558 | License will continue to apply to the part which is the covered work,
559 | but the special requirements of the GNU Affero General Public License,
560 | section 13, concerning interaction through a network will apply to the
561 | combination as such.
562 |
563 | 14. Revised Versions of this License.
564 |
565 | The Free Software Foundation may publish revised and/or new versions of
566 | the GNU General Public License from time to time. Such new versions will
567 | be similar in spirit to the present version, but may differ in detail to
568 | address new problems or concerns.
569 |
570 | Each version is given a distinguishing version number. If the
571 | Program specifies that a certain numbered version of the GNU General
572 | Public License "or any later version" applies to it, you have the
573 | option of following the terms and conditions either of that numbered
574 | version or of any later version published by the Free Software
575 | Foundation. If the Program does not specify a version number of the
576 | GNU General Public License, you may choose any version ever published
577 | by the Free Software Foundation.
578 |
579 | If the Program specifies that a proxy can decide which future
580 | versions of the GNU General Public License can be used, that proxy's
581 | public statement of acceptance of a version permanently authorizes you
582 | to choose that version for the Program.
583 |
584 | Later license versions may give you additional or different
585 | permissions. However, no additional obligations are imposed on any
586 | author or copyright holder as a result of your choosing to follow a
587 | later version.
588 |
589 | 15. Disclaimer of Warranty.
590 |
591 | THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY
592 | APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT
593 | HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY
594 | OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO,
595 | THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR
596 | PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM
597 | IS WITH YOU. SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF
598 | ALL NECESSARY SERVICING, REPAIR OR CORRECTION.
599 |
600 | 16. Limitation of Liability.
601 |
602 | IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING
603 | WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MODIFIES AND/OR CONVEYS
604 | THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY
605 | GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE
606 | USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF
607 | DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD
608 | PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS),
609 | EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF
610 | SUCH DAMAGES.
611 |
612 | 17. Interpretation of Sections 15 and 16.
613 |
614 | If the disclaimer of warranty and limitation of liability provided
615 | above cannot be given local legal effect according to their terms,
616 | reviewing courts shall apply local law that most closely approximates
617 | an absolute waiver of all civil liability in connection with the
618 | Program, unless a warranty or assumption of liability accompanies a
619 | copy of the Program in return for a fee.
620 |
621 | END OF TERMS AND CONDITIONS
622 |
623 | How to Apply These Terms to Your New Programs
624 |
625 | If you develop a new program, and you want it to be of the greatest
626 | possible use to the public, the best way to achieve this is to make it
627 | free software which everyone can redistribute and change under these terms.
628 |
629 | To do so, attach the following notices to the program. It is safest
630 | to attach them to the start of each source file to most effectively
631 | state the exclusion of warranty; and each file should have at least
632 | the "copyright" line and a pointer to where the full notice is found.
633 |
634 |
635 | Copyright (C)
636 |
637 | This program is free software: you can redistribute it and/or modify
638 | it under the terms of the GNU General Public License as published by
639 | the Free Software Foundation, either version 3 of the License, or
640 | (at your option) any later version.
641 |
642 | This program is distributed in the hope that it will be useful,
643 | but WITHOUT ANY WARRANTY; without even the implied warranty of
644 | MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
645 | GNU General Public License for more details.
646 |
647 | You should have received a copy of the GNU General Public License
648 | along with this program. If not, see .
649 |
650 | Also add information on how to contact you by electronic and paper mail.
651 |
652 | If the program does terminal interaction, make it output a short
653 | notice like this when it starts in an interactive mode:
654 |
655 | Copyright (C)
656 | This program comes with ABSOLUTELY NO WARRANTY; for details type `show w'.
657 | This is free software, and you are welcome to redistribute it
658 | under certain conditions; type `show c' for details.
659 |
660 | The hypothetical commands `show w' and `show c' should show the appropriate
661 | parts of the General Public License. Of course, your program's commands
662 | might be different; for a GUI interface, you would use an "about box".
663 |
664 | You should also get your employer (if you work as a programmer) or school,
665 | if any, to sign a "copyright disclaimer" for the program, if necessary.
666 | For more information on this, and how to apply and follow the GNU GPL, see
667 | .
668 |
669 | The GNU General Public License does not permit incorporating your program
670 | into proprietary programs. If your program is a subroutine library, you
671 | may consider it more useful to permit linking proprietary applications with
672 | the library. If this is what you want to do, use the GNU Lesser General
673 | Public License instead of this License. But first, please read
674 | .
