├── src └── boltz │ ├── data │ ├── __init__.py │ ├── crop │ │ ├── __init__.py │ │ └── cropper.py │ ├── filter │ │ ├── __init__.py │ │ ├── dynamic │ │ │ ├── __init__.py │ │ │ ├── filter.py │ │ │ ├── resolution.py │ │ │ ├── max_residues.py │ │ │ ├── size.py │ │ │ ├── subset.py │ │ │ └── date.py │ │ └── static │ │ │ ├── __init__.py │ │ │ ├── filter.py │ │ │ └── ligand.py │ ├── module │ │ └── __init__.py │ ├── msa │ │ └── __init__.py │ ├── parse │ │ ├── __init__.py │ │ ├── yaml.py │ │ ├── csv.py │ │ ├── a3m.py │ │ └── fasta.py │ ├── sample │ │ ├── __init__.py │ │ ├── random.py │ │ ├── sampler.py │ │ └── distillation.py │ ├── write │ │ ├── __init__.py │ │ ├── utils.py │ │ └── pdb.py │ ├── feature │ │ ├── __init__.py │ │ └── pad.py │ └── tokenize │ │ ├── __init__.py │ │ └── tokenizer.py │ ├── model │ ├── __init__.py │ ├── loss │ │ ├── __init__.py │ │ ├── distogram.py │ │ └── diffusion.py │ ├── optim │ │ ├── __init__.py │ │ └── scheduler.py │ ├── layers │ │ ├── __init__.py │ │ ├── triangular_attention │ │ │ ├── __init__.py │ │ │ └── attention.py │ │ ├── dropout.py │ │ ├── transition.py │ │ ├── initialize.py │ │ ├── outer_product_mean.py │ │ ├── attention.py │ │ ├── triangular_mult.py │ │ └── pair_averaging.py │ ├── modules │ │ ├── __init__.py │ │ ├── rna_features.md │ │ └── confidence_utils.py │ └── potentials │ │ └── schedules.py │ └── __init__.py ├── stanford-rna └── preprocessing.ipynb ├── mcp-server ├── .python-version ├── .gitignore ├── pyproject.toml ├── requirements.txt ├── .env.example ├── template │ └── slurm_template.sbatch ├── LICENSE ├── boltz_config.yaml ├── utils │ ├── get_slurm_template.py │ └── adjust_config.py └── boltz_mcp_wrapper.py ├── .DS_Store ├── scripts ├── train │ ├── README.md │ ├── assets │ │ ├── validation_samples │ │ │ ├── merk_challenge_validation_ids.txt │ │ │ └── anti_viral_validation_ids.txt │ │ ├── casp15_ids.txt │ │ ├── test_ids.txt │ │ └── validation_ids.txt │ ├── generate_validation_ids.py │ ├── slurm_scripts │ │ └── parallel_run_finetune_template.sbatch │ └── configs │ │ ├── structure.yaml │ │ ├── full.yaml │ │ └── confidence.yaml ├── process │ ├── requirements.txt │ ├── README.md │ ├── __init__.py │ ├── utils │ │ ├── process_cif_to_fasta.py │ │ ├── collect_a3m_files.py │ │ ├── clean_msa.py │ │ └── merge_processed_data.py │ ├── run_pipeline.py │ ├── cluster.py │ ├── msa.py │ ├── rna │ │ └── rna_example.py │ └── run_pdb_parser.py └── script_utils │ ├── finalize_pdb_outputs.sh │ ├── compile_a3m_files.sh │ ├── extract_fasta_sequences.py │ ├── compile_pdb_structures.sh │ └── compile_pdb_to_manifest.py ├── docs ├── plot_casp.png ├── plot_test.png ├── boltz_title.png ├── boltz1_pred_figure.png ├── evaluation.md └── preprocessing.md ├── examples ├── cyclic_prot.yaml ├── prot.fasta ├── prot.yaml ├── prot_no_msa.yaml ├── prot_custom_msa.yaml ├── multimer.yaml ├── ligand.yaml ├── ligand.fasta └── pocket.yaml ├── tests ├── test_utils.py ├── model │ └── layers │ │ ├── test_triangle_attention.py │ │ └── test_outer_product_mean.py └── test_regression.py ├── dummy_config.yaml ├── slurm_scripts └── run_inference.sbatch ├── LICENSE └── pyproject.toml /src/boltz/data/__init__.py: -------------------------------------------------------------------------------- 1 | -------------------------------------------------------------------------------- /src/boltz/model/__init__.py: -------------------------------------------------------------------------------- 1 | -------------------------------------------------------------------------------- /src/boltz/data/crop/__init__.py: -------------------------------------------------------------------------------- 1 | -------------------------------------------------------------------------------- /src/boltz/data/filter/__init__.py: -------------------------------------------------------------------------------- 1 | -------------------------------------------------------------------------------- /src/boltz/data/module/__init__.py: -------------------------------------------------------------------------------- 1 | -------------------------------------------------------------------------------- /src/boltz/data/msa/__init__.py: -------------------------------------------------------------------------------- 1 | -------------------------------------------------------------------------------- /src/boltz/data/parse/__init__.py: -------------------------------------------------------------------------------- 1 | -------------------------------------------------------------------------------- /src/boltz/data/sample/__init__.py: -------------------------------------------------------------------------------- 1 | -------------------------------------------------------------------------------- /src/boltz/data/write/__init__.py: -------------------------------------------------------------------------------- 1 | -------------------------------------------------------------------------------- /src/boltz/model/loss/__init__.py: -------------------------------------------------------------------------------- 1 | -------------------------------------------------------------------------------- /src/boltz/model/optim/__init__.py: -------------------------------------------------------------------------------- 1 | -------------------------------------------------------------------------------- /stanford-rna/preprocessing.ipynb: -------------------------------------------------------------------------------- 1 | -------------------------------------------------------------------------------- /mcp-server/.python-version: -------------------------------------------------------------------------------- 1 | 3.10 2 | -------------------------------------------------------------------------------- /src/boltz/data/feature/__init__.py: -------------------------------------------------------------------------------- 1 | -------------------------------------------------------------------------------- /src/boltz/data/tokenize/__init__.py: -------------------------------------------------------------------------------- 1 | -------------------------------------------------------------------------------- /src/boltz/model/layers/__init__.py: -------------------------------------------------------------------------------- 1 | -------------------------------------------------------------------------------- /src/boltz/model/modules/__init__.py: -------------------------------------------------------------------------------- 1 | -------------------------------------------------------------------------------- /src/boltz/data/filter/dynamic/__init__.py: -------------------------------------------------------------------------------- 1 | -------------------------------------------------------------------------------- /src/boltz/data/filter/static/__init__.py: -------------------------------------------------------------------------------- 1 | -------------------------------------------------------------------------------- /src/boltz/model/layers/triangular_attention/__init__.py: -------------------------------------------------------------------------------- 1 | -------------------------------------------------------------------------------- /.DS_Store: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/wiwnopgm/boltz-finetune/HEAD/.DS_Store -------------------------------------------------------------------------------- /scripts/train/README.md: -------------------------------------------------------------------------------- 1 | Please see our [training instructions](../../docs/training.md). -------------------------------------------------------------------------------- /scripts/process/requirements.txt: -------------------------------------------------------------------------------- 1 | gemmi 2 | pdbeccdutils 3 | redis 4 | scikit-learn 5 | p_tqdm -------------------------------------------------------------------------------- /docs/plot_casp.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/wiwnopgm/boltz-finetune/HEAD/docs/plot_casp.png -------------------------------------------------------------------------------- /docs/plot_test.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/wiwnopgm/boltz-finetune/HEAD/docs/plot_test.png -------------------------------------------------------------------------------- /scripts/process/README.md: -------------------------------------------------------------------------------- 1 | Please see our [data processing instructions](../../docs/training.md). -------------------------------------------------------------------------------- /docs/boltz_title.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/wiwnopgm/boltz-finetune/HEAD/docs/boltz_title.png -------------------------------------------------------------------------------- /scripts/process/__init__.py: -------------------------------------------------------------------------------- 1 | """Processing tools for protein structure files in PDB and MMCIF formats.""" -------------------------------------------------------------------------------- /docs/boltz1_pred_figure.png: -------------------------------------------------------------------------------- https://raw.githubusercontent.com/wiwnopgm/boltz-finetune/HEAD/docs/boltz1_pred_figure.png -------------------------------------------------------------------------------- /examples/cyclic_prot.yaml: -------------------------------------------------------------------------------- 1 | version: 1 # Optional, defaults to 1 2 | sequences: 3 | - protein: 4 | id: A 5 | sequence: QLEDSEVEAVAKG 6 | cyclic: true 7 | 8 | -------------------------------------------------------------------------------- /examples/prot.fasta: -------------------------------------------------------------------------------- 1 | >A|protein|./examples/msa/seq2.a3m 2 | QLEDSEVEAVAKGLEEMYANGVTEDNFKNYVKNNFAQQEISSVEEELNVNISDSCVANKIKDEFFAMISISAIVKAAQKKAWKELAVTVLRFAKANGLKTNAIIVAGQLALWAVQCG -------------------------------------------------------------------------------- /mcp-server/.gitignore: -------------------------------------------------------------------------------- 1 | # Python-generated files 2 | __pycache__/ 3 | *.py[oc] 4 | build/ 5 | dist/ 6 | wheels/ 7 | *.egg-info 8 | 9 | # Virtual environments 10 | .venv 11 | .env 12 | -------------------------------------------------------------------------------- /mcp-server/pyproject.toml: -------------------------------------------------------------------------------- 1 | [project] 2 | name = "boltz-server" 3 | version = "0.1.0" 4 | description = "Add your description here" 5 | readme = "README.md" 6 | requires-python = ">=3.10" 7 | dependencies = [ 8 | "mcp[cli]>=1.6.0", 9 | ] -------------------------------------------------------------------------------- /src/boltz/__init__.py: -------------------------------------------------------------------------------- 1 | from importlib.metadata import PackageNotFoundError, version 2 | 3 | try: # noqa: SIM105 4 | __version__ = version("boltz") 5 | except PackageNotFoundError: 6 | # package is not installed 7 | pass 8 | -------------------------------------------------------------------------------- /examples/prot.yaml: -------------------------------------------------------------------------------- 1 | version: 1 # Optional, defaults to 1 2 | sequences: 3 | - protein: 4 | id: A 5 | sequence: QLEDSEVEAVAKGLEEMYANGVTEDNFKNYVKNNFAQQEISSVEEELNVNISDSCVANKIKDEFFAMISISAIVKAAQKKAWKELAVTVLRFAKANGLKTNAIIVAGQLALWAVQCG 6 | 7 | -------------------------------------------------------------------------------- /examples/prot_no_msa.yaml: -------------------------------------------------------------------------------- 1 | version: 1 # Optional, defaults to 1 2 | sequences: 3 | - protein: 4 | id: A 5 | sequence: QLEDSEVEAVAKGLEEMYANGVTEDNFKNYVKNNFAQQEISSVEEELNVNISDSCVANKIKDEFFAMISISAIVKAAQKKAWKELAVTVLRFAKANGLKTNAIIVAGQLALWAVQCG 6 | msa: empty 7 | -------------------------------------------------------------------------------- /examples/prot_custom_msa.yaml: -------------------------------------------------------------------------------- 1 | version: 1 # Optional, defaults to 1 2 | sequences: 3 | - protein: 4 | id: A 5 | sequence: QLEDSEVEAVAKGLEEMYANGVTEDNFKNYVKNNFAQQEISSVEEELNVNISDSCVANKIKDEFFAMISISAIVKAAQKKAWKELAVTVLRFAKANGLKTNAIIVAGQLALWAVQCG 6 | msa: ./examples/msa/seq2.a3m 7 | 8 | -------------------------------------------------------------------------------- /scripts/train/assets/validation_samples/merk_challenge_validation_ids.txt: -------------------------------------------------------------------------------- 1 | 7axr 2 | 7b1t 3 | 7eil 4 | 7q3f 5 | 7rui 6 | 7rwq 7 | 7uzn 8 | 7w3d 9 | 7x6t 10 | 7ze6 11 | 7zfs 12 | 7zft 13 | 7zfv 14 | 7zg1 15 | 8k14 16 | 8p9g 17 | 8p9i 18 | 8piq 19 | 8pxm 20 | 8qap 21 | 8r5h 22 | 8rx0 23 | 8wiu 24 | 8yme 25 | 8ymg 26 | 9fwx 27 | -------------------------------------------------------------------------------- /mcp-server/requirements.txt: -------------------------------------------------------------------------------- 1 | streamlit>=1.22.0 2 | pydantic==2.10.6 3 | pydantic-ai==0.0.55 4 | pydantic-ai-slim==0.0.55 5 | pydantic-graph==0.0.55 6 | pydantic-settings==2.8.1 7 | pydantic_core==2.27.2 8 | openai>=1.0.0 9 | python-dotenv>=1.0.0 10 | httpx>=0.24.0 11 | rich>=13.3.0 12 | torch>=2.0.0 13 | pyyaml>=6.0.0 14 | mcp-client>=0.1.0 15 | asyncio>=3.4.3 16 | google-genai -------------------------------------------------------------------------------- /examples/multimer.yaml: -------------------------------------------------------------------------------- 1 | version: 1 # Optional, defaults to 1 2 | sequences: 3 | - protein: 4 | id: A 5 | sequence: MAHHHHHHVAVDAVSFTLLQDQLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLDGSSGSGTPEERLLRAIFGEKA 6 | - protein: 7 | id: B 8 | sequence: MRYAFAAEATTCNAFWRNVDMTVTALYEVPLGVCTQDPDRWTTTPDDEAKTLCRACPRRWLCARDAVESAGAEGLWAGVVIPESGRARAFALGQLRSLAERNGYPVRDHRVSAQSA 9 | -------------------------------------------------------------------------------- /mcp-server/.env.example: -------------------------------------------------------------------------------- 1 | # OpenAI API Configuration for LLM client 2 | LLM_API_KEY=your-api-key-here 3 | MODEL_CHOICE=gpt-4o-mini 4 | BASE_URL=https://api.openai.com/v1 5 | 6 | # Uncomment the following line if you're using Azure OpenAI 7 | # BASE_URL=https://your-deployment-name.openai.azure.com/openai/deployments/your-deployment-id 8 | 9 | # Boltz configuration (optional) 10 | BOLTZ_CACHE_DIR=~/.boltz 11 | REDIS_HOST=localhost 12 | CCD_PORT=7777 13 | TAXONOMY_PORT=7778 14 | 15 | # Gemini API Configuration 16 | GEMINI_API_KEY=your-gemini-api-key-here -------------------------------------------------------------------------------- /mcp-server/template/slurm_template.sbatch: -------------------------------------------------------------------------------- 1 | #!/bin/bash 2 | 3 | #SBATCH --job-name=boltz_training_multi 4 | #SBATCH --output=slurm-%j.out 5 | #SBATCH --error=slurm-%j.err 6 | #SBATCH --nodes=1 7 | #SBATCH --partition=scads-a100 8 | #SBATCH --account=scads 9 | #SBATCH --gres=gpu:2 10 | #SBATCH --mem=192GB 11 | #SBATCH --cpus-per-gpu=6 12 | #SBATCH --time=3-00:00:00 13 | #SBATCH --nice=0 14 | 15 | hostname 16 | nvidia-smi 17 | 18 | # Set environment variables to avoid OOM issues 19 | export PYTORCH_CUDA_ALLOC_CONF=expandable_segments:True 20 | # Removed CUDA_VISIBLE_DEVICES to allow access to all 4 GPUs -------------------------------------------------------------------------------- /src/boltz/data/tokenize/tokenizer.py: -------------------------------------------------------------------------------- 1 | from abc import ABC, abstractmethod 2 | 3 | from boltz.data.types import Input, Tokenized 4 | 5 | 6 | class Tokenizer(ABC): 7 | """Tokenize an input structure for training.""" 8 | 9 | @abstractmethod 10 | def tokenize(self, data: Input) -> Tokenized: 11 | """Tokenize the input data. 12 | 13 | Parameters 14 | ---------- 15 | data : Input 16 | The input data. 17 | 18 | Returns 19 | ------- 20 | Tokenized 21 | The tokenized data. 22 | 23 | """ 24 | raise NotImplementedError 25 | -------------------------------------------------------------------------------- /src/boltz/data/filter/dynamic/filter.py: -------------------------------------------------------------------------------- 1 | from abc import ABC, abstractmethod 2 | 3 | from boltz.data.types import Record 4 | 5 | 6 | class DynamicFilter(ABC): 7 | """Base class for data filters.""" 8 | 9 | @abstractmethod 10 | def filter(self, record: Record) -> bool: 11 | """Filter a data record. 12 | 13 | Parameters 14 | ---------- 15 | record : Record 16 | The object to consider filtering in / out. 17 | 18 | Returns 19 | ------- 20 | bool 21 | True if the data passes the filter, False otherwise. 22 | 23 | """ 24 | raise NotImplementedError 25 | -------------------------------------------------------------------------------- /src/boltz/data/write/utils.py: -------------------------------------------------------------------------------- 1 | import string 2 | from collections.abc import Iterator 3 | 4 | 5 | def generate_tags() -> Iterator[str]: 6 | """Generate chain tags. 7 | 8 | Yields 9 | ------ 10 | str 11 | The next chain tag 12 | 13 | """ 14 | for i in range(1, 4): 15 | for j in range(len(string.ascii_uppercase) ** i): 16 | tag = "" 17 | for k in range(i): 18 | tag += string.ascii_uppercase[ 19 | j 20 | // (len(string.ascii_uppercase) ** k) 21 | % len(string.ascii_uppercase) 22 | ] 23 | yield tag 24 | -------------------------------------------------------------------------------- /tests/test_utils.py: -------------------------------------------------------------------------------- 1 | import os 2 | 3 | import requests 4 | 5 | def download_file(url, filepath, verbose=True): 6 | if verbose: 7 | print(f"Downloading {url} to {filepath}") 8 | response = requests.get(url) 9 | 10 | target_dir = os.path.dirname(filepath) 11 | if target_dir and not os.path.exists(target_dir): 12 | os.makedirs(target_dir) 13 | 14 | # Check if the request was successful 15 | if response.status_code == 200: 16 | with open(filepath, 'wb') as file: 17 | file.write(response.content) 18 | else: 19 | print(f"Failed to download file. Status code: {response.status_code}") 20 | 21 | return filepath 22 | -------------------------------------------------------------------------------- /examples/ligand.yaml: -------------------------------------------------------------------------------- 1 | version: 1 # Optional, defaults to 1 2 | sequences: 3 | - protein: 4 | id: [A, B] 5 | sequence: MVTPEGNVSLVDESLLVGVTDEDRAVRSAHQFYERLIGLWAPAVMEAAHELGVFAALAEAPADSGELARRLDCDARAMRVLLDALYAYDVIDRIHDTNGFRYLLSAEARECLLPGTLFSLVGKFMHDINVAWPAWRNLAEVVRHGARDTSGAESPNGIAQEDYESLVGGINFWAPPIVTTLSRKLRASGRSGDATASVLDVGCGTGLYSQLLLREFPRWTATGLDVERIATLANAQALRLGVEERFATRAGDFWRGGWGTGYDLVLFANIFHLQTPASAVRLMRHAAACLAPDGLVAVVDQIVDADREPKTPQDRFALLFAASMTNTGGGDAYTFQEYEEWFTAAGLQRIETLDTPMHRILLARRATEPSAVPEGQASENLYFQ 6 | msa: ./examples/msa/seq1.a3m 7 | - ligand: 8 | id: [C, D] 9 | ccd: SAH 10 | - ligand: 11 | id: [E, F] 12 | smiles: 'N[C@@H](Cc1ccc(O)cc1)C(=O)O' 13 | -------------------------------------------------------------------------------- /src/boltz/data/filter/static/filter.py: -------------------------------------------------------------------------------- 1 | from abc import ABC, abstractmethod 2 | 3 | import numpy as np 4 | 5 | from boltz.data.types import Structure 6 | 7 | 8 | class StaticFilter(ABC): 9 | """Base class for structure filters.""" 10 | 11 | @abstractmethod 12 | def filter(self, structure: Structure) -> np.ndarray: 13 | """Filter chains in a structure. 14 | 15 | Parameters 16 | ---------- 17 | structure : Structure 18 | The structure to filter chains from. 19 | 20 | Returns 21 | ------- 22 | np.ndarray 23 | The chains to keep, as a boolean mask. 24 | 25 | """ 26 | raise NotImplementedError 27 | -------------------------------------------------------------------------------- /scripts/script_utils/finalize_pdb_outputs.sh: -------------------------------------------------------------------------------- 1 | #!/bin/bash 2 | 3 | # Path to the parsed PDB output directory 4 | OUTPUT_DIR="/ist-nas/users/bunditb/boltz/scripts/examples/parsed_pdb_output" 5 | 6 | # Script to run finalize 7 | FINALIZE_SCRIPT="/ist-nas/users/bunditb/boltz/scripts/command_scripts/run_finalize.py" 8 | 9 | # Activate conda environment 10 | source ~/miniforge3/bin/activate 11 | conda activate boltz 12 | 13 | echo "Running finalize on PDB output directories..." 14 | 15 | # Run the finalize script 16 | python $FINALIZE_SCRIPT --base-dir $OUTPUT_DIR 17 | 18 | # Check if we want to run recursively (if --recursive flag is provided) 19 | if [[ "$1" == "--recursive" ]]; then 20 | echo "Running finalize recursively on all subdirectories..." 