675 |
--------------------------------------------------------------------------------
/Standalone/Pfeature_Descriptors.pdf:
--------------------------------------------------------------------------------
https://raw.githubusercontent.com/raghavagps/Pfeature/1117d4c9712a7d230ed0e0026be8d9a2d859e978/Standalone/Pfeature_Descriptors.pdf
--------------------------------------------------------------------------------
/Standalone/README.md:
--------------------------------------------------------------------------------
1 | # Standalone Package of Pfeature
2 | ## Introduction
3 | Pfeature is developed for computing wide range of protein and peptides features from their amino acid sequences, and structures. More information on Pfeature is available from its web server https://webs.iiitd.edu.in/raghava/pfeature. The standalone package of Pfeature allow users to computes individual as well as, all possible descriptors for a protein/peptide sequence. This page provide information about standalone version of Pfeature. This standalone contains three scripts, their description is as follows:
4 | - `pfeature_comp.py` : To calculated composition based features
5 | - `pfeature_bin.py` : To calculated binary profile based features
6 | - `pfeature_pssm.py` : To calculated binary profile based features
7 |
8 | ## Help Usage
9 | To learn about the full usage, run the following command:
10 | ```sh
11 | python pfeature_comp.py -h
12 | OR
13 | python pfeature_bin.py -h
14 | OR
15 | python pfeature_pssm.py -h
16 | ```
17 | Following output will be generated on running python "pfeature_bin.py -h" command:
18 | 
19 |
20 | ### Parameters Description
21 | ```
22 | Input File: It allow users to provide input in two format:
23 | i. FASTA format (standard) (e.g. protein.fa)
24 | ii. Simple Format, file should have sequences in a single line in single letter code (eg. protein.seq)
25 |
26 | Output File: Program will save result in CSV format, in the provided filename.
27 | If user do not provide output file name, it will be stored in pfeature_results.csv.
28 | In case user want to calculate all the features except ATB and BTB, the job name will be 'ALLBIN'. Reason to leave ATB and BTB is, the number of atoms and bonds are not equal in all amino acid residues.
29 |
30 | Job name: It allows users to choose the type of composition, the user want to calculate, such as AAB which stands for Amino Acid based binary profile.
31 | In case user do not provide any job name, it will choose AAB by default.
32 |
33 | N-terminal: It allows user to cut the specific number of residues from the N-terminal of the sequences.
34 |
35 | C-terminal: It allows user to cut the specific number of residues from the C-terminal of the sequences.
36 |
37 | NCT-terminal: It allows user to cut the specific number of residues from the N- and C-terminal of the sequences, and join them.
38 |
39 | Rest_N : It allow users to drop the specific number of residues from N-terminal, and perform operations on the rest.
40 |
41 | Rest_C : It allow users to drop the specific number of residues from C-terminal, and perform operations on the rest.
42 |
43 | Split: It allow users to divided the sequence into number of sequences.
44 |
45 | Lag : It defines the value for order of dipeptide, to calculate the dipeptide based binary profiles.
46 | ```
47 | ## Minimum Usage Usage
48 | To learn about the full usage, run the following command:
49 | ```sh
50 | python pfeature_comp.py -i protein.fa
51 | OR
52 | python pfeature_bin.py -i protein.fa
53 | OR
54 | python pfeature_pssm.py -i protein.fa
55 | ```
56 |
57 | ## Pfeature Package Files
58 | It contantain following files, brief description of these files are given below:
59 |
60 | * `LICENSE` : License information
61 |
62 | * `README.txt` : This file provide information about this package
63 |
64 | * `pfeature_comp.py` : Python program to calculate composition based features
65 |
66 | * `pfeature_bin.py` : Python program to calculate binary profile based features
67 |
68 | * `pfeature_pssm.py` : Python program to calculate pssm profile based features
69 |
70 | * `protein.seq` : Example file contain protein sequences in simple format
71 |
72 | * `protein.fa` : Example file contain protein sequences in FASTA format
73 |
74 | * `Data ` : This folder contains the files required to calcuate the composition and binary profile based features.
75 |
76 | * `envfile` : This file contains the path information required to run the pfeature_pssm.py script.
77 |
78 | * `Pfeature_Descriptors.pdf` : This file comprises of description of the header of output files, which is generated using the aforementioned scripts.
79 |
80 | * `Requirement.txt` : This file consists of commands and pre-requisite to run the aforementioned scripts.