21 | python $FINALIZE_SCRIPT --base-dir $OUTPUT_DIR --recursive 22 | fi 23 | 24 | echo "Done!" -------------------------------------------------------------------------------- /scripts/train/assets/casp15_ids.txt: -------------------------------------------------------------------------------- 1 | T1112 2 | T1118v1 3 | T1154 4 | T1137s1 5 | T1188 6 | T1157s1 7 | T1137s6 8 | R1117 9 | H1106 10 | T1106s2 11 | R1149 12 | T1158 13 | T1137s2 14 | T1145 15 | T1121 16 | T1123 17 | T1113 18 | R1156 19 | T1114s1 20 | T1183 21 | R1107 22 | T1137s7 23 | T1124 24 | T1178 25 | T1147 26 | R1128 27 | T1161 28 | R1108 29 | T1194 30 | T1185s2 31 | T1176 32 | T1158v3 33 | T1137s4 34 | T1160 35 | T1120 36 | H1185 37 | T1134s1 38 | T1119 39 | H1151 40 | T1137s8 41 | T1133 42 | T1187 43 | H1157 44 | T1122 45 | T1104 46 | T1158v2 47 | T1137s5 48 | T1129s2 49 | T1174 50 | T1157s2 51 | T1155 52 | T1158v4 53 | T1152 54 | T1137s9 55 | T1134s2 56 | T1125 57 | R1116 58 | H1134 59 | R1136 60 | T1159 61 | T1137s3 62 | T1185s1 63 | T1179 64 | T1106s1 65 | T1132 66 | T1185s4 67 | T1114s3 68 | T1114s2 69 | T1151s2 70 | T1158v1 71 | R1117v2 72 | T1173 73 | -------------------------------------------------------------------------------- /dummy_config.yaml: -------------------------------------------------------------------------------- 1 | # Debug configuration that avoids using ClusterSampler 2 | trainer: 3 | devices: 1 4 | max_epochs: 1 5 | check_val_every_n_epoch: 1 6 | log_every_n_steps: 10 7 | num_sanity_val_steps: 0 8 | precision: 16 9 | 10 | output: output/debug_run 11 | 12 | model: 13 | dtype: bfloat16 14 | use_template_embedder: False 15 | 16 | # Use a minimal data configuration to debug 17 | data: 18 | num_workers: 0 # Use 0 workers to make debugging easier 19 | batch_size: 1 20 | max_tokens: 128 21 | max_atoms: 1024 22 | include_ligands: False 23 | 24 | # Don't use datasets with complex samplers for initial debugging 25 | datasets: [] 26 | 27 | # Direct way to create a dummy dataset for debugging 28 | _target_: boltz.data.module.debug.DummyDataModule 29 | sizes: 30 | - 64 # Sequence length 31 | - 128 # MSA depth 32 | - 64 # Template count 33 | -------------------------------------------------------------------------------- /src/boltz/model/layers/dropout.py: -------------------------------------------------------------------------------- 1 | import torch 2 | from torch import Tensor 3 | 4 | 5 | def get_dropout_mask( 6 | dropout: float, 7 | z: Tensor, 8 | training: bool, 9 | columnwise: bool = False, 10 | ) -> Tensor: 11 | """Get the dropout mask. 12 | 13 | Parameters 14 | ---------- 15 | dropout : float 16 | The dropout rate 17 | z : torch.Tensor 18 | The tensor to apply dropout to 19 | training : bool 20 | Whether the model is in training mode 21 | columnwise : bool, optional 22 | Whether to apply dropout columnwise 23 | 24 | Returns 25 | ------- 26 | torch.Tensor 27 | The dropout mask 28 | 29 | """ 30 | dropout = dropout * training 31 | v = z[:, 0:1, :, 0:1] if columnwise else z[:, :, 0:1, 0:1] 32 | d = torch.rand_like(v) > dropout 33 | d = d * 1.0 / (1.0 - dropout) 34 | return d 35 | -------------------------------------------------------------------------------- /examples/ligand.fasta: -------------------------------------------------------------------------------- 1 | >A|protein|./examples/msa/seq1.a3m 2 | MVTPEGNVSLVDESLLVGVTDEDRAVRSAHQFYERLIGLWAPAVMEAAHELGVFAALAEAPADSGELARRLDCDARAMRVLLDALYAYDVIDRIHDTNGFRYLLSAEARECLLPGTLFSLVGKFMHDINVAWPAWRNLAEVVRHGARDTSGAESPNGIAQEDYESLVGGINFWAPPIVTTLSRKLRASGRSGDATASVLDVGCGTGLYSQLLLREFPRWTATGLDVERIATLANAQALRLGVEERFATRAGDFWRGGWGTGYDLVLFANIFHLQTPASAVRLMRHAAACLAPDGLVAVVDQIVDADREPKTPQDRFALLFAASMTNTGGGDAYTFQEYEEWFTAAGLQRIETLDTPMHRILLARRATEPSAVPEGQASENLYFQ 3 | >B|protein|./examples/msa/seq1.a3m 4 | MVTPEGNVSLVDESLLVGVTDEDRAVRSAHQFYERLIGLWAPAVMEAAHELGVFAALAEAPADSGELARRLDCDARAMRVLLDALYAYDVIDRIHDTNGFRYLLSAEARECLLPGTLFSLVGKFMHDINVAWPAWRNLAEVVRHGARDTSGAESPNGIAQEDYESLVGGINFWAPPIVTTLSRKLRASGRSGDATASVLDVGCGTGLYSQLLLREFPRWTATGLDVERIATLANAQALRLGVEERFATRAGDFWRGGWGTGYDLVLFANIFHLQTPASAVRLMRHAAACLAPDGLVAVVDQIVDADREPKTPQDRFALLFAASMTNTGGGDAYTFQEYEEWFTAAGLQRIETLDTPMHRILLARRATEPSAVPEGQASENLYFQ 5 | >C|ccd 6 | SAH 7 | >D|ccd 8 | SAH 9 | >E|smiles 10 | N[C@@H](Cc1ccc(O)cc1)C(=O)O 11 | >F|smiles 12 | N[C@@H](Cc1ccc(O)cc1)C(=O)O -------------------------------------------------------------------------------- /src/boltz/data/filter/dynamic/resolution.py: -------------------------------------------------------------------------------- 1 | from boltz.data.types import Record 2 | from boltz.data.filter.dynamic.filter import DynamicFilter 3 | 4 | 5 | class ResolutionFilter(DynamicFilter): 6 | """A filter that filters complexes based on their resolution.""" 7 | 8 | def __init__(self, resolution: float = 9.0) -> None: 9 | """Initialize the filter. 10 | 11 | Parameters 12 | ---------- 13 | resolution : float, optional 14 | The maximum allowed resolution. 15 | 16 | """ 17 | self.resolution = resolution 18 | 19 | def filter(self, record: Record) -> bool: 20 | """Filter complexes based on their resolution. 21 | 22 | Parameters 23 | ---------- 24 | record : Record 25 | The record to filter. 26 | 27 | Returns 28 | ------- 29 | bool 30 | Whether the record should be filtered. 31 | 32 | """ 33 | structure = record.structure 34 | return structure.resolution <= self.resolution 35 | -------------------------------------------------------------------------------- /slurm_scripts/run_inference.sbatch: -------------------------------------------------------------------------------- 1 | #!/bin/bash 2 | 3 | #SBATCH --job-name=boltz_inference 4 | #SBATCH --output=slurm-%j.out 5 | #SBATCH --error=slurm-%j.err 6 | #SBATCH --nodes=1 7 | #SBATCH --partition=gpu-4080 8 | #SBATCH --account=scads 9 | #SBATCH --gres=gpu:1 10 | #SBATCH --mem=48GB 11 | #SBATCH --cpus-per-gpu=6 12 | #SBATCH --time=3-00:00:00 13 | #SBATCH --qos=normal 14 | #SBATCH --nice=0 15 | 16 | hostname 17 | nvidia-smi 18 | 19 | 20 | source ~/miniforge3/bin/activate 21 | 22 | source activate /ist-nas/users/bunditb/miniforge3/envs/boltz 23 | 24 | # Set environment variables to avoid OOM issues 25 | export PYTORCH_CUDA_ALLOC_CONF=expandable_segments:True 26 | 27 | # Run the training with SLURM's srun using the multi-GPU config 28 | boltz predict /ist-nas/users/bunditb/boltz/examples/merck_challenge.yaml \ 29 | --out_dir /ist-nas/users/bunditb/boltz/test_results/large_finetune_1 \ 30 | --checkpoint /ist-nas/users/bunditb/.boltz/finetune_lora.ckpt \ 31 | --use_msa_server \ 32 | --recycling_steps 5 \ 33 | --diffusion_samples 250 \ 34 | 35 | # Deactivate the environment 36 | conda deactivate -------------------------------------------------------------------------------- /src/boltz/model/potentials/schedules.py: -------------------------------------------------------------------------------- 1 | import math 2 | from abc import ABC 3 | 4 | class ParameterSchedule(ABC): 5 | def compute(self, t): 6 | raise NotImplementedError 7 | 8 | class ExponentialInterpolation(ParameterSchedule): 9 | def __init__(self, start, end, alpha): 10 | self.start = start 11 | self.end = end 12 | self.alpha = alpha 13 | 14 | def compute(self, t): 15 | if self.alpha != 0: 16 | return self.start + (self.end - self.start) * (math.exp(self.alpha * t) - 1) / (math.exp(self.alpha) - 1) 17 | else: 18 | return self.start + (self.end - self.start) * t 19 | 20 | class PiecewiseStepFunction(ParameterSchedule): 21 | def __init__(self, thresholds, values): 22 | self.thresholds = thresholds 23 | self.values = values 24 | 25 | def compute(self, t): 26 | assert len(self.thresholds) > 0 27 | assert len(self.values) == len(self.thresholds) + 1 28 | 29 | idx = 0 30 | while idx < len(self.thresholds) and t > self.thresholds[idx]: 31 | idx += 1 32 | return self.values[idx] -------------------------------------------------------------------------------- /mcp-server/LICENSE: -------------------------------------------------------------------------------- 1 | MIT License 2 | 3 | Copyright (c) 2025 Nopsinth Vithayapalert 4 | 5 | Permission is hereby granted, free of charge, to any person obtaining a copy 6 | of this software and associated documentation files (the "Software"), to deal 7 | in the Software without restriction, including without limitation the rights 8 | to use, copy, modify, merge, publish, distribute, sublicense, and/or sell 9 | copies of the Software, and to permit persons to whom the Software is 10 | furnished to do so, subject to the following conditions: 11 | 12 | The above copyright notice and this permission notice shall be included in all 13 | copies or substantial portions of the Software. 14 | 15 | THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR 16 | IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, 17 | FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE 18 | AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER 19 | LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, 20 | OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE 21 | SOFTWARE. -------------------------------------------------------------------------------- /examples/pocket.yaml: -------------------------------------------------------------------------------- 1 | sequences: 2 | - protein: 3 | id: [A1] 4 | sequence: MYNMRRLSLSPTFSMGFHLLVTVSLLFSHVDHVIAETEMEGEGNETGECTGSYYCKKGVILPIWEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNGETTKTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMFIIIALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYIILSVISPGVVEVWEGLLTFFFFPICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPSSKTEIEMDGKVVNSHVENFLDGALVLEVDERDQDDEEARREMARILKELKQKHPDKEIEQLIELANYQVLSQQQKSRAFYRIQATRLMTGAGNILKRHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLENCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGDTQKEIRVGIIDDDIFEEDENFLVHLSNVKVSSEASEDGILEANHVSTLACLGSPSTATVTIFDDDHAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKIITIRIFDREEYEKECSFSLVLEEPKWIRRGMKGGFTITDEYDDKQPLTSKEEEERRIAEMGRPILGEHTKLEVIIEESYEFKSTVDKLIKKTNLALVVGTNSWREQFIEAITVSAGEDDDDDECGEEKLPSCFDYVMHFLTVFWKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFIGDLASHFGCTIGLKDSVTAVVFVALGTSVPDTFASKVAATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQFKVSPGTLAFSVTLFTIFAFINVGVLLYRRRPEIGGELGGPRTAKLLTSCLFVLLWLLYIFFSSLEAYCHIKGF 5 | - ligand: 6 | ccd: EKY 7 | id: [B1] 8 | constraints: 9 | - pocket: 10 | binder: B1 11 | contacts: [ [ A1, 829 ], [ A1, 138 ] ] 12 | 13 | -------------------------------------------------------------------------------- /LICENSE: -------------------------------------------------------------------------------- 1 | MIT License 2 | 3 | Copyright (c) 2024 Jeremy Wohlwend, Gabriele Corso, Saro Passaro 4 | 5 | Permission is hereby granted, free of charge, to any person obtaining a copy 6 | of this software and associated documentation files (the "Software"), to deal 7 | in the Software without restriction, including without limitation the rights 8 | to use, copy, modify, merge, publish, distribute, sublicense, and/or sell 9 | copies of the Software, and to permit persons to whom the Software is 10 | furnished to do so, subject to the following conditions: 11 | 12 | The above copyright notice and this permission notice shall be included in all 13 | copies or substantial portions of the Software. 14 | 15 | THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR 16 | IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, 17 | FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE 18 | AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER 19 | LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, 20 | OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE 21 | SOFTWARE. 22 | -------------------------------------------------------------------------------- /mcp-server/boltz_config.yaml: -------------------------------------------------------------------------------- 1 | # Boltz-1 MCP Server Configuration 2 | 3 | # Server settings 4 | server: 5 | name: Boltz-1 Server 6 | description: MCP server for running Boltz-1 protein structure prediction 7 | version: 0.1.0 8 | host: 0.0.0.0 9 | port: 8000 10 | 11 | # Inference settings 12 | inference: 13 | defaults: 14 | checkpoint: ~/.boltz/boltz1_conf.ckpt 15 | recycling_steps: 3 16 | sampling_steps: 200 17 | diffusion_samples: 1 18 | step_scale: 1.638 19 | use_msa_server: false 20 | msa_server_url: https://api.colabfold.com 21 | msa_pairing_strategy: greedy 22 | 23 | # Training settings 24 | training: 25 | default_batch_size: 1 26 | default_learning_rate: 0.0018 27 | default_max_epochs: 10 28 | default_devices: 1 29 | 30 | # Fine-tuning settings 31 | fine_tuning: 32 | method: lora 33 | rank: 8 34 | alpha: 16.0 35 | dropout: 0.0 36 | offload_to_cpu: false 37 | batch_size: 8 38 | learning_rate: 1e-3 39 | weight_decay: 0.0 40 | num_epochs: 5 41 | warmup_steps: 0 42 | 43 | # Example data paths 44 | examples: 45 | fasta: ./examples/example.fasta 46 | yaml: ./examples/example.yaml 47 | train_config: ./examples/train_config.yaml 48 | fine_tune_config: ./examples/fine_tune_config.yaml -------------------------------------------------------------------------------- /src/boltz/data/filter/dynamic/max_residues.py: -------------------------------------------------------------------------------- 1 | from boltz.data.types import Record 2 | from boltz.data.filter.dynamic.filter import DynamicFilter 3 | 4 | 5 | class MaxResiduesFilter(DynamicFilter): 6 | """A filter that filters structures based on their size.""" 7 | 8 | def __init__(self, min_residues: int = 1, max_residues: int = 500) -> None: 9 | """Initialize the filter. 10 | 11 | Parameters 12 | ---------- 13 | min_chains : int 14 | The minimum number of chains allowed. 15 | max_chains : int 16 | The maximum number of chains allowed. 17 | 18 | """ 19 | self.min_residues = min_residues 20 | self.max_residues = max_residues 21 | 22 | def filter(self, record: Record) -> bool: 23 | """Filter structures based on their resolution. 24 | 25 | Parameters 26 | ---------- 27 | record : Record 28 | The record to filter. 29 | 30 | Returns 31 | ------- 32 | bool 33 | Whether the record should be filtered. 34 | 35 | """ 36 | num_residues = sum(chain.num_residues for chain in record.chains) 37 | return num_residues <= self.max_residues and num_residues >= self.min_residues 38 | -------------------------------------------------------------------------------- /src/boltz/data/filter/dynamic/size.py: -------------------------------------------------------------------------------- 1 | from boltz.data.types import Record 2 | from boltz.data.filter.dynamic.filter import DynamicFilter 3 | 4 | 5 | class SizeFilter(DynamicFilter): 6 | """A filter that filters structures based on their size.""" 7 | 8 | def __init__(self, min_chains: int = 1, max_chains: int = 300) -> None: 9 | """Initialize the filter. 10 | 11 | Parameters 12 | ---------- 13 | min_chains : int 14 | The minimum number of chains allowed. 15 | max_chains : int 16 | The maximum number of chains allowed. 17 | 18 | """ 19 | self.min_chains = min_chains 20 | self.max_chains = max_chains 21 | 22 | def filter(self, record: Record) -> bool: 23 | """Filter structures based on their resolution. 24 | 25 | Parameters 26 | ---------- 27 | record : Record 28 | The record to filter. 29 | 30 | Returns 31 | ------- 32 | bool 33 | Whether the record should be filtered. 34 | 35 | """ 36 | num_chains = record.structure.num_chains 37 | num_valid = sum(1 for chain in record.chains if chain.valid) 38 | return num_chains <= self.max_chains and num_valid >= self.min_chains 39 | -------------------------------------------------------------------------------- /src/boltz/data/filter/dynamic/subset.py: -------------------------------------------------------------------------------- 1 | from pathlib import Path 2 | 3 | from boltz.data.types import Record 4 | from boltz.data.filter.dynamic.filter import DynamicFilter 5 | 6 | 7 | class SubsetFilter(DynamicFilter): 8 | """Filter a data record based on a subset of the data.""" 9 | 10 | def __init__(self, subset: str, reverse: bool = False) -> None: 11 | """Initialize the filter. 12 | 13 | Parameters 14 | ---------- 15 | subset : str 16 | The subset of data to consider, one per line. 17 | 18 | """ 19 | with Path(subset).open("r") as f: 20 | subset = f.read().splitlines() 21 | 22 | self.subset = {s.lower() for s in subset} 23 | self.reverse = reverse 24 | 25 | def filter(self, record: Record) -> bool: 26 | """Filter a data record. 27 | 28 | Parameters 29 | ---------- 30 | record : Record 31 | The object to consider filtering in / out. 32 | 33 | Returns 34 | ------- 35 | bool 36 | True if the data passes the filter, False otherwise. 37 | 38 | """ 39 | if self.reverse: 40 | return record.id.lower() not in self.subset 41 | else: # noqa: RET505 42 | return record.id.lower() in self.subset 43 | -------------------------------------------------------------------------------- /src/boltz/data/sample/random.py: -------------------------------------------------------------------------------- 1 | from dataclasses import replace 2 | from typing import Iterator, List 3 | 4 | from numpy.random import RandomState 5 | 6 | from boltz.data.types import Record 7 | from boltz.data.sample.sampler import Sample, Sampler 8 | 9 | 10 | class RandomSampler(Sampler): 11 | """A simple random sampler with replacement.""" 12 | 13 | def sample(self, records: List[Record], random: RandomState) -> Iterator[Sample]: 14 | """Sample a structure from the dataset infinitely. 15 | 16 | Parameters 17 | ---------- 18 | records : List[Record] 19 | The records to sample from. 20 | random : RandomState 21 | The random state for reproducibility. 22 | 23 | Yields 24 | ------ 25 | Sample 26 | A data sample. 27 | 28 | """ 29 | while True: 30 | # Sample item from the list 31 | index = random.randint(0, len(records)) 32 | record = records[index] 33 | 34 | # Remove invalid chains and interfaces 35 | chains = [c for c in record.chains if c.valid] 36 | interfaces = [i for i in record.interfaces if i.valid] 37 | record = replace(record, chains=chains, interfaces=interfaces) 38 | 39 | yield Sample(record=record) 40 | -------------------------------------------------------------------------------- /src/boltz/data/sample/sampler.py: -------------------------------------------------------------------------------- 1 | from abc import ABC, abstractmethod 2 | from dataclasses import dataclass 3 | from typing import Iterator, List, Optional 4 | 5 | from numpy.random import RandomState 6 | 7 | from boltz.data.types import Record 8 | 9 | 10 | @dataclass 11 | class Sample: 12 | """A sample with optional chain and interface IDs. 13 | 14 | Attributes 15 | ---------- 16 | record : Record 17 | The record. 18 | chain_id : Optional[int] 19 | The chain ID. 20 | interface_id : Optional[int] 21 | The interface ID. 22 | """ 23 | 24 | record: Record 25 | chain_id: Optional[int] = None 26 | interface_id: Optional[int] = None 27 | 28 | 29 | class Sampler(ABC): 30 | """Abstract base class for samplers.""" 31 | 32 | @abstractmethod 33 | def sample(self, records: List[Record], random: RandomState) -> Iterator[Sample]: 34 | """Sample a structure from the dataset infinitely. 35 | 36 | Parameters 37 | ---------- 38 | records : List[Record] 39 | The records to sample from. 40 | random : RandomState 41 | The random state for reproducibility. 42 | 43 | Yields 44 | ------ 45 | Sample 46 | A data sample. 47 | 48 | """ 49 | raise NotImplementedError 50 | -------------------------------------------------------------------------------- /tests/model/layers/test_triangle_attention.py: -------------------------------------------------------------------------------- 1 | import pytorch_lightning 2 | import torch 3 | import torch.nn as nn 4 | 5 | import unittest 6 | 7 | from boltz.model.layers.triangular_attention.attention import TriangleAttention 8 | 9 | 10 | class OuterProductMeanTest(unittest.TestCase): 11 | def setUp(self): 12 | self.c_in = 128 13 | self.c_hidden = 32 14 | self.no_heads = 1 15 | 16 | torch.set_grad_enabled(False) 17 | pytorch_lightning.seed_everything(1100) 18 | self.layer = TriangleAttention(self.c_in, self.c_hidden, self.no_heads) 19 | 20 | # Initialize layer 21 | for name, param in self.layer.named_parameters(): 22 | nn.init.normal_(param, mean=1., std=1.) 23 | 24 | 25 | def test_chunk(self): 26 | chunk_sizes = [16, 33, 64, 100] 27 | B, N = 1, 99 28 | m = torch.randn(size=(B, N, N, self.c_in)) 29 | mask = torch.randint(low=0, high=1, size=(B, N, N)) 30 | 31 | with torch.no_grad(): 32 | exp_output = self.layer(x=m, mask=mask) 33 | for chunk_size in chunk_sizes: 34 | with self.subTest(chunk_size=chunk_size): 35 | act_output = self.layer(x=m, mask=mask, chunk_size=chunk_size) 36 | assert torch.allclose(exp_output, act_output, atol=1e-8) -------------------------------------------------------------------------------- /src/boltz/data/crop/cropper.py: -------------------------------------------------------------------------------- 1 | from abc import ABC, abstractmethod 2 | from typing import Optional 3 | 4 | import numpy as np 5 | 6 | from boltz.data.types import Tokenized 7 | 8 | 9 | class Cropper(ABC): 10 | """Abstract base class for cropper.""" 11 | 12 | @abstractmethod 13 | def crop( 14 | self, 15 | data: Tokenized, 16 | max_tokens: int, 17 | random: np.random.RandomState, 18 | max_atoms: Optional[int] = None, 19 | chain_id: Optional[int] = None, 20 | interface_id: Optional[int] = None, 21 | ) -> Tokenized: 22 | """Crop the data to a maximum number of tokens. 23 | 24 | Parameters 25 | ---------- 26 | data : Tokenized 27 | The tokenized data. 28 | max_tokens : int 29 | The maximum number of tokens to crop. 30 | random : np.random.RandomState 31 | The random state for reproducibility. 32 | max_atoms : Optional[int] 33 | The maximum number of atoms to consider. 34 | chain_id : Optional[int] 35 | The chain ID to crop. 36 | interface_id : Optional[int] 37 | The interface ID to crop. 38 | 39 | Returns 40 | ------- 41 | Tokenized 42 | The cropped data. 43 | 44 | """ 45 | raise NotImplementedError 46 | -------------------------------------------------------------------------------- /tests/model/layers/test_outer_product_mean.py: -------------------------------------------------------------------------------- 1 | import pytorch_lightning 2 | import torch 3 | import torch.nn as nn 4 | 5 | import unittest 6 | 7 | from boltz.model.layers.outer_product_mean import OuterProductMean 8 | 9 | 10 | class OuterProductMeanTest(unittest.TestCase): 11 | def setUp(self): 12 | self.c_in = 32 13 | self.c_hidden = 16 14 | self.c_out = 64 15 | 16 | torch.set_grad_enabled(False) 17 | pytorch_lightning.seed_everything(1100) 18 | self.layer = OuterProductMean(self.c_in, self.c_hidden, self.c_out) 19 | 20 | # Initialize layer 21 | for name, param in self.layer.named_parameters(): 22 | nn.init.normal_(param, mean=1., std=1.) 23 | 24 | # Set to eval mode 25 | self.layer.eval() 26 | 27 | def test_chunk(self): 28 | chunk_sizes = [16, 33, 64, 83, 100] 29 | B, S, N = 1, 49, 84 30 | m = torch.randn(size=(B, S, N, self.c_in)) 31 | mask = torch.randint(low=0, high=1, size=(B, S, N)) 32 | 33 | with torch.no_grad(): 34 | exp_output = self.layer(m=m, mask=mask) 35 | for chunk_size in chunk_sizes: 36 | with self.subTest(chunk_size=chunk_size): 37 | act_output = self.layer(m=m, mask=mask, chunk_size=chunk_size) 38 | assert torch.allclose(exp_output, act_output, atol=1e-8) -------------------------------------------------------------------------------- /scripts/script_utils/compile_a3m_files.sh: -------------------------------------------------------------------------------- 1 | #!