81 |
--------------------------------------------------------------------------------
/Standalone/README.txt:
--------------------------------------------------------------------------------
1 | # Pfeature
2 | # Introduction
3 | Pfeature is developed for computing wide range of protein and peptides features from their amino acid sequences. More information on Pfeature is abvailble from its web server https://webs.iiitd.edu.in/raghava/pfeature. This page provide information about standalone version of Pfeature. This standalone contains three scripts, their description is as follows:
4 |
5 | #############################################################################################################################################################################################################################
6 |
7 | 1: Standalone for calculating composition based features:
8 |
9 | **Important: To run this script 'Data' folder should be in the same directory.**
10 |
11 | Minimum USAGE: Minimum ussage is "pfeature_comp.py -i protein.fa" where protein.fa is a input fasta file. This will calculate the amino acid composition of the seqeunces provided in the fasta file. It will use other parameters by default. It will save output in "pfeature_result.csv" in CSV (comma seperated variables).
12 |
13 | #Full Usage: Following is complete list of all options, you may get these options by "pfeature_comp.py -h"
14 | usage: pfeature_comp.py [-h] -i INPUT [-o OUTPUT]
15 | [-j {AAC,DPC,TPC,ATC,BTC,PCP,AAI,RRI,PRI,DDR,SEP,SER,SPC,ACR,CTC,CeTD,PAAC,APAAC,QSO,SOC,ALLCOMP}]
16 | [-n N_TERMINAL] [-c C_TERMINAL] [-nct NC_TERMINAL]
17 | [-rn REST_N] [-rc REST_C] [-s SPLIT] [-d LAG]
18 | [-w WEIGHT] [-t PWEIGHT]
19 |
20 | optional arguments:
21 | -h, --help show this help message and exit
22 | -i INPUT, --input INPUT
23 | Input: protein or protein.sequence in FASTA format or single sequence per line in single letter code
24 | -o OUTPUT, --output OUTPUT
25 | Output: File for saving results by default pfeature_result.csv
26 | -j {AAC,DPC,TPC,ATC,BTC,PCP,AAI,RRI,PRI,DDR,SEP,SER,SPC,ACR,CTC,CeTD,PAAC,APAAC,QSO,SOC,ALLCOMP}, --job {AAC,DPC,TPC,ATC,BTC,PCP,AAI,RRI,PRI,DDR,SEP,SER,SPC,ACR,CTC,CeTD,PAAC,APAAC,QSO,SOC,ALLCOMP}
27 | Job Type:
28 | AAC: Amino acid composition
29 | DPC: Dipeptide composition
30 | TPC: Tripeptide composition
31 | ATC: Atomic composition
32 | BTC: Bond composition
33 | PCP: Physico-chemical properties composition
34 | AAI: Amino-acid indices composition
35 | RRI: Residue repeat information
36 | PRI: Physico-chemical properties repeat information
37 | DDR: Distance distribution of residues
38 | SEP: Shannon entropy of protein
39 | SER: Shannon entropy of residues
40 | SPC: Shannon entropy of physico-chemical properties
41 | ACR: Autocorrelation descriptors
42 | CTC: Conjoint triad descriptors
43 | CeTD: Composition enhanced transition distribution
44 | PAAC: Pseudo amino acid composition
45 | APAAC: Amphiphilic pseudo amino acid composition
46 | QSO: Quasi sequence order
47 | SOC: Sequence order coupling number
48 | ALLCOMP:All composition features together except ACR and AAI
49 | by default AAC
50 | -n N_TERMINAL, --n_terminal N_TERMINAL
51 | Window Length from N-terminal: by default 0
52 | -c C_TERMINAL, --c_terminal C_TERMINAL
53 | Window Length from C-terminal: by default 0
54 | -nct NC_TERMINAL, --nc_terminal NC_TERMINAL
55 | Residues from N- and C-terminal: by default 0
56 | -rn REST_N, --rest_n REST_N
57 | Number of residues removed from N-terminal, by default 0
58 | -rc REST_C, --rest_c REST_C
59 | Number of residues removed from C-terminal, by default 0
60 | -s SPLIT, --split SPLIT
61 | Number of splits a sequence divided into, by default 0
62 | -d LAG, --lag LAG This represents the order of gap, lag or dipeptide, by default 1
63 | -w WEIGHT, --weight WEIGHT
64 | Weighting Factor for QSO: Value between 0 to 1, by default 0.1
65 | -t PWEIGHT, --pweight PWEIGHT
66 | Weighting factor for pseudo and amphiphlic pseudo amino acid composition: Value between 0 to 1, by default 0.05
67 |
68 | #Parameters Description:
69 |
70 | Input File: It allow users to provide input in two format;
71 | i) FASTA format (standard) (e.g. protein.fa)
72 | ii) Simple Format, in this case, file should have sequences in a single line in single letter code (eg. protein.seq).
73 |
74 | Output File: Program will save result in CSV format, in the provided filename.
75 | In case user do not provide output file name, it will be stored in pfeature_results.csv.
76 | In case user want to calculate all the features except AAI and ACR, the job name will be 'ALLCOMP'. Reason to leave AAI and ACR is, the feature calculation takes long time for longer sequences.
77 |
78 | Job name: It allows users to choose the type of composition, the user want to calculate, such as AAC which stands for Amino Acid composition.
79 | In case user do not provide any job name, it will choose AAC by default.
80 |
81 | N-terminal: It allows user to cut the specific number of residues from the N-terminal of the sequences.
82 |
83 |
84 | C-terminal: It allows user to cut the specific number of residues from the C-terminal of the sequences.
85 |
86 | NCT-terminal: It allows user to cut the specific number of residues from the N- and C-terminal of the sequences, and join them.
87 |
88 | Rest_N : It allow users to drop the specific number of residues from N-terminal, and perform operations on the rest.
89 |
90 | Rest_C : It allow users to drop the specific number of residues from C-terminal, and perform operations on the rest.
91 |
92 | Split: It allow users to divided the sequence into number of sequences.
93 |
94 | Lag : It defines the value for order of lag, lambda, gap or dipeptide, to calculate certain features.
95 |
96 | Weight: It defines the weight factor to calculate the quasi-sequence order, by default it is set at 0.1.
97 |
98 | Pweight: It defines the weight factor to calculate the pseudo and amphiphlic pseudo amino acid composition, by default it is set at 0.05.
99 |
100 | #############################################################################################################################################################################################################################
101 |
102 | 2: Standalone for calculating binary profiles based features:
103 |
104 | **Important: To run this script 'Data' folder should be in the same directory.**
105 |
106 | Minimum USAGE: Minimum ussage is "pfeature_bin.py -i protein.fa" where protein.fa is a input fasta file. This will calculate the amino acid binary profile of the seqeunces provided in the fasta file. It will use other parameters by default. It will save output in "pfeature_result.csv" in CSV (comma seperated variables).
107 |
108 | usage: pfeature_bin.py [-h] -i INPUT [-o OUTPUT]
109 | [-j {AAB,DPB,ATB,BTB,PCB,AIB,ALLBIN}] [-n N_TERMINAL]
110 | [-c C_TERMINAL] [-nct NC_TERMINAL] [-rn REST_N]
111 | [-rc REST_C] [-s SPLIT] [-d LAG]
112 |
113 | Please provide following arguments
114 |
115 | optional arguments:
116 | -h, --help show this help message and exit
117 | -i INPUT, --input INPUT
118 | Input: protein or protein.sequence in FASTA format or single sequence per line in single letter code
119 | -o OUTPUT, --output OUTPUT
120 | Output: File for saving results by default pfeature_result.csv
121 | -j {AAB,DPB,ATB,BTB,PCB,AIB,ALLBIN}, --job {AAB,DPB,ATB,BTB,PCB,AIB,ALLBIN}
122 | Job Type:
123 | AAB: Amino acid based binary profile
124 | DPB: Dipeptide based binary profile
125 | ATB: Atom based binary profile
126 | BTB: Bond based binary profile
127 | PCB: Physico-chemical properties based binary profile
128 | AIB: Amino-acid indices based binary profile
129 | ALLBIN:All binary profiles together except ATB and BTB
130 | by default AAB
131 | -n N_TERMINAL, --n_terminal N_TERMINAL
132 | Window Length from N-terminal: by default 0
133 | -c C_TERMINAL, --c_terminal C_TERMINAL
134 | Window Length from C-terminal: by default 0
135 | -nct NC_TERMINAL, --nc_terminal NC_TERMINAL
136 | Residues from N- and C-terminal: by default 0
137 | -rn REST_N, --rest_n REST_N
138 | Number of residues removed from N-terminal, by default 0
139 | -rc REST_C, --rest_c REST_C
140 | Number of residues removed from C-terminal, by default 0
141 | -s SPLIT, --split SPLIT
142 | Number of splits a sequence divided into, by default 0
143 | -d LAG, --lag LAG This represents the order of gap, lag or dipeptide, by default 1
144 |
145 | #Parameters Description:
146 |
147 | Input File: It allow users to provide input in two format;
148 | i) FASTA format (standard) (e.g. protein.fa)
149 | ii) Simple Format, in this case, file should have sequences in a single line in single letter code (eg. protein.seq).
150 |
151 | Output File: Program will save result in CSV format, in the provided filename.