/bin/bash 2 | 3 | # Set source and destination directories 4 | SOURCE_DIR="/ist-nas/users/bunditb/boltz/scripts/examples/colabfold_output" 5 | DEST_DIR="/ist-nas/users/bunditb/boltz/scripts/examples/compiled_a3m_files" 6 | 7 | # Create destination directory if it doesn't exist 8 | mkdir -p "$DEST_DIR" 9 | 10 | echo "Searching for a3m files in $SOURCE_DIR" 11 | 12 | # Count the number of a3m files 13 | A3M_FILES=($(find "$SOURCE_DIR" -name "*.a3m")) 14 | TOTAL_FILES=${#A3M_FILES[@]} 15 | echo "Found $TOTAL_FILES a3m files to process" 16 | 17 | # Counter for successful copies 18 | COPIED=0 19 | 20 | # Process each a3m file 21 | for a3m_file in "${A3M_FILES[@]}"; do 22 | # Get the base filename 23 | base_name=$(basename "$a3m_file") 24 | 25 | # Remove the "mpro-" prefix if it exists 26 | new_name="${base_name#mpro-}" 27 | 28 | # Copy to destination with the new name 29 | cp "$a3m_file" "$DEST_DIR/$new_name" 30 | 31 | # Check if copy was successful 32 | if [ $? -eq 0 ]; then 33 | ((COPIED++)) 34 | echo "Copied: $base_name → $new_name" 35 | else 36 | echo "Failed to copy: $a3m_file" 37 | fi 38 | done 39 | 40 | echo "Successfully compiled $COPIED/$TOTAL_FILES a3m files" 41 | echo "Files saved to: $DEST_DIR" 42 | 43 | # List the contents of the destination directory 44 | echo "Contents of destination directory:" 45 | ls -la "$DEST_DIR" -------------------------------------------------------------------------------- /src/boltz/model/loss/distogram.py: -------------------------------------------------------------------------------- 1 | from typing import Dict, Tuple 2 | 3 | import torch 4 | from torch import Tensor 5 | 6 | 7 | def distogram_loss( 8 | output: Dict[str, Tensor], 9 | feats: Dict[str, Tensor], 10 | ) -> Tuple[Tensor, Tensor]: 11 | """Compute the distogram loss. 12 | 13 | Parameters 14 | ---------- 15 | output : Dict[str, Tensor] 16 | Output of the model 17 | feats : Dict[str, Tensor] 18 | Input features 19 | 20 | Returns 21 | ------- 22 | Tensor 23 | The globally averaged loss. 24 | Tensor 25 | Per example loss. 26 | 27 | """ 28 | # Get predicted distograms 29 | pred = output["pdistogram"] 30 | 31 | # Compute target distogram 32 | target = feats["disto_target"] 33 | 34 | # Combine target mask and padding mask 35 | mask = feats["token_disto_mask"] 36 | mask = mask[:, None, :] * mask[:, :, None] 37 | mask = mask * (1 - torch.eye(mask.shape[1])[None]).to(pred) 38 | 39 | # Compute the distogram loss 40 | errors = -1 * torch.sum( 41 | target * torch.nn.functional.log_softmax(pred, dim=-1), 42 | dim=-1, 43 | ) 44 | denom = 1e-5 + torch.sum(mask, dim=(-1, -2)) 45 | mean = errors * mask 46 | mean = torch.sum(mean, dim=-1) 47 | mean = mean / denom[..., None] 48 | batch_loss = torch.sum(mean, dim=-1) 49 | global_loss = torch.mean(batch_loss) 50 | return global_loss, batch_loss 51 | -------------------------------------------------------------------------------- /src/boltz/data/parse/yaml.py: -------------------------------------------------------------------------------- 1 | from pathlib import Path 2 | 3 | import yaml 4 | from rdkit.Chem.rdchem import Mol 5 | 6 | from boltz.data.parse.schema import parse_boltz_schema 7 | from boltz.data.types import Target 8 | 9 | 10 | def parse_yaml(path: Path, ccd: dict[str, Mol]) -> Target: 11 | """Parse a Boltz input yaml / json. 12 | 13 | The input file should be a yaml file with the following format: 14 | 15 | sequences: 16 | - protein: 17 | id: A 18 | sequence: "MADQLTEEQIAEFKEAFSLF" 19 | - protein: 20 | id: [B, C] 21 | sequence: "AKLSILPWGHC" 22 | - rna: 23 | id: D 24 | sequence: "GCAUAGC" 25 | - ligand: 26 | id: E 27 | smiles: "CC1=CC=CC=C1" 28 | - ligand: 29 | id: [F, G] 30 | ccd: [] 31 | constraints: 32 | - bond: 33 | atom1: [A, 1, CA] 34 | atom2: [A, 2, N] 35 | - pocket: 36 | binder: E 37 | contacts: [[B, 1], [B, 2]] 38 | version: 1 39 | 40 | Parameters 41 | ---------- 42 | path : Path 43 | Path to the YAML input format. 44 | components : Dict 45 | Dictionary of CCD components. 46 | 47 | Returns 48 | ------- 49 | Target 50 | The parsed target. 51 | 52 | """ 53 | with path.open("r") as file: 54 | data = yaml.safe_load(file) 55 | 56 | name = path.stem 57 | return parse_boltz_schema(name, data, ccd) 58 | -------------------------------------------------------------------------------- /src/boltz/model/modules/rna_features.md: -------------------------------------------------------------------------------- 1 | Core inputs required: 2 | feats = { 3 | # Single sequence features 4 | "nuc_type": torch.Tensor, # [batch, seq_len, 4] - One-hot encoded nucleotides 5 | "profile": torch.Tensor, # [batch, seq_len, profile_dim] - Evolutionary profile 6 | "deletion_mean": torch.Tensor, # [batch, seq_len] - Mean deletion values 7 | 8 | # MSA features 9 | "rna_msa": torch.Tensor, # [batch, num_seqs, seq_len, rna_tokens] - Multiple sequence alignment 10 | "has_deletion": torch.Tensor, # [batch, num_seqs, seq_len] - Binary deletion indicator 11 | "deletion_value": torch.Tensor, # [batch, num_seqs, seq_len] - Deletion values in alignment 12 | "msa_mask": torch.Tensor, # [batch, num_seqs, seq_len] - Mask for valid MSA entries 13 | 14 | # Masking 15 | "token_pad_mask": torch.Tensor, # [batch, seq_len] - Sequence padding mask 16 | 17 | # Required if use_paired_feature=True (default) 18 | "msa_paired": torch.Tensor, # [batch, num_seqs, seq_len] - Paired positions indicator 19 | 20 | # Required if use_secondary_structure=True (default) 21 | "stem_prob": torch.Tensor, # [batch, num_seqs, seq_len] - Probability in stem 22 | "loop_prob": torch.Tensor, # [batch, num_seqs, seq_len] - Probability in loop 23 | "bulge_prob": torch.Tensor, # [batch, num_seqs, seq_len] - Probability in bulge 24 | 25 | # Optional but recommended 26 | "sec_structure": torch.Tensor, # [batch, seq_len, structure_dim] - Secondary structure encoding 27 | } -------------------------------------------------------------------------------- /mcp-server/utils/get_slurm_template.py: -------------------------------------------------------------------------------- 1 | from typing import List 2 | import os 3 | 4 | def get_slurm_template(template_path: str): 5 | """ 6 | Returns a template for a SLURM job script for training with multiple GPUs. 7 | Reads the template from the slurm_template.sbatch file. 8 | 9 | Returns: 10 | str: A string containing the SLURM script template 11 | """ 12 | # Read the template file 13 | with open(template_path, 'r') as f: 14 | return f.read() 15 | 16 | def write_slurm_script(template, output_path): 17 | """ 18 | Writes a SLURM template to a .sbatch file. 19 | 20 | Args: 21 | template (str): The SLURM template string 22 | output_path (str): Path where the .sbatch file should be written 23 | 24 | Returns: 25 | str: The path to the written file 26 | """ 27 | # Ensure the output path has the .sbatch extension 28 | if not output_path.endswith('.sbatch'): 29 | output_path += '.sbatch' 30 | 31 | # Create the directory if it doesn't exist 32 | os.makedirs(os.path.dirname(os.path.abspath(output_path)), exist_ok=True) 33 | 34 | # Write the template to the file 35 | with open(output_path, 'w') as f: 36 | f.write(template) 37 | 38 | # Make the file executable 39 | return output_path 40 | 41 | def get_slurm_script_with_command(template_path: str, commands: List[str], output_path: str): 42 | """ 43 | Returns a SLURM template with a custom command added at the bottom. 44 | 45 | Args: 46 | command (str): The command to add to the template 47 | 48 | Returns: 49 | str: The SLURM template with the command added 50 | """ 51 | template = get_slurm_template(template_path) 52 | slurm_script = template + "\n\n" + "\n\n".join(commands) 53 | write_slurm_script(slurm_script, output_path) -------------------------------------------------------------------------------- /src/boltz/data/sample/distillation.py: -------------------------------------------------------------------------------- 1 | from typing import Iterator, List 2 | 3 | from numpy.random import RandomState 4 | 5 | from boltz.data.types import Record 6 | from boltz.data.sample.sampler import Sample, Sampler 7 | 8 | 9 | class DistillationSampler(Sampler): 10 | """A sampler for monomer distillation data.""" 11 | 12 | def __init__(self, small_size: int = 200, small_prob: float = 0.01) -> None: 13 | """Initialize the sampler. 14 | 15 | Parameters 16 | ---------- 17 | small_size : int, optional 18 | The maximum size to be considered small. 19 | small_prob : float, optional 20 | The probability of sampling a small item. 21 | 22 | """ 23 | self._size = small_size 24 | self._prob = small_prob 25 | 26 | def sample(self, records: List[Record], random: RandomState) -> Iterator[Sample]: 27 | """Sample a structure from the dataset infinitely. 28 | 29 | Parameters 30 | ---------- 31 | records : List[Record] 32 | The records to sample from. 33 | random : RandomState 34 | The random state for reproducibility. 35 | 36 | Yields 37 | ------ 38 | Sample 39 | A data sample. 40 | 41 | """ 42 | # Remove records with invalid chains 43 | records = [r for r in records if r.chains[0].valid] 44 | 45 | # Split in small and large proteins. We assume that there is only 46 | # one chain per record, as is the case for monomer distillation 47 | small = [r for r in records if r.chains[0].num_residues <= self._size] 48 | large = [r for r in records if r.chains[0].num_residues > self._size] 49 | 50 | # Sample infinitely 51 | while True: 52 | # Sample small or large 53 | samples = small if random.rand() < self._prob else large 54 | 55 | # Sample item from the list 56 | index = random.randint(0, len(samples)) 57 | yield Sample(record=samples[index]) 58 | -------------------------------------------------------------------------------- /scripts/script_utils/extract_fasta_sequences.py: -------------------------------------------------------------------------------- 1 | #!/usr/bin/env python3 2 | 3 | import os 4 | import glob 5 | import re 6 | 7 | # Path to the ligand-posing directory (using absolute path) 8 | base_dir = "/ist-nas/users/bunditb/boltz/scripts/examples/raw_data_package/ligand-posing" 9 | 10 | # Output directory 11 | output_dir = "/ist-nas/users/bunditb/boltz/scripts/examples/compiled_fasta_files" 12 | 13 | # Find all protein.fasta files in subdirectories 14 | fasta_files = glob.glob(os.path.join(base_dir, "**/protein.fasta"), recursive=True) 15 | print(f"Found {len(fasta_files)} protein.fasta files") 16 | 17 | # Process each fasta file 18 | for fasta_file in fasta_files: 19 | print(f"Processing {fasta_file}") 20 | 21 | with open(fasta_file, 'r') as f: 22 | content = f.read() 23 | 24 | # Split the file content by '>' to get individual sequences 25 | sequences = content.split('>') 26 | sequences = [seq for seq in sequences if seq.strip()] # Remove empty strings 27 | 28 | # Process each sequence 29 | for seq in sequences: 30 | lines = seq.strip().split('\n') 31 | header = lines[0] 32 | sequence_data = '\n'.join(lines[1:]) 33 | 34 | # Extract just the identifier part for the filename 35 | # Example: from "Mpro-J0050_0B_A" we want "J0050_0B_A" 36 | parts = header.split('-') 37 | if len(parts) > 1: 38 | # If the header has a hyphen, use the part after the first hyphen 39 | identifier = parts[1] 40 | # Remove any unwanted characters 41 | identifier = re.sub(r'[^\w_]', '', identifier) 42 | filename = f"{identifier}.fasta" 43 | else: 44 | # If there's no hyphen, use the whole header but sanitize it 45 | identifier = re.sub(r'[^\w_]', '', header) 46 | filename = f"{identifier}.fasta" 47 | 48 | output_path = os.path.join(output_dir, filename) 49 | 50 | with open(output_path, 'w') as f: 51 | f.write(f">{header}\n{sequence_data}\n") 52 | print(f"Saved {header} to {output_path}") 53 | 54 | print(f"Completed. All sequences have been saved to individual files.") -------------------------------------------------------------------------------- /scripts/train/generate_validation_ids.py: -------------------------------------------------------------------------------- 1 | import os 2 | import random 3 | import argparse 4 | from pathlib import Path 5 | 6 | def generate_validation_ids(data_dir, output_file, prob=0.2): 7 | """ 8 | Generate validation IDs from .cif files in the data directory. 9 | 10 | Args: 11 | data_dir (str): Directory containing .cif files 12 | output_file (str): Path to save validation IDs 13 | prob (float): Probability of selecting each ID (default: 0.2) 14 | """ 15 | # Convert to Path objects 16 | data_dir = Path(data_dir) 17 | output_file = Path(output_file) 18 | 19 | # Get all .cif files 20 | cif_files = [f for f in os.listdir(data_dir) if f.endswith('.cif')] 21 | 22 | # Extract PDB IDs (remove .cif extension) 23 | pdb_ids = [os.path.splitext(f)[0] for f in cif_files] 24 | 25 | # Select IDs based on probability 26 | selected_ids = [pdb_id for pdb_id in pdb_ids if random.random() < prob] 27 | 28 | # Sort the IDs for consistency 29 | selected_ids.sort() 30 | 31 | # Create output directory if it doesn't exist 32 | output_file.parent.mkdir(parents=True, exist_ok=True) 33 | 34 | # Write to file 35 | with open(output_file, 'w') as f: 36 | for pdb_id in selected_ids: 37 | f.write(f"{pdb_id}\n") 38 | 39 | print(f"Generated {len(selected_ids)} validation IDs in {output_file}") 40 | print(f"Total available IDs: {len(pdb_ids)}") 41 | print(f"Selection probability: {prob}") 42 | 43 | def main(): 44 | parser = argparse.ArgumentParser(description='Generate validation IDs from .cif files') 45 | parser.add_argument('--data_dir', type=str, required=True, 46 | help='Directory containing .cif files') 47 | parser.add_argument('--output_file', type=str, required=True, 48 | help='Path to save validation IDs') 49 | parser.add_argument('--prob', type=float, default=0.2, 50 | help='Probability of selecting each ID (default: 0.2)') 51 | 52 | args = parser.parse_args() 53 | generate_validation_ids(args.data_dir, args.output_file, args.prob) 54 | 55 | if __name__ == '__main__': 56 | main() -------------------------------------------------------------------------------- /scripts/train/assets/validation_samples/anti_viral_validation_ids.txt: -------------------------------------------------------------------------------- 1 | p0010_0a 2 | p0808_0b 3 | p2468_0b 4 | p0764_0a 5 | p2203_0b 6 | x11764_0a 7 | p0845_0a 8 | p3054_0a 9 | x11346_0a 10 | p0075_0b 11 | x10488_0a 12 | x1002_0a 13 | p1858_0a 14 | x3359_0a 15 | p2197_0b 16 | x1458_0a 17 | p3074_0b 18 | p0135_0b 19 | p2178_0a 20 | x12136_0a 21 | x0305_0a 22 | p0187_0a 23 | z7au4_0a 24 | j0071_0a 25 | p0143_0a 26 | p0017_0b 27 | x11204_0a 28 | z7l11_0a 29 | x1226_0a 30 | x12171_0a 31 | x11789_0a 32 | x10248_0a 33 | p2039_0a 34 | p2099_0b 35 | x3115_0a 36 | x10800_0a 37 | x0195_0a 38 | x0678_0a 39 | x2971_0a 40 | p2011_0a 41 | p2144_0b 42 | x12350_0a 43 | x11025_0a 44 | x1358_0a 45 | p2067_0a 46 | p2207_0a 47 | p2141_0a 48 | x11831_0a 49 | z7kvl_0a 50 | x0104_0a 51 | x11812_0a 52 | p2113_0a 53 | x0425_0a 54 | x12064_0a 55 | p0069_0a 56 | x10559_0a 57 | x1308_0a 58 | p1982_0a 59 | p2649_0a 60 | x10638_0a 61 | x11368_0a 62 | x10610_0a 63 | x10856_0a 64 | x0770_0a 65 | p2205_0a 66 | x2562_0a 67 | x2703_0a 68 | p2005_0a 69 | x10484_0a 70 | x0072_0a 71 | p1079_0b 72 | p2605_0a 73 | x11852_0a 74 | p2147_0b 75 | j0076_0a 76 | p0764_0b 77 | p2203_0a 78 | p2036_0a 79 | x11427_0a 80 | p0091_0a 81 | x10535_0a 82 | p2229_0a 83 | x10787_0a 84 | x12735_0a 85 | sars-cov-2-mpro-reference 86 | x10466_0a 87 | x11590_0a 88 | x10604_0a 89 | x11011_0a 90 | p0607_0a 91 | x1402_0a 92 | x0991_0a 93 | p1015_0b 94 | x10327_0a 95 | p0154_0a 96 | x12699_0a 97 | x12731_0a 98 | x10296_0a 99 | x11271_0a 100 | x0434_0a 101 | x11208_0a 102 | p1835_0a 103 | p1982_0b 104 | x10789_0a 105 | p0243_0b 106 | x3303_0a 107 | x11508_0a 108 | p0061_0b 109 | z7o46_0a 110 | p1079_0a 111 | x1380_0a 112 | z7b2j_0a 113 | x11612_0a 114 | p0904_0a 115 | p1701_0b 116 | x12202_0a 117 | x11513_0a 118 | x12080_0a 119 | x10565_0a 120 | p0950_0b 121 | x11493_0a 122 | x11318_0a 123 | j0050_0b 124 | x0161_0a 125 | p0950_0a 126 | p1978_0b 127 | p2660_0b 128 | p2031_0b 129 | p2385_0a 130 | x10049_0a 131 | x12740_0a 132 | p2487_0a 133 | x10889_0a 134 | x11548_0a 135 | x10324_0a 136 | x2097_0a 137 | x10598_0a 138 | p0777_0a 139 | x10422_0a 140 | p0872_0a 141 | p2099_0a 142 | x11809_0a 143 | j0013_0a 144 | p0098_0a 145 | x11540_0a 146 | x0336_0a 147 | p2007_0a 148 | p2185_0a 149 | x10371_0a 150 | p0075_0a 151 | x10237_0a 152 | x12710_0a 153 | x10322_0a 154 | x3077_0a -------------------------------------------------------------------------------- /src/boltz/data/filter/dynamic/date.py: -------------------------------------------------------------------------------- 1 | from datetime import datetime 2 | from typing import Literal 3 | 4 | from boltz.data.types import Record 5 | from boltz.data.filter.dynamic.filter import DynamicFilter 6 | 7 | 8 | class DateFilter(DynamicFilter): 9 | """A filter that filters complexes based on their date. 10 | 11 | The date can be the deposition, release, or revision date. 12 | If the date is not available, the previous date is used. 13 | 14 | If no date is available, the complex is rejected. 15 | 16 | """ 17 | 18 | def __init__( 19 | self, 20 | date: str, 21 | ref: Literal["deposited", "revised", "released"], 22 | ) -> None: 23 | """Initialize the filter. 24 | 25 | Parameters 26 | ---------- 27 | date : str, optional 28 | The maximum date of PDB entries to filter 29 | ref : Literal["deposited", "revised", "released"] 30 | The reference date to use. 31 | 32 | """ 33 | self.filter_date = datetime.fromisoformat(date) 34 | self.ref = ref 35 | 36 | if ref not in ["deposited", "revised", "released"]: 37 | msg = ( 38 | "Invalid reference date. Must be ", 39 | "deposited, revised, or released", 40 | ) 41 | raise ValueError(msg) 42 | 43 | def filter(self, record: Record) -> bool: 44 | """Filter a record based on its date. 45 | 46 | Parameters 47 | ---------- 48 | record : Record 49 | The record to filter. 50 | 51 | Returns 52 | ------- 53 | bool 54 | Whether the record should be filtered. 55 | 56 | """ 57 | structure = record.structure 58 | 59 | if self.ref == "deposited": 60 | date = structure.deposited 61 | elif self.ref == "released": 62 | date = structure.released 63 | if not date: 64 | date = structure.deposited 65 | elif self.ref == "revised": 66 | date = structure.revised 67 | if not date and structure.released: 68 | date = structure.released 69 | elif not date: 70 | date = structure.deposited 71 | 72 | if date is None or date == "": 73 | return False 74 | 75 | date = datetime.fromisoformat(date) 76 | return date <= self.filter_date 77 | -------------------------------------------------------------------------------- /src/boltz/data/feature/pad.py: -------------------------------------------------------------------------------- 1 | import torch 2 | from torch import Tensor 3 | from torch.nn.functional import pad 4 | 5 | 6 | def pad_dim(data: Tensor, dim: int, pad_len: float, value: float = 0) -> Tensor: 7 | """Pad a tensor along a given dimension. 8 | 9 | Parameters 10 | ---------- 11 | data : Tensor 12 | The input tensor. 13 | dim : int 14 | The dimension to pad. 15 | pad_len : float 16 | The padding length. 17 | value : int, optional 18 | The value to pad with. 19 | 20 | Returns 21 | ------- 22 | Tensor 23 | The padded tensor. 24 | 25 | """ 26 | if pad_len == 0: 27 | return data 28 | 29 | total_dims = len(data.shape) 30 | padding = [0] * (2 * (total_dims - dim)) 31 | padding[2 * (total_dims - 1 - dim) + 1] = pad_len 32 | return pad(data, tuple(padding), value=value) 33 | 34 | 35 | def pad_to_max(data: list[Tensor], value: float = 0) -> tuple[Tensor, Tensor]: 36 | """Pad the data in all dimensions to the maximum found. 37 | 38 | Parameters 39 | ---------- 40 | data : List[Tensor] 41 | List of tensors to pad. 42 | value : float 43 | The value to use for padding. 44 | 45 | Returns 46 | ------- 47 | Tensor 48 | The padded tensor. 49 | Tensor 50 | The padding mask. 51 | 52 | """ 53 | if isinstance(data[0], str): 54 | return data, 0 55 | 56 | # Check if all have the same shape 57 | if all(d.shape == data[0].shape for d in data): 58 | return torch.stack(data, dim=0), 0 59 | 60 | # Get the maximum in each dimension 61 | num_dims = len(data[0].shape) 62 | max_dims = [max(d.shape[i] for d in data) for i in range(num_dims)] 63 | 64 | # Get the padding lengths 65 | pad_lengths = [] 66 | for d in data: 67 | dims = [] 68 | for i in range(num_dims): 69 | dims.append(0) 70 | dims.append(max_dims[num_dims - i - 1] - d.shape[num_dims - i - 1]) 71 | pad_lengths.append(dims) 72 | 73 | # Pad the data 74 | padding = [ 75 | pad(torch.ones_like(d), pad_len, value=0) 76 | for d, pad_len in zip(data, pad_lengths) 77 | ] 78 | data = [pad(d, pad_len, value=value) for d, pad_len in zip(data, pad_lengths)] 79 | 80 | # Stack the data 81 | padding = torch.stack(padding, dim=0) 82 | data = torch.stack(data, dim=0) 83 | 84 | return data, padding 85 | -------------------------------------------------------------------------------- /scripts/train/slurm_scripts/parallel_run_finetune_template.sbatch: -------------------------------------------------------------------------------- 1 | #!