152 | In case user do not provide output file name, it will be stored in pfeature_results.csv.
153 | In case user want to calculate all the features except ATB and BTB, the job name will be 'ALLBIN'. Reason to leave ATB and BTB is, the number of atoms and bonds are not equal in all amino acid residues.
154 |
155 | Job name: It allows users to choose the type of composition, the user want to calculate, such as AAB which stands for Amino Acid based binary profile.
156 | In case user do not provide any job name, it will choose AAB by default.
157 |
158 | N-terminal: It allows user to cut the specific number of residues from the N-terminal of the sequences.
159 |
160 |
161 | C-terminal: It allows user to cut the specific number of residues from the C-terminal of the sequences.
162 |
163 | NCT-terminal: It allows user to cut the specific number of residues from the N- and C-terminal of the sequences, and join them.
164 |
165 | Rest_N : It allow users to drop the specific number of residues from N-terminal, and perform operations on the rest.
166 |
167 | Rest_C : It allow users to drop the specific number of residues from C-terminal, and perform operations on the rest.
168 |
169 | Split: It allow users to divided the sequence into number of sequences.
170 |
171 | Lag : It defines the value for order of dipeptide, to calculate the dipeptide based binary profiles.
172 |
173 | #############################################################################################################################################################################################################################
174 |
175 | 3: Standalone for calculating PSSM profile
176 |
177 | **Important: To run this script a file with the file name 'envfile' is required.**
178 |
179 | *This envfile contains paths for the following scripts/data:*
180 | i) Path for blastpgp
181 | ii) Path for blast database
182 | iii) Path for makemat
183 |
184 |
185 | Minimum USAGE: Minimum ussage is "pfeature_pssm.py -i protein.fa" where protein.fa is a input fasta file. This will calculate the PSSM profile of the seqeunces provided in the fasta file. It will use other parameters by default. It will save output in "pssm_profile.csv" in CSV (comma seperated variables).
186 |
187 | -h, --help show this help message and exit
188 | -i INPUT, --input INPUT
189 | Input: protein or peptide sequence in FASTA format or single sequence per line in single letter code
190 | -o OUTPUT, --output OUTPUT
191 | Output: File for saving results by default pssm_profile.csv
192 | -n {N0,N1,N2,N3,N4}, --normalization_method {N0,N1,N2,N3,N4}
193 | Normalization Method:
194 | N0: It provides pssm profile without any normalization
195 | N1: It normalizes pssm profile based on 1/(1+e^-x) formula
196 | N2: It normalizes pssm profile based on (x-min)/(max-min) formula
197 | N3: It normalizes pssm profile based on ((x-min)/(max-min))*100 formula
198 | N4: It normalizes pssm profile based on 1/(1+e^-(x/100) formula
199 | By default it is N0
200 |
201 | #Parameters Description:
202 |
203 | Input File: It allow users to provide input in two format;
204 | i) FASTA format (standard) (e.g. protein.fa)
205 | ii) Simple Format, in this case, file should have sequences in a single line in single letter code (eg. protein.seq).
206 |
207 | Output File: Program will save result in CSV format, in the provided filename.
208 | In case user do not provide output file name, it will be stored in pssm_profile.csv
209 |
210 | Normalization methods: It allows user to normalize the PSSM profiles using four different formula. The description is as follows:
211 | N0: It provides pssm profile without any normalization
212 | N1: It normalizes pssm profile based on 1/(1+e^-x) formula
213 | N2: It normalizes pssm profile based on (x-min)/(max-min) formula
214 | N3: It normalizes pssm profile based on ((x-min)/(max-min))*100 formula
215 | N4: It normalizes pssm profile based on 1/(1+e^-(x/100) formula
216 | By default it is N0
217 |
218 | Pfeature Packakage Files
219 | =======================
220 | It contantain following files, brief description of these files are given below:
221 |
222 | LICENSE : License information
223 |
224 | README.md : This file provide information about this package
225 |
226 | pfeature_comp.py : Python program to calculate composition based features
227 |
228 | pfeature_bin.py : Python program to calculate binary profile based features
229 |
230 | pfeature_pssm.py : Python program to calculate pssm profile based features
231 |
232 | protein.seq : Example file contain protein sequences in simple format
233 |
234 | protein.fa : Example file contain protein sequences in FASTA format
235 |
236 | Data : This folder contains the files required to calcuate the composition and binary profile based features.
237 |
238 | envfile : This file contains the path information required to run the pfeature_pssm.py script.
239 |
240 | Pfeature_Descriptors.pdf : This file comprises of description of the header of output files, which is generated using the aforementioned scripts.