/bin/bash 2 | 3 | #SBATCH --job-name=${JOB_NAME:-boltz_training_array} 4 | #SBATCH --output=${SLURM_OUTPUT_DIR:-slurm-%A_%a.out} 5 | #SBATCH --error=${SLURM_ERROR_DIR:-slurm-%A_%a.err} 6 | #SBATCH --nodes=1 7 | #SBATCH --partition=${SLURM_PARTITION:-scads-a100} 8 | #SBATCH --account=${SLURM_ACCOUNT:-scads} 9 | #SBATCH --gres=gpu:${NUM_GPUS:-2} 10 | #SBATCH --mem=${MEMORY:-192GB} 11 | #SBATCH --cpus-per-gpu=${CPUS_PER_GPU:-6} 12 | #SBATCH --time=${TIME_LIMIT:-3-00:00:00} 13 | #SBATCH --nice=0 14 | #SBATCH --array=0-${ARRAY_SIZE:-8} 15 | 16 | # Define the parameter values - customize these arrays as needed 17 | declare -a PARAM1_VALUES=(${PARAM1_VALUES:-0.3 0.5 0.7}) 18 | declare -a PARAM2_VALUES=(${PARAM2_VALUES:-1 2 4}) 19 | declare -a PARAM3_VALUES=(${PARAM3_VALUES:-0.001 0.0018 0.002}) 20 | 21 | # Calculate indices for the current array task 22 | PARAM1_IDX=$((SLURM_ARRAY_TASK_ID % ${#PARAM1_VALUES[@]})) 23 | PARAM2_IDX=$((SLURM_ARRAY_TASK_ID / ${#PARAM1_VALUES[@]} % ${#PARAM2_VALUES[@]})) 24 | PARAM3_IDX=$((SLURM_ARRAY_TASK_ID / (${#PARAM1_VALUES[@]} * ${#PARAM2_VALUES[@]}) % ${#PARAM3_VALUES[@]})) 25 | 26 | # Get the actual values 27 | PARAM1=${PARAM1_VALUES[$PARAM1_IDX]} 28 | PARAM2=${PARAM2_VALUES[$PARAM2_IDX]} 29 | PARAM3=${PARAM3_VALUES[$PARAM3_IDX]} 30 | 31 | # Print job information 32 | echo "Job ID: $SLURM_JOB_ID" 33 | echo "Array Task ID: $SLURM_ARRAY_TASK_ID" 34 | echo "Parameter 1: $PARAM1" 35 | echo "Parameter 2: $PARAM2" 36 | echo "Parameter 3: $PARAM3" 37 | 38 | hostname 39 | nvidia-smi 40 | 41 | # Activate the conda environment 42 | source ${CONDA_PATH:-~/mambaforge}/bin/activate ${CONDA_ENV:-boltz} 43 | 44 | # Set environment variables to avoid OOM issues 45 | export PYTORCH_CUDA_ALLOC_CONF=expandable_segments:True 46 | 47 | # Print current working directory 48 | echo "Current working directory: $(pwd)" 49 | 50 | # Change to the project directory 51 | cd ${PROJECT_DIR:-.} 52 | 53 | # Create output directory for this specific run 54 | OUTPUT_DIR="${OUTPUT_BASE_DIR:-./output}/param1_${PARAM1}_param2_${PARAM2}_param3_${PARAM3}" 55 | mkdir -p $OUTPUT_DIR 56 | 57 | # Run the training with the specific parameters 58 | python ${TRAIN_SCRIPT:-scripts/train/train.py} ${CONFIG_FILE:-scripts/train/configs/full_finetune.yaml} \ 59 | ${PARAM1_PATH:-data.param1}=${PARAM1} \ 60 | ${PARAM2_PATH:-data.param2}=${PARAM2} \ 61 | ${PARAM3_PATH:-model.param3}=${PARAM3} \ 62 | output=${OUTPUT_DIR} \ 63 | debug=${DEBUG:-1} 64 | 65 | # Deactivate the environment 66 | conda deactivate -------------------------------------------------------------------------------- /src/boltz/model/layers/transition.py: -------------------------------------------------------------------------------- 1 | from typing import Optional 2 | 3 | from torch import Tensor, nn 4 | 5 | import boltz.model.layers.initialize as init 6 | 7 | 8 | class Transition(nn.Module): 9 | """Perform a two-layer MLP.""" 10 | 11 | def __init__( 12 | self, 13 | dim: int = 128, 14 | hidden: int = 512, 15 | out_dim: Optional[int] = None, 16 | ) -> None: 17 | """Initialize the TransitionUpdate module. 18 | 19 | Parameters 20 | ---------- 21 | dim: int 22 | The dimension of the input, default 128 23 | hidden: int 24 | The dimension of the hidden, default 512 25 | out_dim: Optional[int] 26 | The dimension of the output, default None 27 | 28 | """ 29 | super().__init__() 30 | if out_dim is None: 31 | out_dim = dim 32 | 33 | self.norm = nn.LayerNorm(dim, eps=1e-5) 34 | self.fc1 = nn.Linear(dim, hidden, bias=False) 35 | self.fc2 = nn.Linear(dim, hidden, bias=False) 36 | self.fc3 = nn.Linear(hidden, out_dim, bias=False) 37 | self.silu = nn.SiLU() 38 | self.hidden = hidden 39 | 40 | init.bias_init_one_(self.norm.weight) 41 | init.bias_init_zero_(self.norm.bias) 42 | 43 | init.lecun_normal_init_(self.fc1.weight) 44 | init.lecun_normal_init_(self.fc2.weight) 45 | init.final_init_(self.fc3.weight) 46 | 47 | def forward(self, x: Tensor, chunk_size: int = None) -> Tensor: 48 | """Perform a forward pass. 49 | 50 | Parameters 51 | ---------- 52 | x: torch.Tensor 53 | The input data of shape (..., D) 54 | 55 | Returns 56 | ------- 57 | x: torch.Tensor 58 | The output data of shape (..., D) 59 | 60 | """ 61 | x = self.norm(x) 62 | 63 | if chunk_size is None or self.training: 64 | x = self.silu(self.fc1(x)) * self.fc2(x) 65 | x = self.fc3(x) 66 | return x 67 | else: 68 | # Compute in chunks 69 | for i in range(0, self.hidden, chunk_size): 70 | fc1_slice = self.fc1.weight[i : i + chunk_size, :] 71 | fc2_slice = self.fc2.weight[i : i + chunk_size, :] 72 | fc3_slice = self.fc3.weight[:, i : i + chunk_size] 73 | x_chunk = self.silu((x @ fc1_slice.T)) * (x @ fc2_slice.T) 74 | if i == 0: 75 | x_out = x_chunk @ fc3_slice.T 76 | else: 77 | x_out = x_out + x_chunk @ fc3_slice.T 78 | return x_out 79 | -------------------------------------------------------------------------------- /pyproject.toml: -------------------------------------------------------------------------------- 1 | [build-system] 2 | requires = ["setuptools >= 61.0"] 3 | build-backend = "setuptools.build_meta" 4 | 5 | [project] 6 | name = "boltz" 7 | version = "1.0.0" 8 | requires-python = ">=3.10" 9 | description = "Boltz-1" 10 | readme = "README.md" 11 | dependencies = [ 12 | "torch>=2.2", 13 | "numpy==1.26.3", 14 | "hydra-core==1.3.2", 15 | "pytorch-lightning==2.4.0", 16 | "rdkit>=2024.3.2", 17 | "dm-tree==0.1.8", 18 | "requests==2.32.3", 19 | "pandas>=2.2.2", 20 | "types-requests", 21 | "einops==0.8.0", 22 | "einx==0.3.0", 23 | "fairscale==0.4.13", 24 | "mashumaro==3.14", 25 | "modelcif==1.2", 26 | "wandb==0.18.7", 27 | "click==8.1.7", 28 | "pyyaml==6.0.2", 29 | "biopython==1.84", 30 | "scipy==1.13.1", 31 | "trifast>=0.1.11", 32 | "numba==0.61.0", 33 | ] 34 | 35 | [project.scripts] 36 | boltz = "boltz.main:cli" 37 | 38 | [project.optional-dependencies] 39 | lint = ["ruff"] 40 | test = ["pytest", "requests"] 41 | 42 | [tool.ruff] 43 | src = ["src"] 44 | extend-exclude = ["conf.py"] 45 | target-version = "py39" 46 | lint.select = ["ALL"] 47 | lint.ignore = [ 48 | "COM812", # Conflicts with the formatter 49 | "ISC001", # Conflicts with the formatter 50 | "ANN101", # "missing-type-self" 51 | "RET504", # Unnecessary assignment to `x` before `return` statementRuff 52 | "S101", # Use of `assert` detected 53 | "D100", # Missing docstring in public module 54 | "D104", # Missing docstring in public package 55 | "PT001", # https://github.com/astral-sh/ruff/issues/8796#issuecomment-1825907715 56 | "PT004", # https://github.com/astral-sh/ruff/issues/8796#issuecomment-1825907715 57 | "PT005", # https://github.com/astral-sh/ruff/issues/8796#issuecomment-1825907715 58 | "PT023", # https://github.com/astral-sh/ruff/issues/8796#issuecomment-1825907715 59 | "FBT001", 60 | "FBT002", 61 | "PLR0913", # Too many arguments to init (> 5) 62 | ] 63 | 64 | [tool.ruff.lint.per-file-ignores] 65 | "**/__init__.py" = [ 66 | "F401", # Imported but unused 67 | "F403", # Wildcard imports 68 | ] 69 | "docs/**" = [ 70 | "INP001", # Requires __init__.py but folder is not a package. 71 | ] 72 | "scripts/**" = [ 73 | "INP001", # Requires __init__.py but folder is not a package. 74 | ] 75 | 76 | [tool.ruff.lint.pyupgrade] 77 | # Preserve types, even if a file imports `from __future__ import annotations`(https://github.com/astral-sh/ruff/issues/5434) 78 | keep-runtime-typing = true 79 | 80 | [tool.ruff.lint.pydocstyle] 81 | convention = "numpy" 82 | 83 | [tool.pytest.ini_options] 84 | markers = [ 85 | "slow: marks tests as slow (deselect with '-m \"not slow\"')", 86 | "regression", 87 | ] 88 | -------------------------------------------------------------------------------- /mcp-server/utils/adjust_config.py: -------------------------------------------------------------------------------- 1 | import yaml 2 | import sys 3 | from pathlib import Path 4 | 5 | 6 | def set_nested_value(d, path, value): 7 | """Set a value in a nested dictionary using a dot-separated path. 8 | 9 | Args: 10 | d: The dictionary to modify 11 | path: Dot-separated path to the value (e.g., 'trainer.learning_rate') 12 | value: The value to set 13 | 14 | Returns: 15 | The modified dictionary 16 | """ 17 | keys = path.split('.') 18 | for key in keys[:-1]: 19 | if key not in d: 20 | d[key] = {} 21 | d = d[key] 22 | 23 | # Convert value to appropriate type 24 | if value.lower() == 'true': 25 | value = True 26 | elif value.lower() == 'false': 27 | value = False 28 | elif value.lower() == 'null': 29 | value = None 30 | else: 31 | # Try to convert to number if possible 32 | try: 33 | if '.' in value: 34 | value = float(value) 35 | else: 36 | value = int(value) 37 | except ValueError: 38 | pass 39 | 40 | d[keys[-1]] = value 41 | return d 42 | 43 | 44 | def adjust_config(config_path, modifications): 45 | """Modify a YAML configuration file with the specified modifications. 46 | 47 | Args: 48 | config_path: Path to the original configuration file 49 | modifications: Dictionary of parameter paths and new values 50 | output_path: Path to save the modified configuration (if None, overwrites original) 51 | 52 | Returns: 53 | True if successful, False otherwise 54 | """ 55 | # Load the configuration 56 | try: 57 | with open(config_path, 'r') as f: 58 | config = yaml.safe_load(f) 59 | return [set_nested_value(config, param_path, new_value) for param_path, new_value in modifications.items()] 60 | except Exception as e: 61 | print(f"Error adjusting configuration: {str(e)}") 62 | return None 63 | 64 | if __name__ == "__main__": 65 | # Example usage from command line 66 | if len(sys.argv) < 3: 67 | print("Usage: python adjust_config.py [param2=value2 ...]") 68 | sys.exit(1) 69 | 70 | config_path = sys.argv[1] 71 | output_path = sys.argv[2] 72 | 73 | # Parse modifications from command line arguments 74 | modifications = {} 75 | for arg in sys.argv[3:]: 76 | if '=' in arg: 77 | param, value = arg.split('=', 1) 78 | modifications[param] = value 79 | 80 | # Adjust the configuration 81 | success = adjust_config(config_path, modifications, output_path) 82 | sys.exit(0 if success else 1) 83 | -------------------------------------------------------------------------------- /scripts/process/utils/process_cif_to_fasta.py: -------------------------------------------------------------------------------- 1 | #!/usr/bin/env python 2 | """ 3 | Process CIF files to extract PDB IDs, fetch FASTA sequences, and save them in a single folder. 4 | 5 | This script: 6 | 1. Reads all CIF files from the specified directory 7 | 2. Extracts the PDB ID from each filename 8 | 3. Fetches the FASTA sequence using the RCSB PDB API 9 | 4. Saves all FASTA sequences in a single folder with uppercase filenames 10 | """ 11 | 12 | import os 13 | import re 14 | import requests 15 | import time 16 | from pathlib import Path 17 | from tqdm import tqdm 18 | 19 | def fetch_fasta(pdb_id): 20 | """Fetch FASTA sequence directly from RCSB PDB API.""" 21 | url = f"https://www.rcsb.org/fasta/entry/{pdb_id}" 22 | response = requests.get(url) 23 | 24 | if response.status_code == 200: 25 | return response.text 26 | else: 27 | print(f"Error fetching FASTA for {pdb_id}: HTTP {response.status_code}") 28 | return None 29 | 30 | def extract_pdb_id(filename): 31 | """Extract PDB ID from filename.""" 32 | # Remove file extension and any additional text in parentheses 33 | base_name = os.path.splitext(filename)[0] 34 | # Remove any text in parentheses 35 | base_name = re.sub(r'\s*\([^)]*\)', '', base_name) 36 | # Convert to uppercase 37 | return base_name.upper() 38 | 39 | def process_cif_files(cif_dir, output_dir): 40 | """Process all CIF files in the directory.""" 41 | # Create output directory if it doesn't exist 42 | os.makedirs(output_dir, exist_ok=True) 43 | 44 | # Get all CIF files 45 | cif_files = [f for f in os.listdir(cif_dir) if f.endswith('.cif')] 46 | 47 | print(f"Found {len(cif_files)} CIF files to process") 48 | 49 | # Process each CIF file 50 | for cif_file in tqdm(cif_files, desc="Processing CIF files"): 51 | # Extract PDB ID 52 | pdb_id = extract_pdb_id(cif_file) 53 | 54 | # Fetch FASTA sequence 55 | fasta_content = fetch_fasta(pdb_id) 56 | 57 | if fasta_content: 58 | # Save FASTA content to file in the output directory 59 | fasta_file = os.path.join(output_dir, f"{pdb_id}.fasta") 60 | with open(fasta_file, 'w') as f: 61 | f.write(fasta_content) 62 | 63 | # Add a small delay to avoid overwhelming the API 64 | time.sleep(0.5) 65 | 66 | if __name__ == "__main__": 67 | # Define directories 68 | cif_dir = "/ist-nas/users/bunditb/boltz/scripts/merk_challenge/FKBP_binder" 69 | output_dir = "/ist-nas/users/bunditb/boltz/scripts/merk_challenge/FKBP_binder/protein_sequences/fasta_files" 70 | 71 | # Process CIF files 72 | process_cif_files(cif_dir, output_dir) 73 | 74 | print("Processing complete!") -------------------------------------------------------------------------------- /docs/evaluation.md: -------------------------------------------------------------------------------- 1 | # Evaluation 2 | 3 | To encourage reproducibility and facilitate comparison with other models, we provide the evaluation scripts and predictions for Boltz-1, Chai-1, and AlphaFold3 on our test benchmark dataset as well as CASP15. These datasets are created to contain biomolecules different from the training data and to benchmark the performance of these models we run them with the same input MSAs and the same number of recycling and diffusion steps. 4 | 5 | ![Test set evaluations](../docs/plot_test.png) 6 | ![CASP15 set evaluations](../docs/plot_casp.png) 7 | 8 | 9 | ## Evaluation files 10 | 11 | You can download all the MSAs, input files, output files and evaluation outputs for Boltz-1, Boltz-1x, Chai-1, and AlphaFold3 from this [Google Drive folder](https://drive.google.com/file/d/1JvHlYUMINOaqPTunI9wBYrfYniKgVmxf/view?usp=sharing). 12 | 13 | The files are organized as follows: 14 | 15 | ``` 16 | boltz_results_final/ 17 | ├── inputs/ # Input files for every model 18 | ├── casp15/ 19 | ├── af3 20 | ├── boltz 21 | ├── boltzx 22 | ├── chai 23 | └── msa 24 | └── test/ 25 | ├── targets/ # Target files from PDB 26 | ├── casp15 27 | └── test 28 | ├── outputs/ # Output files for every model 29 | ├── casp15 30 | └── test 31 | ├── evals/ # Output of evluation script for every 32 | ├── casp15 33 | └── test 34 | ├── results_casp.csv # Summary of evaluation results for CASP15 35 | └── results_test.csv # Summary of evaluation results for test set 36 | ``` 37 | 38 | ## Evaluation setup 39 | 40 | We evaluate the model on two datasets: 41 | - PDB test set: 541 targets after our validation cut-off date and at most 40% sequence similarity for proteins, 80% Tanimoto for ligands. 42 | - CASP15: 66 difficult targets from the CASP 2022 competition. 43 | 44 | We benchmark Boltz-1 against Chai-1 and AF3, other state-of-the-art structure prediction models, but much more closed source in terms of model code, training and data pipeline. Note that we remove overlap with our validation set, but we cannot ensure that there is no overlap with AF3 or Chai-1 validation set as those were not published. 45 | 46 | For fair comparison we compare the models with the following setup: 47 | - Same MSA’s. 48 | - Same parameters: 10 recycling steps, 200 sampling steps, 5 samples. 49 | - We compare our oracle and top-1 numbers among the 5 samples. 50 | 51 | 52 | ## Evaluation script 53 | 54 | We also provide the scripts we used to evaluate the models and aggregate results. The evaluations were run through [OpenStructure](https://openstructure.org/docs/2.9.0/) version 2.8.0 (it is important to use the specific version for reproducing the results). You can find these scripts at `scripts/eval/run_evals.py` and `scripts/eval/aggregate_evals.py`. -------------------------------------------------------------------------------- /scripts/process/utils/collect_a3m_files.py: -------------------------------------------------------------------------------- 1 | #!/usr/bin/env python3 2 | 3 | import os 4 | import shutil 5 | import argparse 6 | from pathlib import Path 7 | 8 | def collect_a3m_files(source_dir, output_dir): 9 | """ 10 | Collect uniref.a3m files from source directory and its subdirectories. 11 | Rename them to lowercase PDB IDs. 12 | 13 | Args: 14 | source_dir (str): Source directory containing the PDB folders 15 | output_dir (str): Output directory for collected files 16 | """ 17 | # Convert to Path objects 18 | source_dir = Path(source_dir) 19 | output_dir = Path(output_dir) 20 | 21 | # Create output directory if it doesn't exist 22 | output_dir.mkdir(parents=True, exist_ok=True) 23 | 24 | # Keep track of statistics 25 | total_files = 0 26 | processed_pdbs = set() 27 | 28 | # Walk through all subdirectories 29 | for root, dirs, files in os.walk(source_dir): 30 | # Get the PDB_id from the path 31 | path_parts = Path(root).parts 32 | # Find the PDB ID (it's the folder name that matches the pattern of 4 characters followed by a number) 33 | pdb_id = None 34 | for part in path_parts: 35 | if len(part) >= 4 and part[0].isdigit() and part[1:4].isalnum(): 36 | pdb_id = part[:4] # Take just the first 4 characters (e.g., "7P6Y") 37 | break 38 | 39 | if pdb_id and 'uniref.a3m' in files: 40 | # Source file path 41 | source_file = os.path.join(root, 'uniref.a3m') 42 | # Destination file path (using lowercase PDB_id) 43 | dest_file = os.path.join(output_dir, f"{pdb_id.lower()}.a3m") 44 | 45 | # Copy the file with the new name 46 | print(f"Copying {source_file} to {dest_file}") 47 | shutil.copy2(source_file, dest_file) 48 | total_files += 1 49 | processed_pdbs.add(pdb_id) 50 | 51 | print("\nCollection complete!") 52 | print(f"Total uniref.a3m files collected: {total_files}") 53 | print(f"Unique PDB IDs processed: {len(processed_pdbs)}") 54 | print(f"Output directory: {output_dir}") 55 | 56 | def main(): 57 | # Set up argument parser 58 | parser = argparse.ArgumentParser(description='Collect uniref.a3m files and rename them to lowercase PDB IDs.') 59 | parser.add_argument('--input_dir', type=str, required=True, 60 | help='Source directory containing the PDB folders') 61 | parser.add_argument('--output_dir', type=str, required=True, 62 | help='Output directory for collected files') 63 | 64 | # Parse arguments 65 | args = parser.parse_args() 66 | 67 | # Collect the files 68 | collect_a3m_files(args.input_dir, args.output_dir) 69 | 70 | if __name__ == '__main__': 71 | main() -------------------------------------------------------------------------------- /src/boltz/model/layers/initialize.py: -------------------------------------------------------------------------------- 1 | """Utility functions for initializing weights and biases.""" 2 | 3 | # Copyright 2021 AlQuraishi Laboratory 4 | # Copyright 2021 DeepMind Technologies Limited 5 | # 6 | # Licensed under the Apache License, Version 2.0 (the "License"); 7 | # you may not use this file except in compliance with the License. 8 | # You may obtain a copy of the License at 9 | # 10 | # http://www.apache.org/licenses/LICENSE-2.0 11 | # 12 | # Unless required by applicable law or agreed to in writing, software 13 | # distributed under the License is distributed on an "AS IS" BASIS, 14 | # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. 15 | # See the License for the specific language governing permissions and 16 | # limitations under the License. 17 | 18 | import math 19 | import numpy as np 20 | from scipy.stats import truncnorm 21 | import torch 22 | 23 | 24 | def _prod(nums): 25 | out = 1 26 | for n in nums: 27 | out = out * n 28 | return out 29 | 30 | 31 | def _calculate_fan(linear_weight_shape, fan="fan_in"): 32 | fan_out, fan_in = linear_weight_shape 33 | 34 | if fan == "fan_in": 35 | f = fan_in 36 | elif fan == "fan_out": 37 | f = fan_out 38 | elif fan == "fan_avg": 39 | f = (fan_in + fan_out) / 2 40 | else: 41 | raise ValueError("Invalid fan option") 42 | 43 | return f 44 | 45 | 46 | def trunc_normal_init_(weights, scale=1.0, fan="fan_in"): 47 | shape = weights.shape 48 | f = _calculate_fan(shape, fan) 49 | scale = scale / max(1, f) 50 | a = -2 51 | b = 2 52 | std = math.sqrt(scale) / truncnorm.std(a=a, b=b, loc=0, scale=1) 53 | size = _prod(shape) 54 | samples = truncnorm.rvs(a=a, b=b, loc=0, scale=std, size=size) 55 | samples = np.reshape(samples, shape) 56 | with torch.no_grad(): 57 | weights.copy_(torch.tensor(samples, device=weights.device)) 58 | 59 | 60 | def lecun_normal_init_(weights): 61 | trunc_normal_init_(weights, scale=1.0) 62 | 63 | 64 | def he_normal_init_(weights): 65 | trunc_normal_init_(weights, scale=2.0) 66 | 67 | 68 | def glorot_uniform_init_(weights): 69 | torch.nn.init.xavier_uniform_(weights, gain=1) 70 | 71 | 72 | def final_init_(weights): 73 | with torch.no_grad(): 74 | weights.fill_(0.0) 75 | 76 | 77 | def gating_init_(weights): 78 | with torch.no_grad(): 79 | weights.fill_(0.0) 80 | 81 | 82 | def bias_init_zero_(bias): 83 | with torch.no_grad(): 84 | bias.fill_(0.0) 85 | 86 | 87 | def bias_init_one_(bias): 88 | with torch.no_grad(): 89 | bias.fill_(1.0) 90 | 91 | 92 | def normal_init_(weights): 93 | torch.nn.init.kaiming_normal_(weights, nonlinearity="linear") 94 | 95 | 96 | def ipa_point_weights_init_(weights): 97 | with torch.no_grad(): 98 | softplus_inverse_1 = 0.541324854612918 99 | weights.fill_(softplus_inverse_1) 100 | -------------------------------------------------------------------------------- /src/boltz/data/parse/csv.py: -------------------------------------------------------------------------------- 1 | from pathlib import Path 2 | from typing import Optional 3 | 4 | import numpy as np 5 | import pandas as pd 6 | 7 | from boltz.data import const 8 | from boltz.data.types import MSA, MSADeletion, MSAResidue, MSASequence 9 | 10 | 11 | def parse_csv( 12 | path: Path, 13 | max_seqs: Optional[int] = None, 14 | ) -> MSA: 15 | """Process an A3M file. 16 | 17 | Parameters 18 | ---------- 19 | path : Path 20 | The path to the a3m(.gz) file. 21 | max_seqs : int, optional 22 | The maximum number of sequences. 23 | 24 | Returns 25 | ------- 26 | MSA 27 | The MSA object. 28 | 29 | """ 30 | # Read file 31 | data = pd.read_csv(path) 32 | 33 | # Check columns 34 | if tuple(sorted(data.columns)) != ("key", "sequence"): 35 | msg = "Invalid CSV format, expected columns: ['sequence', 'key']" 36 | raise ValueError(msg) 37 | 38 | # Create taxonomy mapping 39 | visited = set() 40 | sequences = [] 41 | deletions = [] 42 | residues = [] 43 | 44 | seq_idx = 0 45 | for line, key in zip(data["sequence"], data["key"]): 46 | line: str 47 | line = line.strip() # noqa: PLW2901 48 | if not line: 49 | continue 50 | 51 | # Get taxonomy, if annotated 52 | taxonomy_id = -1 53 | if (str(key) != "nan") and (key is not None) and (key != ""): 54 | taxonomy_id = key 55 | 56 | # Skip if duplicate sequence 57 | str_seq = line.replace("-", "").upper() 58 | if str_seq not in visited: 59 | visited.add(str_seq) 60 | else: 61 | continue 62 | 63 | # Process sequence 64 | residue = [] 65 | deletion = [] 66 | count = 0 67 | res_idx = 0 68 | for c in line: 69 | if c != "-" and c.islower(): 70 | count += 1 71 | continue 72 | token = const.prot_letter_to_token[c] 73 | token = const.token_ids[token] 74 | residue.append(token) 75 | if count > 0: 76 | deletion.append((res_idx, count)) 77 | count = 0 78 | res_idx += 1 79 | 80 | res_start = len(residues) 81 | res_end = res_start + len(residue) 82 | 83 | del_start = len(deletions) 84 | del_end = del_start + len(deletion) 85 | 86 | sequences.append((seq_idx, taxonomy_id, res_start, res_end, del_start, del_end)) 87 | residues.extend(residue) 88 | deletions.extend(deletion) 89 | 90 | seq_idx += 1 91 | if (max_seqs is not None) and (seq_idx >= max_seqs): 92 | break 93 | 94 | # Create MSA object 95 | msa = MSA( 96 | residues=np.array(residues, dtype=MSAResidue), 97 | deletions=np.array(deletions, dtype=MSADeletion), 98 | sequences=np.array(sequences, dtype=MSASequence), 99 | ) 100 | return msa 101 | -------------------------------------------------------------------------------- /scripts/process/run_pipeline.py: -------------------------------------------------------------------------------- 1 | #!/usr/bin/env python3 2 | 3 | import argparse 4 | import subprocess 5 | from pathlib import Path 6 | 7 | def run_command(cmd, description): 8 | """Run a command and handle errors.""" 9 | print(f"\n{description}...") 10 | print(f"Running command: {' '.join(cmd)}") 11 | 12 | result = subprocess.run(cmd, check=True) 13 | 14 | if result.returncode != 0: 15 | raise RuntimeError(f"Command failed with return code {result.returncode}") 16 | 17 | print(f"{description} completed successfully") 18 | 19 | def main(): 20 | parser = argparse.ArgumentParser(description="Run the processing pipeline") 21 | parser.add_argument("--data_dir", type=Path, required=True, 22 | help="Directory containing CIF/PDB files") 23 | parser.add_argument("--msa_dir", type=Path, required=True, 24 | help="Directory containing MSA files") 25 | parser.add_argument("--output_dir", type=Path, required=True, 26 | help="Base directory for output") 27 | parser.add_argument("--redis_host", type=str, default="localhost", 28 | help="Redis host (default: localhost)") 29 | parser.add_argument("--ccd_port", type=int, default=7777, 30 | help="Port for CCD Redis server (default: 7777)") 31 | parser.add_argument("--taxonomy_port", type=int, default=7778, 32 | help="Port for taxonomy Redis server (default: 7778)") 33 | parser.add_argument("--num_processes", type=int, default=4, 34 | help="Number of processes to use (default: 4)") 35 | parser.add_argument("--max_seqs", type=int, default=1000, 36 | help="Maximum number of sequences to process (default: 1000)") 37 | 38 | args = parser.parse_args() 39 | 40 | # Get the absolute path to the scripts directory 41 | script_dir = Path(__file__).parent.absolute() 42 | 43 | # Create output directories 44 | structures_output_dir = args.output_dir / "processed_structures" 45 | msa_output_dir = args.output_dir / "processed_msa" 46 | structures_output_dir.mkdir(parents=True, exist_ok=True) 47 | msa_output_dir.mkdir(parents=True, exist_ok=True) 48 | 49 | # Process structures using CCD Redis server 50 | run_command( 51 | ["python", str(script_dir / "rcsb.py"), 52 | "--datadir", str(args.data_dir), 53 | "--outdir", str(structures_output_dir), 54 | "--redis-host", args.redis_host, 55 | "--redis-port", str(args.ccd_port)], 56 | "Processing CIF/PDB files" 57 | ) 58 | 59 | # Process MSA files using taxonomy Redis server 60 | run_command( 61 | ["python", str(script_dir / "msa.py"), 62 | "--msadir", str(args.msa_dir), 63 | "--outdir", str(msa_output_dir), 64 | "--redis-host", args.redis_host, 65 | "--redis-port", str(args.taxonomy_port), 66 | "--max-seqs", str(args.max_seqs)], 67 | "Processing MSA files" 68 | ) 69 | 70 | print("\nPipeline completed successfully!") 71 | print(f"Processed structures saved to: {structures_output_dir}") 72 | print(f"Processed MSA files saved to: {msa_output_dir}") 73 | 74 | if __name__ == "__main__": 75 | main() 76 | -------------------------------------------------------------------------------- /docs/preprocessing.md: -------------------------------------------------------------------------------- 1 | # Structure Processing Module 2 | 3 | This module provides tools for parsing and processing protein and RNA structures from various file formats. 4 | 5 | For detailed data processing instructions, please see our [data processing guide](../../docs/training.md). 6 | 7 | ## Overview 8 | 9 | The module includes parsers for multiple file formats: 10 | 11 | - `mmcif.py`: Parses MMCIF formatted files 12 | - `pdb.py`: Parses PDB formatted files and CSV files containing 3D coordinates 13 | - `rcsb.py`: Main entry point that determines the appropriate parser based on file extension 14 | 15 | ## Protein Structure Parsing 16 | 17 | ### Parser Selection 18 | 19 | - **For MMCIF/CIF/PDB formatted input**: Use `rcsb.py` as the main entry point 20 | - **For CSV formatted input containing 3D coordinates**: Convert to PDB structure format first 21 | 22 | ### Extracted Information 23 | 24 | Both parsers extract the following information: 25 | - Atom coordinates, elements, and properties 26 | - Bonds between atoms 27 | - Residue information 28 | - Chain information 29 | - Interface detection between chains 30 | - Metadata (resolution, deposition date, etc.) 31 | 32 | ### Usage 33 | 34 | The `rcsb.py` script automatically detects file formats based on extensions: 35 | - `.pdb` for PDB files 36 | - `.cif*` for MMCIF files 37 | 38 | ```bash 39 | # Process a directory of structures 40 | python -m boltz.scripts.process.rcsb --datadir /path/to/mmcif_or_pdb_files --outdir /path/to/output 41 | ``` 42 | 43 | ## RNA Structure Parsing 44 | 45 | The `pdb.py` module includes specialized functionality for parsing RNA structures from various sources. 46 | 47 | ### Standard PDB Files 48 | - The `parse_pdb()` function can handle RNA structures in standard PDB format 49 | - RNA chains are identified by their polymer type (Rna) 50 | - Standard RNA residues (A, C, G, U) are processed automatically 51 | - Non-standard RNA residues require entries in the components dictionary 52 | 53 | ### CSV Dataset 54 | - The `convert_csv_to_pdb()` function specifically handles RNA structures from the Stanford RNA dataset 55 | - It reads sequence and coordinate information from CSV files 56 | - Coordinates are converted to PDB format for processing 57 | - Supports both standard and non-standard RNA residues 58 | 59 | ### RNA-Specific Processing 60 | - RNA structures are identified by their polymer type 61 | - One-letter codes are used for sequence representation (A, C, G, U) 62 | - Special handling for RNA-specific atoms and bonds 63 | - Support for RNA modifications and non-standard bases 64 | 65 | ### Coordinate Handling 66 | - RNA coordinates are typically provided as phosphate positions 67 | - The `prepare_rna_from_csv()` function converts these to PDB format 68 | - Missing coordinates are handled gracefully with appropriate error messages 69 | 70 | ### Error Handling 71 | - Invalid RNA structures raise ValueError with descriptive messages 72 | - Missing components are reported and skipped 73 | - Coordinate parsing errors are caught and reported 74 | 75 | ### Usage Example 76 | 77 | To parse an RNA structure from the Stanford RNA dataset: 78 | 79 | ```python 80 | from boltz.scripts.process.pdb import convert_csv_to_pdb 81 | 82 | # Parse an RNA structure 83 | rna_structure = convert_csv_to_pdb( 84 | rna_id="1SCL_A", 85 | components=components_dict, 86 | csv_path="/path/to/train_labels.csv", 87 | seq_csv_path="/path/to/train_sequences.csv" 88 | ) 89 | ``` -------------------------------------------------------------------------------- /src/boltz/data/filter/static/ligand.py: -------------------------------------------------------------------------------- 1 | import numpy as np 2 | 3 | from boltz.data import const 4 | from boltz.data.types import Structure 5 | from boltz.data.filter.static.filter import StaticFilter 6 | 7 | LIGAND_EXCLUSION = { 8 | "144", 9 | "15P", 10 | "1PE", 11 | "2F2", 12 | "2JC", 13 | "3HR", 14 | "3SY", 15 | "7N5", 16 | "7PE", 17 | "9JE", 18 | "AAE", 19 | "ABA", 20 | "ACE", 21 | "ACN", 22 | "ACT", 23 | "ACY", 24 | "AZI", 25 | "BAM", 26 | "BCN", 27 | "BCT", 28 | "BDN", 29 | "BEN", 30 | "BME", 31 | "BO3", 32 | "BTB", 33 | "BTC", 34 | "BU1", 35 | "C8E", 36 | "CAD", 37 | "CAQ", 38 | "CBM", 39 | "CCN", 40 | "CIT", 41 | "CL", 42 | "CLR", 43 | "CM", 44 | "CMO", 45 | "CO3", 46 | "CPT", 47 | "CXS", 48 | "D10", 49 | "DEP", 50 | "DIO", 51 | "DMS", 52 | "DN", 53 | "DOD", 54 | "DOX", 55 | "EDO", 56 | "EEE", 57 | "EGL", 58 | "EOH", 59 | "EOX", 60 | "EPE", 61 | "ETF", 62 | "FCY", 63 | "FJO", 64 | "FLC", 65 | "FMT", 66 | "FW5", 67 | "GOL", 68 | "GSH", 69 | "GTT", 70 | "GYF", 71 | "HED", 72 | "IHP", 73 | "IHS", 74 | "IMD", 75 | "IOD", 76 | "IPA", 77 | "IPH", 78 | "LDA", 79 | "MB3", 80 | "MEG", 81 | "MES", 82 | "MLA", 83 | "MLI", 84 | "MOH", 85 | "MPD", 86 | "MRD", 87 | "MSE", 88 | "MYR", 89 | "N", 90 | "NA", 91 | "NH2", 92 | "NH4", 93 | "NHE", 94 | "NO3", 95 | "O4B", 96 | "OHE", 97 | "OLA", 98 | "OLC", 99 | "OMB", 100 | "OME", 101 | "OXA", 102 | "P6G", 103 | "PE3", 104 | "PE4", 105 | "PEG", 106 | "PEO", 107 | "PEP", 108 | "PG0", 109 | "PG4", 110 | "PGE", 111 | "PGR", 112 | "PLM", 113 | "PO4", 114 | "POL", 115 | "POP", 116 | "PVO", 117 | "SAR", 118 | "SCN", 119 | "SEO", 120 | "SEP", 121 | "SIN", 122 | "SO4", 123 | "SPD", 124 | "SPM", 125 | "SR", 126 | "STE", 127 | "STO", 128 | "STU", 129 | "TAR", 130 | "TBU", 131 | "TME", 132 | "TPO", 133 | "TRS", 134 | "UNK", 135 | "UNL", 136 | "UNX", 137 | "UPL", 138 | "URE", 139 | } 140 | 141 | 142 | class ExcludedLigands(StaticFilter): 143 | """Filter excluded ligands.""" 144 | 145 | def filter(self, structure: Structure) -> np.ndarray: 146 | """Filter excluded ligands. 147 | 148 | Parameters 149 | ---------- 150 | structure : Structure 151 | The structure to filter chains from. 152 | 153 | Returns 154 | ------- 155 | np.ndarray 156 | The chains to keep, as a boolean mask. 157 | 158 | """ 159 | valid = np.ones(len(structure.chains), dtype=bool) 160 | 161 | for i, chain in enumerate(structure.chains): 162 | if chain["mol_type"] != const.chain_type_ids["NONPOLYMER"]: 163 | continue 164 | 165 | res_start = chain["res_idx"] 166 | res_end = res_start + chain["res_num"] 167 | residues = structure.residues[res_start:res_end] 168 | if any(res["name"] in LIGAND_EXCLUSION for res in residues): 169 | valid[i] = 0 170 | 171 | return valid 172 | -------------------------------------------------------------------------------- /src/boltz/model/layers/outer_product_mean.py: -------------------------------------------------------------------------------- 1 | import torch 2 | from torch import Tensor, nn 3 | 4 | import boltz.model.layers.initialize as init 5 | 6 | 7 | class OuterProductMean(nn.Module): 8 | """Outer product mean layer.""" 9 | 10 | def __init__(self, c_in: int, c_hidden: int, c_out: int) -> None: 11 | """Initialize the outer product mean layer. 12 | 13 | Parameters 14 | ---------- 15 | c_in : int 16 | The input dimension. 17 | c_hidden : int 18 | The hidden dimension. 19 | c_out : int 20 | The output dimension. 21 | 22 | """ 23 | super().__init__() 24 | self.c_hidden = c_hidden 25 | self.norm = nn.LayerNorm(c_in) 26 | self.proj_a = nn.Linear(c_in, c_hidden, bias=False) 27 | self.proj_b = nn.Linear(c_in, c_hidden, bias=False) 28 | self.proj_o = nn.Linear(c_hidden * c_hidden, c_out) 29 | init.final_init_(self.proj_o.weight) 30 | init.final_init_(self.proj_o.bias) 31 | 32 | def forward(self, m: Tensor, mask: Tensor, chunk_size: int = None) -> Tensor: 33 | """Forward pass. 34 | 35 | Parameters 36 | ---------- 37 | m : torch.Tensor 38 | The sequence tensor (B, S, N, c_in). 39 | mask : torch.Tensor 40 | The mask tensor (B, S, N). 41 | 42 | Returns 43 | ------- 44 | torch.Tensor 45 | The output tensor (B, N, N, c_out). 46 | 47 | """ 48 | # Expand mask 49 | mask = mask.unsqueeze(-1).to(m) 50 | 51 | # Compute projections 52 | m = self.norm(m) 53 | a = self.proj_a(m) * mask 54 | b = self.proj_b(m) * mask 55 | 56 | # Compute outer product mean 57 | if chunk_size is not None and not self.training: 58 | # Compute pairwise mask 59 | for i in range(0, mask.shape[1], 64): 60 | if i == 0: 61 | num_mask = ( 62 | mask[:, i : i + 64, None, :] * mask[:, i : i + 64, :, None] 63 | ).sum(1) 64 | else: 65 | num_mask += ( 66 | mask[:, i : i + 64, None, :] * mask[:, i : i + 64, :, None] 67 | ).sum(1) 68 | num_mask = num_mask.clamp(min=1) 69 | 70 | # Compute squentially in chunks 71 | for i in range(0, self.c_hidden, chunk_size): 72 | a_chunk = a[:, :, :, i : i + chunk_size] 73 | sliced_weight_proj_o = self.proj_o.weight[ 74 | :, i * self.c_hidden : (i + chunk_size) * self.c_hidden 75 | ] 76 | 77 | z = torch.einsum("bsic,bsjd->bijcd", a_chunk, b) 78 | z = z.reshape(*z.shape[:3], -1) 79 | z = z / num_mask 80 | 81 | # Project to output 82 | if i == 0: 83 | z_out = z.to(m) @ sliced_weight_proj_o.T 84 | else: 85 | z_out = z_out + z.to(m) @ sliced_weight_proj_o.T 86 | 87 | z_out = z_out + self.proj_o.bias # add bias 88 | return z_out 89 | else: 90 | mask = mask[:, :, None, :] * mask[:, :, :, None] 91 | num_mask = mask.sum(1).clamp(min=1) 92 | z = torch.einsum("bsic,bsjd->bijcd", a.float(), b.float()) 93 | z = z.reshape(*z.shape[:3], -1) 94 | z = z / num_mask 95 | 96 | # Project to output 97 | z = self.proj_o(z.to(m)) 98 | return z 99 | -------------------------------------------------------------------------------- /scripts/process/cluster.py: -------------------------------------------------------------------------------- 1 | """Create a mapping from structure and chain ID to MSA indices.""" 2 | 3 | import argparse 4 | import hashlib 5 | import json 6 | import pickle 7 | import subprocess 8 | from pathlib import Path 9 | 10 | import pandas as pd 11 | from Bio import SeqIO 12 | 13 | 14 | def hash_sequence(seq: str) -> str: 15 | """Hash a sequence.""" 16 | return hashlib.sha256(seq.encode()).hexdigest() 17 | 18 | 19 | def main(args: argparse.Namespace) -> None: 20 | """Create clustering.""" 21 | # Set output directory 22 | outdir = Path(args.outdir) 23 | outdir.mkdir(parents=True, exist_ok=True) 24 | 25 | # Split the sequences into proteins and nucleotides 26 | with Path(args.sequences).open("r") as f: 27 | data = list(SeqIO.parse(f, "fasta")) 28 | 29 | proteins = set() 30 | shorts = set() 31 | nucleotides = set() 32 | 33 | # Separate the sequences into proteins, nucleotides and short sequences 34 | # Short sequences cause a bug in the clustering, so they are separated 35 | for seq in data: 36 | if set(str(seq.seq)).issubset({"A", "C", "G", "T", "U", "N"}): 37 | nucleotides.add(str(seq.seq).strip()) 38 | elif len(str(seq.seq).strip()) < 10: # noqa: PLR2004 39 | shorts.add(str(seq.seq).strip()) 40 | else: 41 | proteins.add(str(seq.seq).strip()) 42 | 43 | # Run mmseqs on the protein data 44 | proteins = [f">{hash_sequence(seq)}\n{seq}" for seq in proteins] 45 | with (outdir / "proteins.fasta").open("w") as f: 46 | f.write("\n".join(proteins)) 47 | 48 | subprocess.run( 49 | f"{args.mmseqs} easy-cluster {outdir / 'proteins.fasta'} {outdir / 'clust_prot'} {outdir / 'tmp'} --min-seq-id 0.4", # noqa: E501 50 | shell=True, # noqa: S602 51 | check=True, 52 | ) 53 | 54 | # Load protein clusters 55 | clustering_path = outdir / "clust_prot_cluster.tsv" 56 | protein_data = pd.read_csv(clustering_path, sep="\t", header=None) 57 | clusters = protein_data[0] 58 | items = protein_data[1] 59 | clustering = dict(zip(list(items), list(clusters))) 60 | 61 | # Each shqrt sequence is given an id 62 | for short in shorts: 63 | short_id = hash_sequence(short) 64 | clustering[short_id] = short_id 65 | 66 | # Each unique rna sequence is given an id 67 | for nucl in nucleotides: 68 | nucl_id = hash_sequence(nucl) 69 | clustering[nucl_id] = nucl_id 70 | 71 | # Load ligand data 72 | with Path(args.ccd).open("rb") as handle: 73 | ligand_data = pickle.load(handle) # noqa: S301 74 | 75 | # Each unique ligand CCD is given an id 76 | for ccd_code in ligand_data: 77 | clustering[ccd_code] = ccd_code 78 | 79 | # Save clustering 80 | with (outdir / "clustering.json").open("w") as handle: 81 | json.dump(clustering, handle) 82 | 83 | 84 | if __name__ == "__main__": 85 | parser = argparse.ArgumentParser() 86 | parser.add_argument( 87 | "--sequences", 88 | type=str, 89 | help="Input to protein fasta.", 90 | required=True, 91 | ) 92 | parser.add_argument( 93 | "--ccd", 94 | type=str, 95 | help="Input to rna fasta.", 96 | required=True, 97 | ) 98 | parser.add_argument( 99 | "--outdir", 100 | type=str, 101 | help="Output directory.", 102 | required=True, 103 | ) 104 | parser.add_argument( 105 | "--mmseqs", 106 | type=str, 107 | help="Path to mmseqs program.", 108 | default="mmseqs", 109 | ) 110 | args = parser.parse_args() 111 | main(args) 112 | -------------------------------------------------------------------------------- /scripts/process/utils/clean_msa.py: -------------------------------------------------------------------------------- 1 | #!/usr/bin/env python3 2 | import argparse 3 | import os 4 | from pathlib import Path 5 | import re 6 | import shutil 7 | import tempfile 8 | from tqdm import tqdm 9 | 10 | def clean_a3m_file(input_path, output_path=None): 11 | """ 12 | Clean an a3m file by removing null characters and other problematic characters. 13 | If output_path is None, the file will be modified in place. 14 | """ 15 | # Create a temp file if we're modifying in place 16 | if output_path is None: 17 | temp_fd, temp_path = tempfile.mkstemp() 18 | output_path = temp_path 19 | in_place = True 20 | else: 21 | in_place = False 22 | 23 | try: 24 | with open(input_path, 'rb') as f_in: 25 | content = f_in.read() 26 | 27 | # Replace null characters with spaces 28 | clean_content = content.replace(b'\x00', b' ') 29 | 30 | with open(output_path, 'wb') as f_out: 31 | f_out.write(clean_content) 32 | 33 | # If modifying in place, replace the original file 34 | if in_place: 35 | shutil.move(output_path, input_path) 36 | os.close(temp_fd) 37 | 38 | return True 39 | except Exception as e: 40 | print(f"Error cleaning {input_path}: {e}") 41 | if in_place and 'temp_fd' in locals(): 42 | os.close(temp_fd) 43 | if os.path.exists(temp_path): 44 | os.unlink(temp_path) 45 | return False 46 | 47 | def main(): 48 | parser = argparse.ArgumentParser(description="Clean a3m files by removing problematic characters") 49 | parser.add_argument("--input_dir", type=str, required=True, 50 | help="Directory containing a3m files to clean") 51 | parser.add_argument("--output_dir", type=str, default=None, 52 | help="Directory to save cleaned files (if not specified, files will be modified in place)") 53 | parser.add_argument("--exclude", type=str, default="*_env*", 54 | help="Pattern to exclude (default: '*_env*')") 55 | 56 | args = parser.parse_args() 57 | 58 | input_dir = Path(args.input_dir) 59 | output_dir = Path(args.output_dir) if args.output_dir else None 60 | 61 | # Create output directory if specified 62 | if output_dir: 63 | output_dir.mkdir(parents=True, exist_ok=True) 64 | 65 | # Find all a3m files to process 66 | a3m_files = [] 67 | for path in input_dir.rglob("*.a3m"): 68 | # Skip files matching the exclude pattern 69 | if args.exclude and re.search(args.exclude.replace("*", ".*"), str(path)): 70 | continue 71 | a3m_files.append(path) 72 | 73 | print(f"Found {len(a3m_files)} a3m files to clean") 74 | 75 | # Process each file 76 | cleaned_count = 0 77 | for a3m_path in tqdm(a3m_files): 78 | if output_dir: 79 | # Keep the relative path structure and convert to lowercase 80 | rel_path = a3m_path.relative_to(input_dir) 81 | # Convert the filename part to lowercase while preserving the directory structure 82 | rel_path_parts = list(rel_path.parts) 83 | rel_path_parts[-1] = rel_path_parts[-1].lower() 84 | out_path = output_dir.joinpath(*rel_path_parts) 85 | # Create parent directories if they don't exist 86 | out_path.parent.mkdir(parents=True, exist_ok=True) 87 | else: 88 | out_path = None 89 | 90 | success = clean_a3m_file(a3m_path, out_path) 91 | if success: 92 | cleaned_count += 1 93 | 94 | print(f"Successfully cleaned {cleaned_count}/{len(a3m_files)} files") 95 | 96 | if __name__ == "__main__": 97 | main() -------------------------------------------------------------------------------- /scripts/process/utils/merge_processed_data.py: -------------------------------------------------------------------------------- 1 | import os 2 | import json 3 | import shutil 4 | from pathlib import Path 5 | 6 | def merge_processed_data(brd4_dir, fkbp_dir, output_dir): 7 | """ 8 | Merge processed data from BRD4 and FKBP binders into a single directory. 9 | 10 | Args: 11 | brd4_dir (str): Path to BRD4_binder_processed directory 12 | fkbp_dir (str): Path to FKBP_binder_processed directory 13 | output_dir (str): Path to output directory 14 | """ 15 | # Convert to Path objects 16 | brd4_dir = Path(brd4_dir) 17 | fkbp_dir = Path(fkbp_dir) 18 | output_dir = Path(output_dir) 19 | 20 | # Create output directory structure 21 | output_records = output_dir / "records" 22 | output_structures = output_dir / "structures" 23 | output_records.mkdir(parents=True, exist_ok=True) 24 | output_structures.mkdir(parents=True, exist_ok=True) 25 | 26 | # Load manifests 27 | with open(brd4_dir / "manifest.json", 'r') as f: 28 | brd4_manifest = json.load(f) 29 | 30 | with open(fkbp_dir / "manifest.json", 'r') as f: 31 | fkbp_manifest = json.load(f) 32 | 33 | # Combine manifests (they are lists) 34 | combined_manifest = brd4_manifest + fkbp_manifest 35 | 36 | # Create a set of record IDs for quick lookup 37 | brd4_ids = {record['id'] for record in brd4_manifest} 38 | fkbp_ids = {record['id'] for record in fkbp_manifest} 39 | 40 | # Copy files from BRD4 41 | print("Copying BRD4 files...") 