241 |
242 | Requirement.txt : This file consists of commands and pre-requisite to run the aforementioned scripts.
243 |
--------------------------------------------------------------------------------
/Standalone/Requirement.txt:
--------------------------------------------------------------------------------
1 | 1. Pre-requisite
2 | ==========
3 | In order to run this program user should have Python3, and scikit-learn library.
4 |
5 | 2. Command line
6 | ================
7 | In order to know the arguments of any script, please run the following command:
8 | i. For Composition based features
9 | python pfeature_comp.py -h
10 | i. For Binary profile based features
11 | python pfeature_bin.py -h
12 | i. For PSSM profile based features
13 | python pfeature_pssm.py -h
14 |
--------------------------------------------------------------------------------
/Standalone/Screenshot.png:
--------------------------------------------------------------------------------
https://raw.githubusercontent.com/raghavagps/Pfeature/1117d4c9712a7d230ed0e0026be8d9a2d859e978/Standalone/Screenshot.png
--------------------------------------------------------------------------------
/Standalone/envfile:
--------------------------------------------------------------------------------
1 | #Path information for the generation of PSSM profile
2 | #User can change the paths according to their machines
3 | BLASTPGP:/home/gpsr/software/blastpr/blastpgp
4 | BLAST database:/usr1/software/blastpr/data/swissprot
5 | MAKEMAT:/home/gpsr/software/blastpr/makemat
6 |
--------------------------------------------------------------------------------
/Standalone/pfeature_pssm.py:
--------------------------------------------------------------------------------
1 | import io
2 | import os
3 | import shlex
4 | import subprocess
5 | import glob
6 | import pandas as pd
7 | import numpy as np
8 | import sys
9 | import uuid
10 | import re
11 | import argparse
12 | from argparse import RawTextHelpFormatter
13 | parser = argparse.ArgumentParser(description='Please provide following arguments',formatter_class=RawTextHelpFormatter)
14 | parser.add_argument("-i","-I","--input", type=str, required=True, help="Input: protein or peptide sequence in FASTA format or single sequence per line in single letter code")
15 | parser.add_argument("-o","-O","--output",type=str, help="Output: File for saving results by default pssm_profile.csv")
16 | parser.add_argument("-n","-N","--normalization_method",type=str.upper, choices = ['N0','N1','N2','N3','N4'], help="Normalization Method:\nN0: It provides pssm profile without any normalization\nN1: It normalizes pssm profile based on 1/(1+e^-x) formula\nN2: It normalizes pssm profile based on (x-min)/(max-min) formula\nN3: It normalizes pssm profile based on ((x-min)/(max-min))*100 formula\nN4: It normalizes pssm profile based on 1/(1+e^-(x/100) formula\nBy default it is N0")
17 | args = parser.parse_args()
18 |
19 | # Input variable
20 | sequencefile= args.input
21 | # Output file
22 | if args.output == None:
23 | result_filename= "pssm_profile.csv"
24 | else:
25 | result_filename = args.output
26 | if args.normalization_method == None:
27 | nm= "N0"
28 | else:
29 | nm = args.normalization_method
30 |
31 | def pssm_2(file):
32 | pd.options.display.float_format = '{:.2e}'.format
33 | df=file
34 | df1 = df
35 | df2 = df1.applymap(pssm_1)
36 | return df2
37 | def pssm_1(x):
38 | if nm == 'N0':
39 | if type(x) is str:
40 | return x
41 | elif x:
42 | return x
43 | else:
44 | return
45 | if nm == 'N1':
46 | if type(x) is str:
47 | return x
48 | elif x < -700:
49 | return 0
50 | elif x:
51 | return (1/(1+(2.7182)**(-x)))
52 | else:
53 | return x
54 | if nm == 'N2':
55 | a = 1000
56 | b = -1000
57 | if type(x) is str:
58 | return x
59 | elif x:
60 | return (x-a)/(b - a)
61 | else:
62 | return
63 | if nm == 'N3':
64 | a = 1000
65 | b = -1000
66 | if type(x) is str:
67 | return x
68 | elif x:
69 | return ((x-a)*100)/(b - a)
70 | else:
71 | return
72 | if nm == 'N4':
73 | if type(x) is str:
74 | return x
75 | elif x:
76 | return (1/(1+(2.7182)**(-x/100)))
77 | else:
78 | return
79 | def readseq(file,out):
80 | with open(file) as f:
81 | records = f.read()
82 | records = records.split('>')[1:]
83 | seqid = []
84 | seq = []
85 | for fasta in records:
86 | array = fasta.split('\n')
87 | name, sequence = array[0].split()[0], re.sub('[^ARNDCQEGHILKMFPSTWYV-]', '', ''.join(array[1:]).upper())
88 | seqid.append(name)
89 | seq.append(sequence)
90 | if len(seqid) == 0:
91 | f=open(file,"r")
92 | data1 = f.readlines()
93 | for each in data1:
94 | seq.append(each.replace('\n',''))
95 | for i in range (1,len(seq)+1):
96 | seqid.append("Seq_"+str(i))
97 | for i in seq:
98 | if 'B' in i:
99 | print('\nError: The input sequences contain non-natural amino acids. Kindly check the sequence.\n')
100 | sys.exit()
101 | if 'J' in i:
102 | print('\nError: The input sequences contain non-natural amino acids. Kindly check the sequence.\n')
103 | sys.exit()
104 | if 'O' in i:
105 | print('\nError: The input sequences contain non-natural amino acids. Kindly check the sequence.\n')
106 | sys.exit()
107 | if 'U' in i:
108 | print('\nError: The input sequences contain non-natural amino acids. Kindly check the sequence.\n')
109 | sys.exit()
110 | if 'Z' in i:
111 | print('\nError: The input sequences contain non-natural amino acids. Kindly check the sequence.\n')
112 | sys.exit()
113 | if 'X' in i:
114 | print('\nError: The input sequences contain non-natural amino acids. Kindly check the sequence.\n')
115 | sys.exit()
116 | df4 = pd.DataFrame(seq)
117 | df4.to_csv(out,index=None,header=False)
118 | def pssm(inputfile,outputfile):
119 | if os.path.exists('envfile'):
120 | with open('envfile', 'r') as file:
121 | data = file.readlines()
122 | output = []
123 | for line in data:
124 | if not "#" in line:
125 | output.append(line)
126 | if len(output)==3:
127 | paths = []
128 | for i in range (0,len(output)):
129 | paths.append(output[i].split(':')[1].replace('\n',''))
130 | blastpgp = paths[0]
131 | blastdb = paths[1]
132 | makemat = paths[2]
133 | if os.path.isfile(blastpgp) and os.access(blastpgp, os.R_OK):
134 | print('The provided directory for blastpgp is correct and readable.')
135 | else:
136 | print("########################################################################################################################")
137 | print("Error: Either 'blastbgp' file is missing from the provided directory in the 'envfile', or not readable. Kindly check.", file=sys.stderr)
138 | print("########################################################################################################################")
139 | sys.exit()
140 | if os.path.isfile(makemat) and os.access(makemat, os.R_OK):
141 | print('The provided directory for makemat is correct and readable.')
142 | else:
143 | print("########################################################################################################################")
144 | print("Error: Either 'makemat' file is missing from the provided directory in the 'envfile', or not readable. Kindly check.", file=sys.stderr)
145 | print("########################################################################################################################")
146 | sys.exit()
147 | if (glob.glob(blastdb+".pin")) and (glob.glob(blastdb+".psq")) and (glob.glob(blastdb+".phr")):
148 | print('The provided directory for blast database is correct and readable.')
149 | else:
150 | dbfiles = blastdb.split('/')[-1]
151 | print("##############################################################################################################################################################################################")
152 | print("Error: Either the files for BLAST database are missing from the provided directory in the 'envfile', or not readable. Please provide the files with extension of", dbfiles+".pin,", dbfiles+".phr,", dbfiles+".psq in the provided directory.", "Kindly check.", file=sys.stderr)
153 | print("##############################################################################################################################################################################################")
154 | sys.exit()
155 |
156 | else:
157 | print("####################################################################################")
158 | print("Error: Please provide the '{}', which comprises paths for BLASTPGP and MAKEMAT".format('envfile'), file=sys.stderr)
159 | print("####################################################################################")
160 | sys.exit()
161 | ss = []
162 | file_list = []
163 | readseq(inputfile,'temp.readseq')
164 | df1 = pd.read_csv('temp.readseq', header=None)
165 | aa = []
166 | for i in df1[0]:
167 | aa.append(len(i))
168 | for i in range(0,len(df1)):
169 | ss.append('>seq_'+str(i+1))
170 | df1['seq'] = ss
171 | df1 = df1[['seq',0]]
172 | for ii in range(0,len(df1)):
173 | name_file = df1['seq'][ii].replace('>','')+'.fasta'
174 | file_out = df1['seq'][ii].replace('>','')+'.pssmout'
175 | file_list.append(df1['seq'][ii].replace('>','')+'.mtx')
176 | df1.iloc[ii].to_csv(name_file, index=None, header=False, sep='\n')
177 | filename, file_extension = os.path.splitext(name_file)
178 | filename_o, file_extension_o = os.path.splitext(file_out)
179 | S = blastpgp + ' -d ' + blastdb + ' -i ' + name_file + ' -j 3 -C ' + file_out
180 | os.system(S)
181 | os.rename(file_out, filename_o + '.chk')
182 | outputfile1 = filename_o + ".chk"
183 | temp1 =filename_o + ".sn"
184 | C2 = 'echo {} > {}'.format(name_file,temp1)
185 | os.system(C2)
186 | temp2 = filename_o + ".pn"
187 | C1 = 'echo {} > {}'.format(outputfile1,temp2)
188 | os.system(C1)
189 | P = makemat + ' -P ' + filename_o
190 | os.system(P)
191 | dir = '.'