42 | for record in brd4_manifest: 43 | record_id = record['id'] 44 | # Copy record file 45 | src_record = brd4_dir / "records" / f"{record_id}.json" 46 | dst_record = output_records / f"{record_id}.json" 47 | shutil.copy2(src_record, dst_record) 48 | 49 | # Copy structure file if it exists 50 | src_structure = brd4_dir / "structures" / f"{record_id}.npz" 51 | if src_structure.exists(): 52 | dst_structure = output_structures / f"{record_id}.npz" 53 | shutil.copy2(src_structure, dst_structure) 54 | 55 | # Copy files from FKBP 56 | print("Copying FKBP files...") 57 | for record in fkbp_manifest: 58 | record_id = record['id'] 59 | # Copy record file 60 | src_record = fkbp_dir / "records" / f"{record_id}.json" 61 | dst_record = output_records / f"{record_id}.json" 62 | shutil.copy2(src_record, dst_record) 63 | 64 | # Copy structure file if it exists 65 | src_structure = fkbp_dir / "structures" / f"{record_id}.npz" 66 | if src_structure.exists(): 67 | dst_structure = output_structures / f"{record_id}.npz" 68 | shutil.copy2(src_structure, dst_structure) 69 | 70 | # Save combined manifest 71 | with open(output_dir / "manifest.json", 'w') as f: 72 | json.dump(combined_manifest, f, indent=2) 73 | 74 | print(f"\nMerge completed successfully!") 75 | print(f"Total records in combined manifest: {len(combined_manifest)}") 76 | print(f"BRD4 records: {len(brd4_manifest)}") 77 | print(f"FKBP records: {len(fkbp_manifest)}") 78 | print(f"Unique BRD4 IDs: {len(brd4_ids)}") 79 | print(f"Unique FKBP IDs: {len(fkbp_ids)}") 80 | print(f"Total unique IDs: {len(brd4_ids | fkbp_ids)}") 81 | print(f"\nOutput directory: {output_dir}") 82 | 83 | def main(): 84 | # Define paths 85 | base_dir = Path("/ist-nas/users/bunditb/boltz/scripts/merk_challenge") 86 | brd4_dir = base_dir / "BRD4_binder/BRD4_binder_processed" 87 | fkbp_dir = base_dir / "FKBP_binder/FKBP_binder_processed" 88 | output_dir = base_dir / "combined_processed" 89 | 90 | # Merge the data 91 | merge_processed_data(brd4_dir, fkbp_dir, output_dir) 92 | 93 | if __name__ == '__main__': 94 | main() -------------------------------------------------------------------------------- /scripts/process/msa.py: -------------------------------------------------------------------------------- 1 | import argparse 2 | import multiprocessing 3 | from dataclasses import asdict 4 | from functools import partial 5 | from pathlib import Path 6 | from typing import Any 7 | 8 | import numpy as np 9 | from p_tqdm import p_umap 10 | from redis import Redis 11 | from tqdm import tqdm 12 | 13 | from boltz.data.parse.a3m import parse_a3m 14 | 15 | 16 | class Resource: 17 | """A shared resource for processing.""" 18 | 19 | def __init__(self, host: str, port: int) -> None: 20 | """Initialize the redis database.""" 21 | self._redis = Redis(host=host, port=port) 22 | 23 | def get(self, key: str) -> Any: # noqa: ANN401 24 | """Get an item from the Redis database.""" 25 | return self._redis.get(key) 26 | 27 | def __getitem__(self, key: str) -> Any: # noqa: ANN401 28 | """Get an item from the resource.""" 29 | out = self.get(key) 30 | if out is None: 31 | raise KeyError(key) 32 | return out 33 | 34 | 35 | def process_msa( 36 | path: Path, 37 | outdir: str, 38 | max_seqs: int, 39 | resource: Resource, 40 | ) -> None: 41 | """Run processing in a worker thread.""" 42 | outdir = Path(outdir) 43 | out_path = outdir / f"{path.stem}.npz" 44 | if not out_path.exists(): 45 | msa = parse_a3m(path, resource, max_seqs) 46 | np.savez_compressed(out_path, **asdict(msa)) 47 | 48 | 49 | def process(args) -> None: 50 | """Run the data processing task.""" 51 | # Create output directory 52 | args.outdir.mkdir(parents=True, exist_ok=True) 53 | 54 | # Load the resource 55 | resource = Resource(host=args.redis_host, port=args.redis_port) 56 | 57 | # Get data points 58 | print("Fetching data...") 59 | data = list(args.msadir.rglob("*.a3m*")) 60 | print(f"Found {len(data)} MSA's.") 61 | 62 | # Check if we can run in parallel 63 | max_processes = multiprocessing.cpu_count() 64 | num_processes = max(1, min(args.num_processes, max_processes, len(data))) 65 | parallel = num_processes > 1 66 | 67 | # Run processing 68 | if parallel: 69 | # Create processing function 70 | fn = partial( 71 | process_msa, 72 | outdir=args.outdir, 73 | max_seqs=args.max_seqs, 74 | resource=resource, 75 | ) 76 | 77 | # Run in parallel 78 | p_umap(fn, data, num_cpus=num_processes) 79 | 80 | else: 81 | # Run in serial 82 | for path in tqdm(data): 83 | process_msa( 84 | path, 85 | outdir=args.outdir, 86 | max_seqs=args.max_seqs, 87 | resource=resource, 88 | ) 89 | 90 | 91 | if __name__ == "__main__": 92 | parser = argparse.ArgumentParser(description="Process MSA data.") 93 | parser.add_argument( 94 | "--msadir", 95 | type=Path, 96 | required=True, 97 | help="The MSA data directory.", 98 | ) 99 | parser.add_argument( 100 | "--outdir", 101 | type=Path, 102 | default="data", 103 | help="The output directory.", 104 | ) 105 | parser.add_argument( 106 | "--num-processes", 107 | type=int, 108 | default=multiprocessing.cpu_count(), 109 | help="The number of processes.", 110 | ) 111 | parser.add_argument( 112 | "--redis-host", 113 | type=str, 114 | default="localhost", 115 | help="The Redis host.", 116 | ) 117 | parser.add_argument( 118 | "--redis-port", 119 | type=int, 120 | default=7777, 121 | help="The Redis port.", 122 | ) 123 | parser.add_argument( 124 | "--max-seqs", 125 | type=int, 126 | default=16384, 127 | help="The maximum number of sequences.", 128 | ) 129 | args = parser.parse_args() 130 | process(args) 131 | -------------------------------------------------------------------------------- /mcp-server/boltz_mcp_wrapper.py: -------------------------------------------------------------------------------- 1 | #!/usr/bin/env python3 2 | # -*- coding: utf-8 -*- 3 | 4 | """ 5 | Wrapper for Boltz-1 MCP Server tools. 6 | This provides a unified interface for accessing Boltz-1 functions using FastMCP tools. 7 | """ 8 | 9 | import os 10 | import sys 11 | import json 12 | import pathlib 13 | import importlib.util 14 | from typing import Dict, List, Any, Optional, Union, Callable 15 | 16 | # Get the directory where the current script is located 17 | SCRIPT_DIR = pathlib.Path(__file__).parent.resolve() 18 | 19 | # Path to the boltz_mcp_server.py file 20 | SERVER_PATH = SCRIPT_DIR / "boltz_mcp_server.py" 21 | 22 | # Dictionary to store the imported tools 23 | TOOLS = {} 24 | 25 | # Import the tools from boltz_mcp_server.py 26 | def import_server_tools(): 27 | """Import tools from boltz_mcp_server.py.""" 28 | global TOOLS 29 | 30 | if not SERVER_PATH.exists(): 31 | print(f"Error: boltz_mcp_server.py not found at {SERVER_PATH}") 32 | return False 33 | 34 | # Create a module spec 35 | spec = importlib.util.spec_from_file_location("boltz_mcp_server", SERVER_PATH) 36 | 37 | # Create a module from the spec 38 | server_module = importlib.util.module_from_spec(spec) 39 | 40 | # Add the module to sys.modules 41 | sys.modules["boltz_mcp_server"] = server_module 42 | 43 | # Execute the module 44 | try: 45 | spec.loader.exec_module(server_module) 46 | except ImportError as e: 47 | print(f"Warning: Could not fully import boltz_mcp_server.py: {e}") 48 | return False 49 | 50 | # Extract the FastMCP tools 51 | # Resources 52 | if hasattr(server_module, "get_documentation"): 53 | TOOLS["get_documentation"] = server_module.get_documentation 54 | if hasattr(server_module, "get_config_template"): 55 | TOOLS["get_config_template"] = server_module.get_config_template 56 | if hasattr(server_module, "get_model_info"): 57 | TOOLS["get_model_info"] = server_module.get_model_info 58 | 59 | # Tools 60 | if hasattr(server_module, "prepare_inputs"): 61 | TOOLS["prepare_inputs"] = server_module.prepare_inputs 62 | if hasattr(server_module, "train_model"): 63 | TOOLS["train_model"] = server_module.train_model 64 | if hasattr(server_module, "finetune_model"): 65 | TOOLS["finetune_model"] = server_module.finetune_model 66 | if hasattr(server_module, "run_inference"): 67 | TOOLS["run_inference"] = server_module.run_inference 68 | if hasattr(server_module, "analyze_results"): 69 | TOOLS["analyze_results"] = server_module.analyze_results 70 | if hasattr(server_module, "connect_ssh"): 71 | TOOLS["connect_ssh"] = server_module.connect_ssh 72 | if hasattr(server_module, "check_remote_path"): 73 | TOOLS["check_remote_path"] = server_module.check_remote_path 74 | if hasattr(server_module, "change_remote_dir"): 75 | TOOLS["change_remote_dir"] = server_module.change_remote_dir 76 | if hasattr(server_module, "activate_environment"): 77 | TOOLS["activate_environment"] = server_module.activate_environment 78 | if hasattr(server_module, "start_redis_server"): 79 | TOOLS["start_redis_server"] = server_module.start_redis_server 80 | if hasattr(server_module, "start_ccd_redis_server"): 81 | TOOLS["start_ccd_redis_server"] = server_module.start_ccd_redis_server 82 | if hasattr(server_module, "start_taxonomy_redis_server"): 83 | TOOLS["start_taxonomy_redis_server"] = server_module.start_taxonomy_redis_server 84 | 85 | return True 86 | 87 | # Import the tools 88 | import_server_tools() 89 | 90 | # Get a function from the imported tools 91 | def get_tool(name: str) -> Callable: 92 | """Get a function from the imported tools.""" 93 | if name in TOOLS: 94 | return TOOLS[name] 95 | else: 96 | # If the tool is not available, raise an error 97 | raise ImportError(f"Tool '{name}' not found in boltz_mcp_server.py") -------------------------------------------------------------------------------- /src/boltz/data/parse/a3m.py: -------------------------------------------------------------------------------- 1 | import gzip 2 | from pathlib import Path 3 | from typing import Optional, TextIO 4 | 5 | import numpy as np 6 | 7 | from boltz.data import const 8 | from boltz.data.types import MSA, MSADeletion, MSAResidue, MSASequence 9 | 10 | 11 | def _parse_a3m( # noqa: C901 12 | lines: TextIO, 13 | taxonomy: Optional[dict[str, str]], 14 | max_seqs: Optional[int] = None, 15 | ) -> MSA: 16 | """Process an MSA file. 17 | 18 | Parameters 19 | ---------- 20 | lines : TextIO 21 | The lines of the MSA file. 22 | taxonomy : dict[str, str] 23 | The taxonomy database, if available. 24 | max_seqs : int, optional 25 | The maximum number of sequences. 26 | 27 | Returns 28 | ------- 29 | MSA 30 | The MSA object. 31 | 32 | """ 33 | visited = set() 34 | sequences = [] 35 | deletions = [] 36 | residues = [] 37 | 38 | seq_idx = 0 39 | for line in lines: 40 | line: str 41 | line = line.strip() # noqa: PLW2901 42 | if not line or line.startswith("#"): 43 | continue 44 | 45 | # Get taxonomy, if annotated 46 | if line.startswith(">"): 47 | header = line.split()[0] 48 | if taxonomy and header.startswith(">UniRef100"): 49 | uniref_id = header.split("_")[1] 50 | taxonomy_id = taxonomy.get(uniref_id) 51 | if taxonomy_id is None: 52 | taxonomy_id = -1 53 | else: 54 | taxonomy_id = -1 55 | continue 56 | 57 | # Skip if duplicate sequence 58 | str_seq = line.replace("-", "").upper() 59 | if str_seq not in visited: 60 | visited.add(str_seq) 61 | else: 62 | continue 63 | 64 | # Process sequence 65 | residue = [] 66 | deletion = [] 67 | count = 0 68 | res_idx = 0 69 | for c in line: 70 | if c != "-" and c.islower(): 71 | count += 1 72 | continue 73 | token = const.prot_letter_to_token[c] 74 | token = const.token_ids[token] 75 | residue.append(token) 76 | if count > 0: 77 | deletion.append((res_idx, count)) 78 | count = 0 79 | res_idx += 1 80 | 81 | res_start = len(residues) 82 | res_end = res_start + len(residue) 83 | 84 | del_start = len(deletions) 85 | del_end = del_start + len(deletion) 86 | 87 | sequences.append((seq_idx, taxonomy_id, res_start, res_end, del_start, del_end)) 88 | residues.extend(residue) 89 | deletions.extend(deletion) 90 | 91 | seq_idx += 1 92 | if (max_seqs is not None) and (seq_idx >= max_seqs): 93 | break 94 | 95 | # Create MSA object 96 | msa = MSA( 97 | residues=np.array(residues, dtype=MSAResidue), 98 | deletions=np.array(deletions, dtype=MSADeletion), 99 | sequences=np.array(sequences, dtype=MSASequence), 100 | ) 101 | return msa 102 | 103 | 104 | def parse_a3m( 105 | path: Path, 106 | taxonomy: Optional[dict[str, str]], 107 | max_seqs: Optional[int] = None, 108 | ) -> MSA: 109 | """Process an A3M file. 110 | 111 | Parameters 112 | ---------- 113 | path : Path 114 | The path to the a3m(.gz) file. 115 | taxonomy : Redis 116 | The taxonomy database. 117 | max_seqs : int, optional 118 | The maximum number of sequences. 119 | 120 | Returns 121 | ------- 122 | MSA 123 | The MSA object. 124 | 125 | """ 126 | # Read the file 127 | if path.suffix == ".gz": 128 | with gzip.open(str(path), "rt") as f: 129 | msa = _parse_a3m(f, taxonomy, max_seqs) 130 | else: 131 | with path.open("r") as f: 132 | msa = _parse_a3m(f, taxonomy, max_seqs) 133 | 134 | return msa 135 | -------------------------------------------------------------------------------- /src/boltz/model/optim/scheduler.py: -------------------------------------------------------------------------------- 1 | import torch 2 | 3 | 4 | class AlphaFoldLRScheduler(torch.optim.lr_scheduler._LRScheduler): 5 | """Implements the learning rate schedule defined AF3. 6 | 7 | A linear warmup is followed by a plateau at the maximum 8 | learning rate and then exponential decay. Note that the 9 | initial learning rate of the optimizer in question is 10 | ignored; use this class' base_lr parameter to specify 11 | the starting point of the warmup. 12 | 13 | """ 14 | 15 | def __init__( 16 | self, 17 | optimizer: torch.optim.Optimizer, 18 | last_epoch: int = -1, 19 | verbose: bool = False, 20 | base_lr: float = 0.0, 21 | max_lr: float = 1.8e-3, 22 | warmup_no_steps: int = 1000, 23 | start_decay_after_n_steps: int = 50000, 24 | decay_every_n_steps: int = 50000, 25 | decay_factor: float = 0.95, 26 | ) -> None: 27 | """Initialize the learning rate scheduler. 28 | 29 | Parameters 30 | ---------- 31 | optimizer : torch.optim.Optimizer 32 | The optimizer. 33 | last_epoch : int, optional 34 | The last epoch, by default -1 35 | verbose : bool, optional 36 | Whether to print verbose output, by default False 37 | base_lr : float, optional 38 | The base learning rate, by default 0.0 39 | max_lr : float, optional 40 | The maximum learning rate, by default 1.8e-3 41 | warmup_no_steps : int, optional 42 | The number of warmup steps, by default 1000 43 | start_decay_after_n_steps : int, optional 44 | The number of steps after which to start decay, by default 50000 45 | decay_every_n_steps : int, optional 46 | The number of steps after which to decay, by default 50000 47 | decay_factor : float, optional 48 | The decay factor, by default 0.95 49 | 50 | """ 51 | step_counts = { 52 | "warmup_no_steps": warmup_no_steps, 53 | "start_decay_after_n_steps": start_decay_after_n_steps, 54 | } 55 | 56 | for k, v in step_counts.items(): 57 | if v < 0: 58 | msg = f"{k} must be nonnegative" 59 | raise ValueError(msg) 60 | 61 | if warmup_no_steps > start_decay_after_n_steps: 62 | msg = "warmup_no_steps must not exceed start_decay_after_n_steps" 63 | raise ValueError(msg) 64 | 65 | self.optimizer = optimizer 66 | self.last_epoch = last_epoch 67 | self.verbose = verbose 68 | self.base_lr = base_lr 69 | self.max_lr = max_lr 70 | self.warmup_no_steps = warmup_no_steps 71 | self.start_decay_after_n_steps = start_decay_after_n_steps 72 | self.decay_every_n_steps = decay_every_n_steps 73 | self.decay_factor = decay_factor 74 | 75 | super().__init__(optimizer, last_epoch=last_epoch, verbose=verbose) 76 | 77 | def state_dict(self) -> dict: 78 | state_dict = {k: v for k, v in self.__dict__.items() if k not in ["optimizer"]} 79 | return state_dict 80 | 81 | def load_state_dict(self, state_dict): 82 | self.__dict__.update(state_dict) 83 | 84 | def get_lr(self): 85 | if not self._get_lr_called_within_step: 86 | msg = ( 87 | "To get the last learning rate computed by the scheduler, use " 88 | "get_last_lr()" 89 | ) 90 | raise RuntimeError(msg) 91 | 92 | step_no = self.last_epoch 93 | 94 | if step_no <= self.warmup_no_steps: 95 | lr = self.base_lr + (step_no / self.warmup_no_steps) * self.max_lr 96 | elif step_no > self.start_decay_after_n_steps: 97 | steps_since_decay = step_no - self.start_decay_after_n_steps 98 | exp = (steps_since_decay // self.decay_every_n_steps) + 1 99 | lr = self.max_lr * (self.decay_factor**exp) 100 | else: # plateau 101 | lr = self.max_lr 102 | 103 | return [lr for group in self.optimizer.param_groups] 104 | -------------------------------------------------------------------------------- /src/boltz/data/parse/fasta.py: -------------------------------------------------------------------------------- 1 | from collections.abc import Mapping 2 | from pathlib import Path 3 | 4 | from Bio import SeqIO 5 | from rdkit.Chem.rdchem import Mol 6 | 7 | from boltz.data.parse.yaml import parse_boltz_schema 8 | from boltz.data.types import Target 9 | 10 | 11 | def parse_fasta(path: Path, ccd: Mapping[str, Mol]) -> Target: # noqa: C901 12 | """Parse a fasta file. 13 | 14 | The name of the fasta file is used as the name of this job. 15 | We rely on the fasta record id to determine the entity type. 16 | 17 | > CHAIN_ID|ENTITY_TYPE|MSA_ID 18 | SEQUENCE 19 | > CHAIN_ID|ENTITY_TYPE|MSA_ID 20 | ... 21 | 22 | Where ENTITY_TYPE is either protein, rna, dna, ccd or smiles, 23 | and CHAIN_ID is the chain identifier, which should be unique. 24 | The MSA_ID is optional and should only be used on proteins. 25 | 26 | Parameters 27 | ---------- 28 | fasta_file : Path 29 | Path to the fasta file. 30 | ccd : Dict 31 | Dictionary of CCD components. 32 | 33 | Returns 34 | ------- 35 | Target 36 | The parsed target. 37 | 38 | """ 39 | # Read fasta file 40 | with path.open("r") as f: 41 | records = list(SeqIO.parse(f, "fasta")) 42 | 43 | # Make sure all records have a chain id and entity 44 | for seq_record in records: 45 | if "|" not in seq_record.id: 46 | msg = f"Invalid record id: {seq_record.id}" 47 | raise ValueError(msg) 48 | 49 | header = seq_record.id.split("|") 50 | assert len(header) >= 2, f"Invalid record id: {seq_record.id}" 51 | 52 | chain_id, entity_type = header[:2] 53 | if entity_type.lower() not in {"protein", "dna", "rna", "ccd", "smiles"}: 54 | msg = f"Invalid entity type: {entity_type}" 55 | raise ValueError(msg) 56 | if chain_id == "": 57 | msg = "Empty chain id in input fasta!" 58 | raise ValueError(msg) 59 | if entity_type == "": 60 | msg = "Empty entity type in input fasta!" 61 | raise ValueError(msg) 62 | 63 | # Convert to yaml format 64 | sequences = [] 65 | for seq_record in records: 66 | # Get chain id, entity type and sequence 67 | header = seq_record.id.split("|") 68 | chain_id, entity_type = header[:2] 69 | if len(header) == 3 and header[2] != "": 70 | assert ( 71 | entity_type.lower() == "protein" 72 | ), "MSA_ID is only allowed for proteins" 73 | msa_id = header[2] 74 | else: 75 | msa_id = None 76 | 77 | entity_type = entity_type.upper() 78 | seq = str(seq_record.seq) 79 | 80 | if entity_type == "PROTEIN": 81 | molecule = { 82 | "protein": { 83 | "id": chain_id, 84 | "sequence": seq, 85 | "modifications": [], 86 | "msa": msa_id, 87 | }, 88 | } 89 | elif entity_type == "RNA": 90 | molecule = { 91 | "rna": { 92 | "id": chain_id, 93 | "sequence": seq, 94 | "modifications": [], 95 | }, 96 | } 97 | elif entity_type == "DNA": 98 | molecule = { 99 | "dna": { 100 | "id": chain_id, 101 | "sequence": seq, 102 | "modifications": [], 103 | } 104 | } 105 | elif entity_type.upper() == "CCD": 106 | molecule = { 107 | "ligand": { 108 | "id": chain_id, 109 | "ccd": seq, 110 | } 111 | } 112 | elif entity_type.upper() == "SMILES": 113 | molecule = { 114 | "ligand": { 115 | "id": chain_id, 116 | "smiles": seq, 117 | } 118 | } 119 | 120 | sequences.append(molecule) 121 | 122 | data = { 123 | "sequences": sequences, 124 | "bonds": [], 125 | "version": 1, 126 | } 127 | 128 | name = path.stem 129 | return parse_boltz_schema(name, data, ccd) 130 | -------------------------------------------------------------------------------- /src/boltz/model/layers/attention.py: -------------------------------------------------------------------------------- 1 | from einops.layers.torch import Rearrange 2 | import torch 3 | from torch import Tensor, nn 4 | 5 | import boltz.model.layers.initialize as init 6 | 7 | 8 | class AttentionPairBias(nn.Module): 9 | """Attention pair bias layer.""" 10 | 11 | def __init__( 12 | self, 13 | c_s: int, 14 | c_z: int, 15 | num_heads: int, 16 | inf: float = 1e6, 17 | initial_norm: bool = True, 18 | ) -> None: 19 | """Initialize the attention pair bias layer. 20 | 21 | Parameters 22 | ---------- 23 | c_s : int 24 | The input sequence dimension. 25 | c_z : int 26 | The input pairwise dimension. 27 | num_heads : int 28 | The number of heads. 29 | inf : float, optional 30 | The inf value, by default 1e6 31 | initial_norm: bool, optional 32 | Whether to apply layer norm to the input, by default True 33 | 34 | """ 35 | super().__init__() 36 | 37 | assert c_s % num_heads == 0 38 | 39 | self.c_s = c_s 40 | self.num_heads = num_heads 41 | self.head_dim = c_s // num_heads 42 | self.inf = inf 43 | 44 | self.initial_norm = initial_norm 45 | if self.initial_norm: 46 | self.norm_s = nn.LayerNorm(c_s) 47 | 48 | self.proj_q = nn.Linear(c_s, c_s) 49 | self.proj_k = nn.Linear(c_s, c_s, bias=False) 50 | self.proj_v = nn.Linear(c_s, c_s, bias=False) 51 | self.proj_g = nn.Linear(c_s, c_s, bias=False) 52 | 53 | self.proj_z = nn.Sequential( 54 | nn.LayerNorm(c_z), 55 | nn.Linear(c_z, num_heads, bias=False), 56 | Rearrange("b ... h -> b h ..."), 57 | ) 58 | 59 | self.proj_o = nn.Linear(c_s, c_s, bias=False) 60 | init.final_init_(self.proj_o.weight) 61 | 62 | def forward( 63 | self, 64 | s: Tensor, 65 | z: Tensor, 66 | mask: Tensor, 67 | multiplicity: int = 1, 68 | to_keys=None, 69 | model_cache=None, 70 | ) -> Tensor: 71 | """Forward pass. 72 | 73 | Parameters 74 | ---------- 75 | s : torch.Tensor 76 | The input sequence tensor (B, S, D) 77 | z : torch.Tensor 78 | The input pairwise tensor (B, N, N, D) 79 | mask : torch.Tensor 80 | The pairwise mask tensor (B, N) 81 | multiplicity : int, optional 82 | The diffusion batch size, by default 1 83 | 84 | Returns 85 | ------- 86 | torch.Tensor 87 | The output sequence tensor. 