192 | tt = []
193 | for i in file_list:
194 | ss = []
195 | fp = open(i)
196 | all_line = fp.readlines()
197 | ss.append(all_line[14:])
198 | uu = []
199 | for j in all_line[14:]:
200 | uu.append(j.replace('\n','').replace(' ',','))
201 | np.savetxt(i+'_temp',uu, fmt="%s")
202 | df11 = pd.read_csv(i+'_temp', header=None, sep=",")
203 | col = [1,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,22]
204 | df13 = df11.iloc[:,col].reset_index(drop=True)
205 | df12 = pssm_2(df13)
206 | for i in range(0,len(df12)):
207 | tt.extend(df12.loc[i])
208 | bb = []
209 | cc = 0
210 | for i in range(0,len(aa)):
211 | bb.append(tt[cc:cc+20*(aa[i])])
212 | cc = cc+20*(aa[i])
213 | df123 = pd.DataFrame(bb)
214 | df456 = df123.fillna('NA')
215 | df456.to_csv(outputfile,index=None,header=False,float_format='%.2e')
216 | allfiles = os.listdir(dir)
217 | for item in allfiles :
218 | if item.endswith(".aux") or item.endswith(".sn") or item.endswith(".pn") or item.endswith(".mn") or item.endswith(".mtx_temp") or item.endswith(".mtx") or item.endswith(".chk") or item.endswith(".fasta") or item.endswith(".readseq"):
219 | os.remove(os.path.join(dir, item))
220 |
221 | pssm(sequencefile,result_filename)
222 |
--------------------------------------------------------------------------------
/Standalone/pfeature_standalone.zip:
--------------------------------------------------------------------------------
https://raw.githubusercontent.com/raghavagps/Pfeature/1117d4c9712a7d230ed0e0026be8d9a2d859e978/Standalone/pfeature_standalone.zip
--------------------------------------------------------------------------------
/Standalone/protein.fa:
--------------------------------------------------------------------------------
1 | >Seq_1
2 | PAAAAQAVAGLAPVAAEQMALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
3 | >Seq_2
4 | MMFRSVIPVLLFLIPLLLSAQAANSLRACGPALMDMLRVACPNGFNSMFAKRGTLGLFDYEDHLADLDSSESHHMNSLSSIRRDFRGVVDSCCRKSCSFSTLRAYCDS
5 | >Seq_3
6 | MALWTRLLPLLALLALWAPAPAQAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREAENPQAGAVELGGGLGGLQALALEGPPQKRGIVEQCCTSICSLYQLENYCN
7 |
--------------------------------------------------------------------------------
/Standalone/protein.seq:
--------------------------------------------------------------------------------
1 | PAAAAQAVAGLAPVAAEQMALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
2 | MMFRSVIPVLLFLIPLLLSAQAANSLRACGPALMDMLRVACPNGFNSMFAKRGTLGLFDYEDHLADLDSSESHHMNSLSSIRRDFRGVVDSCCRKSCSFSTLRAYCDS
3 | MALWTRLLPLLALLALWAPAPAQAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREAENPQAGAVELGGGLGGLQALALEGPPQKRGIVEQCCTSICSLYQLENYCN
4 |
--------------------------------------------------------------------------------
/scripts/Pfeature_scripts.zip:
--------------------------------------------------------------------------------
https://raw.githubusercontent.com/raghavagps/Pfeature/1117d4c9712a7d230ed0e0026be8d9a2d859e978/scripts/Pfeature_scripts.zip
--------------------------------------------------------------------------------
/scripts/readme:
--------------------------------------------------------------------------------
1 | ## Python scripts in python, these scripts can run independently
2 |
--------------------------------------------------------------------------------