88 | 89 | """ 90 | B = s.shape[0] 91 | 92 | # Layer norms 93 | if self.initial_norm: 94 | s = self.norm_s(s) 95 | 96 | if to_keys is not None: 97 | k_in = to_keys(s) 98 | mask = to_keys(mask.unsqueeze(-1)).squeeze(-1) 99 | else: 100 | k_in = s 101 | 102 | # Compute projections 103 | q = self.proj_q(s).view(B, -1, self.num_heads, self.head_dim) 104 | k = self.proj_k(k_in).view(B, -1, self.num_heads, self.head_dim) 105 | v = self.proj_v(k_in).view(B, -1, self.num_heads, self.head_dim) 106 | 107 | # Caching z projection during diffusion roll-out 108 | if model_cache is None or "z" not in model_cache: 109 | z = self.proj_z(z) 110 | 111 | if model_cache is not None: 112 | model_cache["z"] = z 113 | else: 114 | z = model_cache["z"] 115 | z = z.repeat_interleave(multiplicity, 0) 116 | 117 | g = self.proj_g(s).sigmoid() 118 | 119 | with torch.autocast("cuda", enabled=False): 120 | # Compute attention weights 121 | attn = torch.einsum("bihd,bjhd->bhij", q.float(), k.float()) 122 | attn = attn / (self.head_dim**0.5) + z.float() 123 | # The pairwise mask tensor (B, N) is broadcasted to (B, 1, 1, N) and (B, H, N, N) 124 | attn = attn + (1 - mask[:, None, None].float()) * -self.inf 125 | attn = attn.softmax(dim=-1) 126 | 127 | # Compute output 128 | o = torch.einsum("bhij,bjhd->bihd", attn, v.float()).to(v.dtype) 129 | o = o.reshape(B, -1, self.c_s) 130 | o = self.proj_o(g * o) 131 | 132 | return o 133 | -------------------------------------------------------------------------------- /src/boltz/model/layers/triangular_mult.py: -------------------------------------------------------------------------------- 1 | import torch 2 | from torch import Tensor, nn 3 | 4 | from boltz.model.layers import initialize as init 5 | 6 | 7 | class TriangleMultiplicationOutgoing(nn.Module): 8 | """TriangleMultiplicationOutgoing.""" 9 | 10 | def __init__(self, dim: int = 128) -> None: 11 | """Initialize the TriangularUpdate module. 12 | 13 | Parameters 14 | ---------- 15 | dim: int 16 | The dimension of the input, default 128 17 | 18 | """ 19 | super().__init__() 20 | 21 | self.norm_in = nn.LayerNorm(dim, eps=1e-5) 22 | self.p_in = nn.Linear(dim, 2 * dim, bias=False) 23 | self.g_in = nn.Linear(dim, 2 * dim, bias=False) 24 | 25 | self.norm_out = nn.LayerNorm(dim) 26 | self.p_out = nn.Linear(dim, dim, bias=False) 27 | self.g_out = nn.Linear(dim, dim, bias=False) 28 | 29 | init.bias_init_one_(self.norm_in.weight) 30 | init.bias_init_zero_(self.norm_in.bias) 31 | 32 | init.lecun_normal_init_(self.p_in.weight) 33 | init.gating_init_(self.g_in.weight) 34 | 35 | init.bias_init_one_(self.norm_out.weight) 36 | init.bias_init_zero_(self.norm_out.bias) 37 | 38 | init.final_init_(self.p_out.weight) 39 | init.gating_init_(self.g_out.weight) 40 | 41 | def forward(self, x: Tensor, mask: Tensor) -> Tensor: 42 | """Perform a forward pass. 43 | 44 | Parameters 45 | ---------- 46 | x: torch.Tensor 47 | The input data of shape (B, N, N, D) 48 | mask: torch.Tensor 49 | The input mask of shape (B, N, N) 50 | 51 | Returns 52 | ------- 53 | x: torch.Tensor 54 | The output data of shape (B, N, N, D) 55 | 56 | """ 57 | # Input gating: D -> D 58 | x = self.norm_in(x) 59 | x_in = x 60 | x = self.p_in(x) * self.g_in(x).sigmoid() 61 | 62 | # Apply mask 63 | x = x * mask.unsqueeze(-1) 64 | 65 | # Split input and cast to float 66 | a, b = torch.chunk(x.float(), 2, dim=-1) 67 | 68 | # Triangular projection 69 | x = torch.einsum("bikd,bjkd->bijd", a, b) 70 | 71 | # Output gating 72 | x = self.p_out(self.norm_out(x)) * self.g_out(x_in).sigmoid() 73 | 74 | return x 75 | 76 | 77 | class TriangleMultiplicationIncoming(nn.Module): 78 | """TriangleMultiplicationIncoming.""" 79 | 80 | def __init__(self, dim: int = 128) -> None: 81 | """Initialize the TriangularUpdate module. 82 | 83 | Parameters 84 | ---------- 85 | dim: int 86 | The dimension of the input, default 128 87 | 88 | """ 89 | super().__init__() 90 | 91 | self.norm_in = nn.LayerNorm(dim, eps=1e-5) 92 | self.p_in = nn.Linear(dim, 2 * dim, bias=False) 93 | self.g_in = nn.Linear(dim, 2 * dim, bias=False) 94 | 95 | self.norm_out = nn.LayerNorm(dim) 96 | self.p_out = nn.Linear(dim, dim, bias=False) 97 | self.g_out = nn.Linear(dim, dim, bias=False) 98 | 99 | init.bias_init_one_(self.norm_in.weight) 100 | init.bias_init_zero_(self.norm_in.bias) 101 | 102 | init.lecun_normal_init_(self.p_in.weight) 103 | init.gating_init_(self.g_in.weight) 104 | 105 | init.bias_init_one_(self.norm_out.weight) 106 | init.bias_init_zero_(self.norm_out.bias) 107 | 108 | init.final_init_(self.p_out.weight) 109 | init.gating_init_(self.g_out.weight) 110 | 111 | def forward(self, x: Tensor, mask: Tensor) -> Tensor: 112 | """Perform a forward pass. 113 | 114 | Parameters 115 | ---------- 116 | x: torch.Tensor 117 | The input data of shape (B, N, N, D) 118 | mask: torch.Tensor 119 | The input mask of shape (B, N, N) 120 | 121 | Returns 122 | ------- 123 | x: torch.Tensor 124 | The output data of shape (B, N, N, D) 125 | 126 | """ 127 | # Input gating: D -> D 128 | x = self.norm_in(x) 129 | x_in = x 130 | x = self.p_in(x) * self.g_in(x).sigmoid() 131 | 132 | # Apply mask 133 | x = x * mask.unsqueeze(-1) 134 | 135 | # Split input and cast to float 136 | a, b = torch.chunk(x.float(), 2, dim=-1) 137 | 138 | # Triangular projection 139 | x = torch.einsum("bkid,bkjd->bijd", a, b) 140 | 141 | # Output gating 142 | x = self.p_out(self.norm_out(x)) * self.g_out(x_in).sigmoid() 143 | 144 | return x 145 | -------------------------------------------------------------------------------- /tests/test_regression.py: -------------------------------------------------------------------------------- 1 | import os 2 | import pickle 3 | from dataclasses import asdict 4 | import pprint 5 | 6 | import torch 7 | import torch.nn as nn 8 | 9 | import pytest 10 | import unittest 11 | 12 | from lightning_fabric import seed_everything 13 | 14 | from boltz.main import MODEL_URL 15 | from boltz.model.model import Boltz1 16 | 17 | import test_utils 18 | 19 | tests_dir = os.path.dirname(os.path.abspath(__file__)) 20 | test_data_dir = os.path.join(tests_dir, 'data') 21 | 22 | @pytest.mark.regression 23 | class RegressionTester(unittest.TestCase): 24 | 25 | @classmethod 26 | def setUpClass(cls): 27 | device = torch.device("cuda" if torch.cuda.is_available() else "cpu") 28 | cache = os.path.expanduser('~/.boltz') 29 | checkpoint_url = MODEL_URL 30 | model_name = checkpoint_url.split("/")[-1] 31 | checkpoint = os.path.join(cache, model_name) 32 | if not os.path.exists(checkpoint): 33 | test_utils.download_file(checkpoint_url, checkpoint) 34 | 35 | regression_feats_path = os.path.join(test_data_dir, 'ligand_regression_feats.pkl') 36 | if not os.path.exists(regression_feats_path): 37 | regression_feats_url = "https://www.dropbox.com/scl/fi/1avbcvoor5jcnvpt07tp6/ligand_regression_feats.pkl?rlkey=iwtm9gpxgrbp51jbizq937pqf&st=jnbky253&dl=1" 38 | test_utils.download_file(regression_feats_url, regression_feats_path) 39 | 40 | regression_feats = torch.load(regression_feats_path, map_location=device) 41 | model_module: nn.Module = Boltz1.load_from_checkpoint(checkpoint, map_location=device) 42 | model_module.to(device) 43 | model_module.eval() 44 | 45 | coords = regression_feats["feats"]["coords"] 46 | # Coords should be rank 4 47 | if len(coords.shape) == 3: 48 | coords = coords.unsqueeze(0) 49 | regression_feats["feats"]["coords"] = coords 50 | for key, val in regression_feats["feats"].items(): 51 | if hasattr(val, "to"): 52 | regression_feats["feats"][key] = val.to(device) 53 | 54 | cls.model_module = model_module.to(device) 55 | cls.regression_feats = regression_feats 56 | 57 | def test_input_embedder(self): 58 | exp_s_inputs = self.regression_feats["s_inputs"] 59 | act_s_inputs = self.model_module.input_embedder(self.regression_feats["feats"]) 60 | 61 | assert torch.allclose(exp_s_inputs, act_s_inputs, atol=1e-5) 62 | 63 | def test_rel_pos(self): 64 | exp_rel_pos_encoding = self.regression_feats["relative_position_encoding"] 65 | act_rel_pos_encoding = self.model_module.rel_pos(self.regression_feats["feats"]) 66 | 67 | assert torch.allclose(exp_rel_pos_encoding, act_rel_pos_encoding, atol=1e-5) 68 | 69 | @pytest.mark.slow 70 | def test_structure_output(self): 71 | exp_structure_output = self.regression_feats["structure_output"] 72 | s = self.regression_feats["s"] 73 | z = self.regression_feats["z"] 74 | s_inputs = self.regression_feats["s_inputs"] 75 | feats = self.regression_feats["feats"] 76 | relative_position_encoding = self.regression_feats["relative_position_encoding"] 77 | multiplicity_diffusion_train = self.regression_feats["multiplicity_diffusion_train"] 78 | 79 | self.model_module.structure_module.coordinate_augmentation = False 80 | self.model_module.structure_module.sigma_data = 0.0 81 | 82 | seed_everything(self.regression_feats["seed"]) 83 | act_structure_output = self.model_module.structure_module( 84 | s_trunk=s, 85 | z_trunk=z, 86 | s_inputs=s_inputs, 87 | feats=feats, 88 | relative_position_encoding=relative_position_encoding, 89 | multiplicity=multiplicity_diffusion_train, 90 | ) 91 | 92 | act_keys = act_structure_output.keys() 93 | exp_keys = exp_structure_output.keys() 94 | assert act_keys == exp_keys 95 | 96 | # Other keys have some randomness, so we will only check the keys that 97 | # we can make deterministic with sigma_data = 0.0 (above). 98 | check_keys = ["noised_atom_coords", "aligned_true_atom_coords"] 99 | for key in check_keys: 100 | exp_val = exp_structure_output[key] 101 | act_val = act_structure_output[key] 102 | assert exp_val.shape == act_val.shape, f"Shape mismatch in {key}" 103 | assert torch.allclose(exp_val, act_val, atol=1e-4) 104 | 105 | 106 | if __name__ == '__main__': 107 | unittest.main() 108 | -------------------------------------------------------------------------------- /scripts/script_utils/compile_pdb_structures.sh: -------------------------------------------------------------------------------- 1 | #!/bin/bash 2 | 3 | # Source directory containing subdirectories with structures 4 | SRC_DIR="/ist-nas/users/bunditb/boltz/scripts/examples/parsed_pdb_output" 5 | 6 | # Target directory where files will be compiled 7 | TARGET_DIR="/ist-nas/users/bunditb/boltz/scripts/examples/training_example/processed_pdb_structure" 8 | 9 | # Create target directory and subdirectories if they don't exist 10 | mkdir -p "$TARGET_DIR/records" 11 | mkdir -p "$TARGET_DIR/structure" 12 | 13 | # Count for progress reporting 14 | total_files=0 15 | processed_files=0 16 | 17 | # First, count the total number of .npz and .json files in records and structures directories 18 | total_files=$(find "$SRC_DIR" -path "*/structures/*.npz" -o -path "*/records/*.npz" -o -path "*/records/*.json" | wc -l) 19 | echo "Found $total_files files to process" 20 | 21 | # Process structure files 22 | echo "Processing structure files..." 23 | find "$SRC_DIR" -type d -name "structures" | while read struct_dir; do 24 | # Find all .npz files in this structure directory 25 | find "$struct_dir" -type f -name "*.npz" | while read file; do 26 | # Get the basename of the file 27 | filename=$(basename "$file") 28 | 29 | # Extract the file extension (.npz) 30 | extension="${filename##*.}" 31 | 32 | # Extract the base name without extension 33 | base="${filename%.*}" 34 | 35 | # Convert to lowercase before any _A or _B suffix 36 | if [[ "$base" =~ (.*)(_[AB])$ ]]; then 37 | # Get the part before the suffix 38 | prefix="${BASH_REMATCH[1]}" 39 | # Get the suffix (_A or _B) 40 | suffix="${BASH_REMATCH[2]}" 41 | 42 | # Convert the prefix to lowercase 43 | prefix_lower=$(echo "$prefix" | tr '[:upper:]' '[:lower:]') 44 | 45 | # Create the new filename with lowercase prefix and original suffix 46 | new_base="${prefix_lower}${suffix}" 47 | else 48 | # If there's no _A or _B suffix, just convert the whole base to lowercase 49 | new_base=$(echo "$base" | tr '[:upper:]' '[:lower:]') 50 | fi 51 | 52 | # Add back the extension 53 | new_filename="${new_base}.${extension}" 54 | 55 | # Copy the file to the structure subdirectory with the new name 56 | cp "$file" "$TARGET_DIR/structure/$new_filename" 57 | 58 | # Update processed files count 59 | processed_files=$((processed_files + 1)) 60 | 61 | # Print progress 62 | echo "[$processed_files/$total_files] Copied $filename to $TARGET_DIR/structure/$new_filename" 63 | done 64 | done 65 | 66 | # Process record files (.npz and .json) 67 | echo "Processing record files..." 68 | find "$SRC_DIR" -type d -name "records" | while read record_dir; do 69 | # Find all .npz and .json files in this record directory 70 | find "$record_dir" -type f \( -name "*.npz" -o -name "*.json" \) | while read file; do 71 | # Get the basename of the file 72 | filename=$(basename "$file") 73 | 74 | # Extract the file extension 75 | extension="${filename##*.}" 76 | 77 | # Extract the base name without extension 78 | base="${filename%.*}" 79 | 80 | # Convert to lowercase before any _A or _B suffix 81 | if [[ "$base" =~ (.*)(_[AB])$ ]]; then 82 | # Get the part before the suffix 83 | prefix="${BASH_REMATCH[1]}" 84 | # Get the suffix (_A or _B) 85 | suffix="${BASH_REMATCH[2]}" 86 | 87 | # Convert the prefix to lowercase 88 | prefix_lower=$(echo "$prefix" | tr '[:upper:]' '[:lower:]') 89 | 90 | # Create the new filename with lowercase prefix and original suffix 91 | new_base="${prefix_lower}${suffix}" 92 | else 93 | # If there's no _A or _B suffix, just convert the whole base to lowercase 94 | new_base=$(echo "$base" | tr '[:upper:]' '[:lower:]') 95 | fi 96 | 97 | # Add back the extension 98 | new_filename="${new_base}.${extension}" 99 | 100 | # Copy the file to the records subdirectory with the new name 101 | cp "$file" "$TARGET_DIR/records/$new_filename" 102 | 103 | # Update processed files count 104 | processed_files=$((processed_files + 1)) 105 | 106 | # Print progress 107 | echo "[$processed_files/$total_files] Copied $filename to $TARGET_DIR/records/$new_filename" 108 | done 109 | done 110 | 111 | echo "Compilation complete. All files are now available in:" 112 | echo " - Structure files: $TARGET_DIR/structure" 113 | echo " - Record files: $TARGET_DIR/records (both .npz and .json files)" -------------------------------------------------------------------------------- /src/boltz/model/layers/pair_averaging.py: -------------------------------------------------------------------------------- 1 | import torch 2 | from torch import Tensor, nn 3 | 4 | import boltz.model.layers.initialize as init 5 | 6 | 7 | class PairWeightedAveraging(nn.Module): 8 | """Pair weighted averaging layer.""" 9 | 10 | def __init__( 11 | self, 12 | c_m: int, 13 | c_z: int, 14 | c_h: int, 15 | num_heads: int, 16 | inf: float = 1e6, 17 | ) -> None: 18 | """Initialize the pair weighted averaging layer. 19 | 20 | Parameters 21 | ---------- 22 | c_m: int 23 | The dimension of the input sequence. 24 | c_z: int 25 | The dimension of the input pairwise tensor. 26 | c_h: int 27 | The dimension of the hidden. 28 | num_heads: int 29 | The number of heads. 30 | inf: float 31 | The value to use for masking, default 1e6. 32 | 33 | """ 34 | super().__init__() 35 | self.c_m = c_m 36 | self.c_z = c_z 37 | self.c_h = c_h 38 | self.num_heads = num_heads 39 | self.inf = inf 40 | 41 | self.norm_m = nn.LayerNorm(c_m) 42 | self.norm_z = nn.LayerNorm(c_z) 43 | 44 | self.proj_m = nn.Linear(c_m, c_h * num_heads, bias=False) 45 | self.proj_g = nn.Linear(c_m, c_h * num_heads, bias=False) 46 | self.proj_z = nn.Linear(c_z, num_heads, bias=False) 47 | self.proj_o = nn.Linear(c_h * num_heads, c_m, bias=False) 48 | init.final_init_(self.proj_o.weight) 49 | 50 | def forward( 51 | self, m: Tensor, z: Tensor, mask: Tensor, chunk_heads: False = bool 52 | ) -> Tensor: 53 | """Forward pass. 54 | 55 | Parameters 56 | ---------- 57 | m : torch.Tensor 58 | The input sequence tensor (B, S, N, D) 59 | z : torch.Tensor 60 | The input pairwise tensor (B, N, N, D) 61 | mask : torch.Tensor 62 | The pairwise mask tensor (B, N, N) 63 | 64 | Returns 65 | ------- 66 | torch.Tensor 67 | The output sequence tensor (B, S, N, D) 68 | 69 | """ 70 | # Compute layer norms 71 | m = self.norm_m(m) 72 | z = self.norm_z(z) 73 | 74 | if chunk_heads and not self.training: 75 | # Compute heads sequentially 76 | o_chunks = [] 77 | for head_idx in range(self.num_heads): 78 | sliced_weight_proj_m = self.proj_m.weight[ 79 | head_idx * self.c_h : (head_idx + 1) * self.c_h, : 80 | ] 81 | sliced_weight_proj_g = self.proj_g.weight[ 82 | head_idx * self.c_h : (head_idx + 1) * self.c_h, : 83 | ] 84 | sliced_weight_proj_z = self.proj_z.weight[head_idx : (head_idx + 1), :] 85 | sliced_weight_proj_o = self.proj_o.weight[ 86 | :, head_idx * self.c_h : (head_idx + 1) * self.c_h 87 | ] 88 | 89 | # Project input tensors 90 | v: Tensor = m @ sliced_weight_proj_m.T 91 | v = v.reshape(*v.shape[:3], 1, self.c_h) 92 | v = v.permute(0, 3, 1, 2, 4) 93 | 94 | # Compute weights 95 | b: Tensor = z @ sliced_weight_proj_z.T 96 | b = b.permute(0, 3, 1, 2) 97 | b = b + (1 - mask[:, None]) * -self.inf 98 | w = torch.softmax(b, dim=-1) 99 | 100 | # Compute gating 101 | g: Tensor = m @ sliced_weight_proj_g.T 102 | g = g.sigmoid() 103 | 104 | # Compute output 105 | o = torch.einsum("bhij,bhsjd->bhsid", w, v) 106 | o = o.permute(0, 2, 3, 1, 4) 107 | o = o.reshape(*o.shape[:3], 1 * self.c_h) 108 | o_chunks = g * o 109 | if head_idx == 0: 110 | o_out = o_chunks @ sliced_weight_proj_o.T 111 | else: 112 | o_out += o_chunks @ sliced_weight_proj_o.T 113 | return o_out 114 | else: 115 | # Project input tensors 116 | v: Tensor = self.proj_m(m) 117 | v = v.reshape(*v.shape[:3], self.num_heads, self.c_h) 118 | v = v.permute(0, 3, 1, 2, 4) 119 | 120 | # Compute weights 121 | b: Tensor = self.proj_z(z) 122 | b = b.permute(0, 3, 1, 2) 123 | b = b + (1 - mask[:, None]) * -self.inf 124 | w = torch.softmax(b, dim=-1) 125 | 126 | # Compute gating 127 | g: Tensor = self.proj_g(m) 128 | g = g.sigmoid() 129 | 130 | # Compute output 131 | o = torch.einsum("bhij,bhsjd->bhsid", w, v) 132 | o = o.permute(0, 2, 3, 1, 4) 133 | o = o.reshape(*o.shape[:3], self.num_heads * self.c_h) 134 | o = self.proj_o(g * o) 135 | return o 136 | -------------------------------------------------------------------------------- /scripts/process/rna/rna_example.py: -------------------------------------------------------------------------------- 1 | #!/usr/bin/env python 2 | """ 3 | Example script demonstrating how to use the Stanford RNA dataset parsing functions. 4 | 5 | This script shows how to: 6 | 1. Convert Stanford RNA dataset entries to PDB format 7 | 2. Parse these PDB files into ParsedStructure objects for further processing 8 | """ 9 | 10 | import os 11 | import sys 12 | import argparse 13 | from typing import Dict, List 14 | 15 | from rdkit.Chem import AllChem 16 | import numpy as np 17 | 18 | # Fix the import path 19 | sys.path.insert(0, os.path.abspath(os.path.dirname(os.path.dirname(os.path.dirname(os.path.dirname(__file__)))))) 20 | 21 | # Import the necessary modules with direct relative import 22 | from pdb import prepare_rna_from_csv, parse_stanford_rna_structure 23 | 24 | 25 | def load_components() -> Dict: 26 | """Load the PDB components dictionary. 27 | 28 | This is a simplified version that loads a minimal set of components. 29 | 30 | Returns 31 | ------- 32 | Dict 33 | Dictionary of PDB components 34 | """ 35 | # Create a minimal components dictionary with RNA nucleotides 36 | components = {} 37 | 38 | # Define the standard RNA nucleotides 39 | nucleotides = ['A', 'C', 'G', 'U'] 40 | 41 | for nuc in nucleotides: 42 | # Create a simple molecule for each nucleotide 43 | mol = AllChem.MolFromSmiles('P') # Phosphate atom 44 | mol.SetProp("name", nuc) 45 | 46 | # Set atom properties 47 | for atom in mol.GetAtoms(): 48 | atom.SetProp("name", "P") # Set atom name 49 | 50 | # Store as single letter key 51 | components[nuc] = mol 52 | 53 | print(f"Loaded {len(components)} components") 54 | return components 55 | 56 | 57 | def main(args): 58 | """Main function to demonstrate RNA structure parsing.""" 59 | print("Demonstrating Stanford RNA dataset parsing") 60 | 61 | # Load RNA components 62 | components = load_components() 63 | 64 | # Set paths to the CSV files 65 | csv_path = args.labels_csv or "/ist-nas/users/bunditb/boltz/stanford-rna/train_labels.csv" 66 | seq_csv_path = args.sequences_csv or "/ist-nas/users/bunditb/boltz/stanford-rna/train_sequences.csv" 67 | 68 | # Create output directory for PDB files 69 | output_dir = args.output_dir 70 | if output_dir: 71 | os.makedirs(output_dir, exist_ok=True) 72 | 73 | # Generate PDB files for all RNA structures 74 | if args.generate_all: 75 | print(f"Generating PDB files for all RNA structures in {csv_path}") 76 | pdb_paths = prepare_rna_from_csv(csv_path, seq_csv_path, output_dir) 77 | print(f"Generated {len(pdb_paths)} PDB files") 78 | 79 | # Print the first few RNA IDs 80 | print("First few RNA IDs:") 81 | for i, rna_id in enumerate(list(pdb_paths.keys())[:5]): 82 | print(f" {i+1}. {rna_id}: {pdb_paths[rna_id]}") 83 | 84 | # Parse specific RNA structure 85 | if args.rna_id: 86 | print(f"Parsing RNA structure: {args.rna_id}") 87 | try: 88 | parsed_structure = parse_stanford_rna_structure( 89 | args.rna_id, 90 | components, 91 | csv_path, 92 | seq_csv_path, 93 | output_dir 94 | ) 95 | 96 | # Print structure info 97 | print("Structure info:") 98 | print(f" Number of chains: {parsed_structure.data.chains.shape[0]}") 99 | print(f" Number of residues: {parsed_structure.data.residues.shape[0]}") 100 | print(f" Number of atoms: {parsed_structure.data.atoms.shape[0]}") 101 | 102 | # Print first few atoms 103 | if parsed_structure.data.atoms.shape[0] > 0: 104 | print("First few atoms:") 105 | for i in range(min(5, parsed_structure.data.atoms.shape[0])): 106 | atom = parsed_structure.data.atoms[i] 107 | print(f" Atom {i+1}: Element={atom['element']}, Coords={atom['coords']}") 108 | 109 | except Exception as e: 110 | print(f"Error parsing RNA structure {args.rna_id}: {e}") 111 | 112 | 113 | if __name__ == "__main__": 114 | parser = argparse.ArgumentParser(description="Demonstrate Stanford RNA dataset parsing") 115 | parser.add_argument("--rna_id", type=str, help="RNA structure ID to parse (e.g., '1SCL_A')") 116 | parser.add_argument("--labels_csv", type=str, help="Path to the labels CSV file") 117 | parser.add_argument("--sequences_csv", type=str, help="Path to the sequences CSV file") 118 | parser.add_argument("--output_dir", type=str, help="Directory to save generated PDB files") 119 | parser.add_argument("--generate_all", action="store_true", help="Generate PDB files for all RNA structures") 120 | 121 | args = parser.parse_args() 122 | 123 | if not (args.rna_id or args.generate_all): 124 | parser.error("At least one of --rna_id or --generate_all must be specified") 125 | 126 | main(args) -------------------------------------------------------------------------------- /scripts/train/configs/structure.yaml: -------------------------------------------------------------------------------- 1 | trainer: 2 | accelerator: gpu 3 | devices: 1 4 | precision: 32 5 | gradient_clip_val: 10.0 6 | max_epochs: -1 7 | accumulate_grad_batches: 128 # to adjust depending on the number of devices 8 | 9 | # Optional set wandb here 10 | # wandb: 11 | # name: boltz 12 | # project: boltz 13 | # entity: boltz 14 | 15 | output: SET_PATH_HERE 16 | pretrained: PATH_TO_CHECKPOINT_FILE 17 | resume: null 18 | disable_checkpoint: false 19 | matmul_precision: null 20 | save_top_k: -1 21 | 22 | data: 23 | datasets: 24 | - _target_: boltz.data.module.training.DatasetConfig 25 | target_dir: PATH_TO_TARGETS_DIR 26 | msa_dir: PATH_TO_MSA_DIR 27 | prob: 1.0 28 | sampler: 29 | _target_: boltz.data.sample.cluster.ClusterSampler 30 | cropper: 31 | _target_: boltz.data.crop.boltz.BoltzCropper 32 | min_neighborhood: 0 33 | max_neighborhood: 40 34 | split: ./scripts/train/assets/validation_ids.txt 35 | 36 | filters: 37 | - _target_: boltz.data.filter.dynamic.size.SizeFilter 38 | min_chains: 1 39 | max_chains: 300 40 | - _target_: boltz.data.filter.dynamic.date.DateFilter 41 | date: "2021-09-30" 42 | ref: released 43 | - _target_: boltz.data.filter.dynamic.resolution.ResolutionFilter 44 | resolution: 9.0 45 | 46 | tokenizer: 47 | _target_: boltz.data.tokenize.boltz.BoltzTokenizer 48 | featurizer: 49 | _target_: boltz.data.feature.featurizer.BoltzFeaturizer 50 | 51 | symmetries: PATH_TO_SYMMETRY_FILE 52 | max_tokens: 512 53 | max_atoms: 4608 54 | max_seqs: 2048 55 | pad_to_max_tokens: true 56 | pad_to_max_atoms: true 57 | pad_to_max_seqs: true 58 | samples_per_epoch: 100000 59 | batch_size: 1 60 | num_workers: 4 61 | random_seed: 42 62 | pin_memory: true 63 | overfit: null 64 | crop_validation: false 65 | return_train_symmetries: false 66 | return_val_symmetries: true 67 | train_binder_pocket_conditioned_prop: 0.3 68 | val_binder_pocket_conditioned_prop: 0.3 69 | binder_pocket_cutoff: 6.0 70 | binder_pocket_sampling_geometric_p: 0.3 71 | min_dist: 2.0 72 | max_dist: 22.0 73 | num_bins: 64 74 | atoms_per_window_queries: 32 75 | 76 | model: 77 | _target_: boltz.model.model.Boltz1 78 | atom_s: 128 79 | atom_z: 16 80 | token_s: 384 81 | token_z: 128 82 | num_bins: 64 83 | atom_feature_dim: 389 84 | atoms_per_window_queries: 32 85 | atoms_per_window_keys: 128 86 | compile_pairformer: false 87 | nucleotide_rmsd_weight: 5.0 88 | ligand_rmsd_weight: 10.0 89 | ema: true 90 | ema_decay: 0.999 91 | 92 | embedder_args: 93 | atom_encoder_depth: 3 94 | atom_encoder_heads: 4 95 | 96 | msa_args: 97 | msa_s: 64 98 | msa_blocks: 4 99 | msa_dropout: 0.15 100 | z_dropout: 0.25 101 | pairwise_head_width: 32 102 | pairwise_num_heads: 4 103 | activation_checkpointing: true 104 | offload_to_cpu: false 105 | 106 | pairformer_args: 107 | num_blocks: 48 108 | num_heads: 16 109 | dropout: 0.25 110 | activation_checkpointing: true 111 | offload_to_cpu: false 112 | 113 | score_model_args: 114 | sigma_data: 16 115 | dim_fourier: 256 116 | atom_encoder_depth: 3 117 | atom_encoder_heads: 4 118 | token_transformer_depth: 24 119 | token_transformer_heads: 16 120 | atom_decoder_depth: 3 121 | atom_decoder_heads: 4 122 | conditioning_transition_layers: 2 123 | activation_checkpointing: true 124 | offload_to_cpu: false 125 | 126 | confidence_prediction: false 127 | confidence_model_args: 128 | num_dist_bins: 64 129 | max_dist: 22 130 | add_s_to_z_prod: true 131 | add_s_input_to_s: true 132 | use_s_diffusion: true 133 | add_z_input_to_z: true 134 | 135 | confidence_args: 136 | num_plddt_bins: 50 137 | num_pde_bins: 64 138 | num_pae_bins: 64 139 | 140 | training_args: 141 | recycling_steps: 3 142 | sampling_steps: 20 143 | diffusion_multiplicity: 16 144 | diffusion_samples: 2 145 | confidence_loss_weight: 1e-4 146 | diffusion_loss_weight: 4.0 147 | distogram_loss_weight: 3e-2 148 | adam_beta_1: 0.9 149 | adam_beta_2: 0.95 150 | adam_eps: 0.00000001 151 | lr_scheduler: af3 152 | base_lr: 0.0 153 | max_lr: 0.0018 154 | lr_warmup_no_steps: 1000 155 | lr_start_decay_after_n_steps: 50000 156 | lr_decay_every_n_steps: 50000 157 | lr_decay_factor: 0.95 158 | 159 | validation_args: 160 | recycling_steps: 3 161 | sampling_steps: 200 162 | diffusion_samples: 5 163 | symmetry_correction: true 164 | run_confidence_sequentially: false 165 | 166 | diffusion_process_args: 167 | sigma_min: 0.0004 168 | sigma_max: 160.0 169 | sigma_data: 16.0 170 | rho: 7 171 | P_mean: -1.2 172 | P_std: 1.5 173 | gamma_0: 0.8 174 | gamma_min: 1.0 175 | noise_scale: 1.0 176 | step_scale: 1.0 177 | coordinate_augmentation: true 178 | alignment_reverse_diff: true 179 | synchronize_sigmas: true 180 | use_inference_model_cache: true 181 | 182 | diffusion_loss_args: 183 | add_smooth_lddt_loss: true 184 | nucleotide_loss_weight: 5.0 185 | ligand_loss_weight: 10.0 186 | -------------------------------------------------------------------------------- /scripts/train/configs/full.yaml: -------------------------------------------------------------------------------- 1 | trainer: 2 | accelerator: gpu 3 | devices: 1 4 | precision: 32 5 | gradient_clip_val: 10.0 6 | max_epochs: -1 7 | accumulate_grad_batches: 128 # to adjust depending on the number of devices 8 | 9 | # Optional set wandb here 10 | # wandb: 11 | # name: boltz 12 | # project: boltz 13 | # entity: boltz 14 | 15 | 16 | output: SET_PATH_HERE 17 | pretrained: PATH_TO_CHECKPOINT_FILE 18 | resume: null 19 | disable_checkpoint: false 20 | matmul_precision: null 21 | save_top_k: -1 22 | 23 | data: 24 | datasets: 25 | - _target_: boltz.data.module.training.DatasetConfig 26 | target_dir: PATH_TO_TARGETS_DIR 27 | msa_dir: PATH_TO_MSA_DIR 28 | prob: 1.0 29 | sampler: 30 | _target_: boltz.data.sample.cluster.ClusterSampler 31 | cropper: 32 | _target_: boltz.data.crop.boltz.BoltzCropper 33 | min_neighborhood: 0 34 | max_neighborhood: 40 35 | split: ./scripts/train/assets/validation_ids.txt 36 | 37 | filters: 38 | - _target_: boltz.data.filter.dynamic.size.SizeFilter 39 | min_chains: 1 40 | max_chains: 300 41 | - _target_: boltz.data.filter.dynamic.date.DateFilter 42 | date: "2021-09-30" 43 | ref: released 44 | - _target_: boltz.data.filter.dynamic.resolution.ResolutionFilter 45 | resolution: 4.0 46 | 47 | tokenizer: 48 | _target_: boltz.data.tokenize.boltz.BoltzTokenizer 49 | featurizer: 50 | _target_: boltz.data.feature.featurizer.BoltzFeaturizer 51 | 52 | symmetries: PATH_TO_SYMMETRY_FILE 53 | max_tokens: 512 54 | max_atoms: 4608 55 | max_seqs: 2048 56 | pad_to_max_tokens: true 57 | pad_to_max_atoms: true 58 | pad_to_max_seqs: true 59 | samples_per_epoch: 100000 60 | batch_size: 1 61 | num_workers: 4 62 | random_seed: 42 63 | pin_memory: true 64 | overfit: null 65 | crop_validation: true 66 | return_train_symmetries: true 67 | return_val_symmetries: true 68 | train_binder_pocket_conditioned_prop: 0.3 69 | val_binder_pocket_conditioned_prop: 0.3 70 | binder_pocket_cutoff: 6.0 71 | binder_pocket_sampling_geometric_p: 0.3 72 | min_dist: 2.0 73 | max_dist: 22.0 74 | num_bins: 64 75 | atoms_per_window_queries: 32 76 | 77 | model: 78 | _target_: boltz.model.model.Boltz1 79 | atom_s: 128 80 | atom_z: 16 81 | token_s: 384 82 | token_z: 128 83 | num_bins: 64 84 | atom_feature_dim: 389 85 | atoms_per_window_queries: 32 86 | atoms_per_window_keys: 128 87 | compile_pairformer: false 88 | nucleotide_rmsd_weight: 5.0 89 | ligand_rmsd_weight: 10.0 90 | ema: true 91 | ema_decay: 0.999 92 | 93 | embedder_args: 94 | atom_encoder_depth: 3 95 | atom_encoder_heads: 4 96 | 97 | msa_args: 98 | msa_s: 64 99 | msa_blocks: 4 100 | msa_dropout: 0.15 101 | z_dropout: 0.25 102 | pairwise_head_width: 32 103 | pairwise_num_heads: 4 104 | activation_checkpointing: true 105 | offload_to_cpu: false 106 | 107 | pairformer_args: 108 | num_blocks: 48 109 | num_heads: 16 110 | dropout: 0.25 111 | activation_checkpointing: true 112 | offload_to_cpu: false 113 | 114 | score_model_args: 115 | sigma_data: 16 116 | dim_fourier: 256 117 | atom_encoder_depth: 3 118 | atom_encoder_heads: 4 119 | token_transformer_depth: 24 120 | token_transformer_heads: 16 121 | atom_decoder_depth: 3 122 | atom_decoder_heads: 4 123 | conditioning_transition_layers: 2 124 | activation_checkpointing: true 125 | offload_to_cpu: false 126 | 127 | structure_prediction_training: true 128 | confidence_prediction: true 129 | alpha_pae: 1 130 | confidence_imitate_trunk: true 131 | confidence_model_args: 132 | num_dist_bins: 64 133 | max_dist: 22 134 | add_s_to_z_prod: true 135 | add_s_input_to_s: true 136 | use_s_diffusion: true 137 | add_z_input_to_z: true 138 | 139 | confidence_args: 140 | num_plddt_bins: 50 141 | num_pde_bins: 64 142 | num_pae_bins: 64 143 | 144 | training_args: 145 | recycling_steps: 3 146 | sampling_steps: 200 147 | diffusion_multiplicity: 16 148 | diffusion_samples: 1 149 | confidence_loss_weight: 3e-3 150 | diffusion_loss_weight: 4.0 151 | distogram_loss_weight: 3e-2 152 | adam_beta_1: 0.9 153 | adam_beta_2: 0.95 154 | adam_eps: 0.00000001 155 | lr_scheduler: af3 156 | base_lr: 0.0 157 | max_lr: 0.0018 158 | lr_warmup_no_steps: 1000 159 | lr_start_decay_after_n_steps: 50000 160 | lr_decay_every_n_steps: 50000 161 | lr_decay_factor: 0.95 162 | symmetry_correction: true 163 | run_confidence_sequentially: false 164 | 165 | validation_args: 166 | recycling_steps: 3 167 | sampling_steps: 200 168 | diffusion_samples: 5 169 | symmetry_correction: true 170 | run_confidence_sequentially: true 171 | 172 | diffusion_process_args: 173 | sigma_min: 0.0004 174 | sigma_max: 160.0 175 | sigma_data: 16.0 176 | rho: 7 177 | P_mean: -1.2 178 | P_std: 1.5 179 | gamma_0: 0.8 180 | gamma_min: 1.0 181 | noise_scale: 1.0 182 | step_scale: 1.0 183 | coordinate_augmentation: true 184 | alignment_reverse_diff: true 185 | synchronize_sigmas: true 186 | use_inference_model_cache: true 187 | 188 | diffusion_loss_args: 189 | add_smooth_lddt_loss: true 190 | nucleotide_loss_weight: 5.0 191 | ligand_loss_weight: 10.0 192 | -------------------------------------------------------------------------------- /scripts/train/configs/confidence.yaml: -------------------------------------------------------------------------------- 1 | trainer: 2 | accelerator: gpu 3 | devices: 1 4 | precision: 32 5 | gradient_clip_val: 10.0 6 | max_epochs: -1 7 | accumulate_grad_batches: 128 # to adjust depending on the number of devices 8 | 9 | # Optional set wandb here 10 | # wandb: 11 | # name: boltz 12 | # project: boltz 13 | # entity: boltz 14 | 15 | 16 | output: SET_PATH_HERE 17 | pretrained: PATH_TO_STRUCTURE_CHECKPOINT_FILE 18 | resume: null 19 | disable_checkpoint: false 20 | matmul_precision: null 21 | save_top_k: -1 22 | load_confidence_from_trunk: false # should be set to true only when starting from scratch, not from a pretrained confidence model 23 | 24 | data: 25 | datasets: 26 | - _target_: boltz.data.module.training.DatasetConfig 27 | target_dir: PATH_TO_TARGETS_DIR 28 | msa_dir: PATH_TO_MSA_DIR 29 | prob: 1.0 30 | sampler: 31 | _target_: boltz.data.sample.cluster.ClusterSampler 32 | cropper: 33 | _target_: boltz.data.crop.boltz.BoltzCropper 34 | min_neighborhood: 0 35 | max_neighborhood: 40 36 | split: ./scripts/train/assets/validation_ids.txt 37 | 38 | filters: 39 | - _target_: boltz.data.filter.dynamic.size.SizeFilter 40 | min_chains: 1 41 | max_chains: 300 42 | - _target_: boltz.data.filter.dynamic.date.DateFilter 43 | date: "2021-09-30" 44 | ref: released 45 | - _target_: boltz.data.filter.dynamic.resolution.ResolutionFilter 46 | resolution: 4.0 47 | 48 | tokenizer: 49 | _target_: boltz.data.tokenize.boltz.BoltzTokenizer 50 | featurizer: 51 | _target_: boltz.data.feature.featurizer.BoltzFeaturizer 52 | 53 | symmetries: PATH_TO_SYMMETRY_FILE 54 | max_tokens: 512 55 | max_atoms: 4608 56 | max_seqs: 2048 57 | pad_to_max_tokens: true 58 | pad_to_max_atoms: true 59 | pad_to_max_seqs: true 60 | samples_per_epoch: 100000 61 | batch_size: 1 62 | num_workers: 4 63 | random_seed: 42 64 | pin_memory: true 65 | overfit: null 66 | crop_validation: true 67 | return_train_symmetries: true 68 | return_val_symmetries: true 69 | train_binder_pocket_conditioned_prop: 0.3 70 | val_binder_pocket_conditioned_prop: 0.3 71 | binder_pocket_cutoff: 6.0 72 | binder_pocket_sampling_geometric_p: 0.3 73 | min_dist: 2.0 74 | max_dist: 22.0 75 | num_bins: 64 76 | atoms_per_window_queries: 32 77 | 78 | model: 79 | _target_: boltz.model.model.Boltz1 80 | atom_s: 128 81 | atom_z: 16 82 | token_s: 384 83 | token_z: 128 84 | num_bins: 64 85 | atom_feature_dim: 389 86 | atoms_per_window_queries: 32 87 | atoms_per_window_keys: 128 88 | compile_pairformer: false 89 | nucleotide_rmsd_weight: 5.0 90 | ligand_rmsd_weight: 10.0 91 | ema: true 92 | ema_decay: 0.999 93 | 94 | embedder_args: 95 | atom_encoder_depth: 3 96 | atom_encoder_heads: 4 97 | 98 | msa_args: 99 | msa_s: 64 100 | msa_blocks: 4 101 | msa_dropout: 0.15 102 | z_dropout: 0.25 103 | pairwise_head_width: 32 104 | pairwise_num_heads: 4 105 | activation_checkpointing: true 106 | offload_to_cpu: false 107 | 108 | pairformer_args: 109 | num_blocks: 48 110 | num_heads: 16 111 | dropout: 0.25 112 | activation_checkpointing: true 113 | offload_to_cpu: false 114 | 115 | score_model_args: 116 | sigma_data: 16 117 | dim_fourier: 256 118 | atom_encoder_depth: 3 119 | atom_encoder_heads: 4 120 | token_transformer_depth: 24 121 | token_transformer_heads: 16 122 | atom_decoder_depth: 3 123 | atom_decoder_heads: 4 124 | conditioning_transition_layers: 2 125 | activation_checkpointing: true 126 | offload_to_cpu: false 127 | 128 | structure_prediction_training: false 129 | confidence_prediction: true 130 | alpha_pae: 1 131 | confidence_imitate_trunk: true 132 | confidence_model_args: 133 | num_dist_bins: 64 134 | max_dist: 22 135 | add_s_to_z_prod: true 136 | add_s_input_to_s: true 137 | use_s_diffusion: true 138 | add_z_input_to_z: true 139 | 140 | confidence_args: 141 | num_plddt_bins: 50 142 | num_pde_bins: 64 143 | num_pae_bins: 64 144 | 145 | training_args: 146 | recycling_steps: 3 147 | sampling_steps: 200 148 | diffusion_multiplicity: 16 149 | diffusion_samples: 1 150 | confidence_loss_weight: 3e-3 151 | diffusion_loss_weight: 4.0 152 | distogram_loss_weight: 3e-2 153 | adam_beta_1: 0.9 154 | adam_beta_2: 0.95 155 | adam_eps: 0.00000001 156 | lr_scheduler: af3 157 | base_lr: 0.0 158 | max_lr: 0.0018 159 | lr_warmup_no_steps: 1000 160 | lr_start_decay_after_n_steps: 50000 161 | lr_decay_every_n_steps: 50000 162 | lr_decay_factor: 0.95 163 | symmetry_correction: true 164 | run_confidence_sequentially: false 165 | 166 | validation_args: 167 | recycling_steps: 3 168 | sampling_steps: 200 169 | diffusion_samples: 5 170 | symmetry_correction: true 171 | run_confidence_sequentially: true 172 | 173 | diffusion_process_args: 174 | sigma_min: 0.0004 175 | sigma_max: 160.0 176 | sigma_data: 16.0 177 | rho: 7 178 | P_mean: -1.2 179 | P_std: 1.5 180 | gamma_0: 0.8 181 | gamma_min: 1.0 182 | noise_scale: 1.0 183 | step_scale: 1.0 184 | coordinate_augmentation: true 185 | alignment_reverse_diff: true 186 | synchronize_sigmas: true 187 | use_inference_model_cache: true 188 | 189 | diffusion_loss_args: 190 | add_smooth_lddt_loss: true 191 | nucleotide_loss_weight: 5.0 192 | ligand_loss_weight: 10.0 193 | -------------------------------------------------------------------------------- /src/boltz/data/write/pdb.py: -------------------------------------------------------------------------------- 1 | from typing import Optional 2 | 3 | from rdkit import Chem 4 | from torch import Tensor 5 | 6 | from boltz.data import const 7 | from boltz.data.types import Structure 8 | 9 | 10 | def to_pdb(structure: Structure, plddts: Optional[Tensor] = None) -> str: # noqa: PLR0915 11 | """Write a structure into a PDB file. 12 | 13 | Parameters 14 | ---------- 15 | structure : Structure 16 | The input structure 17 | 18 | Returns 19 | ------- 20 | str 21 | the output PDB file 22 | 23 | """ 24 | pdb_lines = [] 25 | 26 | atom_index = 1 27 | atom_reindex_ter = [] 28 | 29 | # Load periodic table for element mapping 30 | periodic_table = Chem.GetPeriodicTable() 31 | 32 | # Index into plddt tensor for current residue. 33 | res_num = 0 34 | # Tracks non-ligand plddt tensor indices, 35 | # Initializing to -1 handles case where ligand is resnum 0 36 | prev_polymer_resnum = -1 37 | # Tracks ligand indices. 38 | ligand_index_offset = 0 39 | 40 | # Add all atom sites. 41 | for chain in structure.chains: 42 | # We rename the chains in alphabetical order 43 | chain_idx = chain["asym_id"] 44 | chain_tag = chain["name"] 45 | 46 | res_start = chain["res_idx"] 47 | res_end = chain["res_idx"] + chain["res_num"] 48 | 49 | residues = structure.residues[res_start:res_end] 50 | for residue in residues: 51 | atom_start = residue["atom_idx"] 52 | atom_end = residue["atom_idx"] + residue["atom_num"] 53 | atoms = structure.atoms[atom_start:atom_end] 54 | atom_coords = atoms["coords"] 55 | for i, atom in enumerate(atoms): 56 | # This should not happen on predictions, but just in case. 57 | if not atom["is_present"]: 58 | continue 59 | 60 | record_type = ( 61 | "ATOM" 62 | if chain["mol_type"] != const.chain_type_ids["NONPOLYMER"] 63 | else "HETATM" 64 | ) 65 | name = atom["name"] 66 | name = [chr(c + 32) for c in name if c != 0] 67 | name = "".join(name) 68 | name = name if len(name) == 4 else f" {name}" # noqa: PLR2004 69 | alt_loc = "" 70 | insertion_code = "" 71 | occupancy = 1.00 72 | element = periodic_table.GetElementSymbol(atom["element"].item()) 73 | element = element.upper() 74 | charge = "" 75 | residue_index = residue["res_idx"] + 1 76 | pos = atom_coords[i] 77 | res_name_3 = ( 78 | "LIG" if record_type == "HETATM" else str(residue["name"][:3]) 79 | ) 80 | 81 | if record_type != 'HETATM': 82 | # The current residue plddt is stored at the res_num index unless a ligand has previouly been added. 83 | b_factor = ( 84 | 100.00 if plddts is None else round(plddts[res_num + ligand_index_offset].item() * 100, 2) 85 | ) 86 | prev_polymer_resnum = res_num 87 | else: 88 | # If not a polymer resnum, we can get index into plddts by adding offset relative to previous polymer resnum. 89 | ligand_index_offset += 1 90 | b_factor = ( 91 | 100.00 if plddts is None else round(plddts[prev_polymer_resnum + ligand_index_offset].item() * 100, 2) 92 | ) 93 | 94 | # PDB is a columnar format, every space matters here! 95 | atom_line = ( 96 | f"{record_type:<6}{atom_index:>5} {name:<4}{alt_loc:>1}" 97 | f"{res_name_3:>3} {chain_tag:>1}" 98 | f"{residue_index:>4}{insertion_code:>1} " 99 | f"{pos[0]:>8.3f}{pos[1]:>8.3f}{pos[2]:>8.3f}" 100 | f"{occupancy:>6.2f}{b_factor:>6.2f} " 101 | f"{element:>2}{charge:>2}" 102 | ) 103 | pdb_lines.append(atom_line) 104 | atom_reindex_ter.append(atom_index) 105 | atom_index += 1 106 | 107 | if record_type != 'HETATM': 108 | res_num += 1 109 | 110 | should_terminate = chain_idx < (len(structure.chains) - 1) 111 | if should_terminate: 112 | # Close the chain. 113 | chain_end = "TER" 114 | chain_termination_line = ( 115 | f"{chain_end:<6}{atom_index:>5} " 116 | f"{res_name_3:>3} " 117 | f"{chain_tag:>1}{residue_index:>4}" 118 | ) 119 | pdb_lines.append(chain_termination_line) 120 | atom_index += 1 121 | 122 | # Dump CONECT records. 123 | for bonds in [structure.bonds, structure.connections]: 124 | for bond in bonds: 125 | atom1 = structure.atoms[bond["atom_1"]] 126 | atom2 = structure.atoms[bond["atom_2"]] 127 | if not atom1["is_present"] or not atom2["is_present"]: 128 | continue 129 | atom1_idx = atom_reindex_ter[bond["atom_1"]] 130 | atom2_idx = atom_reindex_ter[bond["atom_2"]] 131 | conect_line = f"CONECT{atom1_idx:>5}{atom2_idx:>5}" 132 | pdb_lines.append(conect_line) 133 | 134 | pdb_lines.append("END") 135 | pdb_lines.append("") 136 | pdb_lines = [line.ljust(80) for line in pdb_lines] 137 | return "\n".join(pdb_lines) 138 | -------------------------------------------------------------------------------- /scripts/train/assets/test_ids.txt: -------------------------------------------------------------------------------- 1 | 8BZ4 2 | 8URN 3 | 7U71 4 | 7Z64 5 | 7Y3Z 6 | 8SOT 7 | 8GH8 8 | 8IIB 9 | 7U08 10 | 8EB5 11 | 8G49 12 | 8K7Y 13 | 7QQD 14 | 8EIL 15 | 8JQE 16 | 8V1K 17 | 7ZRZ 18 | 7YN2 19 | 8D40 20 | 8RXO 21 | 8SXS 22 | 7UDL 23 | 8ADD 24 | 7Z3I 25 | 7YUK 26 | 7XWY 27 | 8F9Y 28 | 8WO7 29 | 8C27 30 | 8I3J 31 | 8HVC 32 | 8SXU 33 | 8K1I 34 | 8FTV 35 | 8ERC 36 | 8DVQ 37 | 8DTQ 38 | 8J12 39 | 8D0P 40 | 8POG 41 | 8HN0 42 | 7QPK 43 | 8AGR 44 | 8GXR 45 | 8K7X 46 | 8BL6 47 | 8HAW 48 | 8SRO 49 | 8HHM 50 | 8C26 51 | 7SPQ 52 | 8SME 53 | 7XGV 54 | 8GTY 55 | 8Q42 56 | 8BRY 57 | 8HDV 58 | 8B3Z 59 | 7XNJ 60 | 8EEL 61 | 8IOI 62 | 8Q70 63 | 8Y4U 64 | 8ANT 65 | 8IUB 66 | 8D49 67 | 8CPQ 68 | 8BAT 69 | 8E2B 70 | 8IWP 71 | 8IJT 72 | 7Y01 73 | 8CJG 74 | 8HML 75 | 8WU2 76 | 8VRM 77 | 8J1J 78 | 8DAJ 79 | 8SUT 80 | 8PTJ 81 | 8IVZ 82 | 8SDZ 83 | 7YDQ 84 | 8JU7 85 | 8K34 86 | 8B6Q 87 | 8F7N 88 | 8IBZ 89 | 7WOI 90 | 8R7D 91 | 8T65 92 | 8IQC 93 | 8SIU 94 | 8QK8 95 | 8HIG 96 | 7Y43 97 | 8IN8 98 | 8IBW 99 | 8GOY 100 | 7ZAO 101 | 8J9G 102 | 7ZCA 103 | 8HIO 104 | 8EFZ 105 | 8IQ8 106 | 8OQ0 107 | 8HHL 108 | 7XMW 109 | 8GI1 110 | 8AYR 111 | 7ZCB 112 | 8BRD 113 | 8IN6 114 | 8I3F 115 | 8HIU 116 | 8ER5 117 | 8WIL 118 | 7YPR 119 | 8UA2 120 | 8BW6 121 | 8IL8 122 | 8J3R 123 | 8K1F 124 | 8OHI 125 | 8WCT 126 | 8AN0 127 | 8BDQ 128 | 7FCT 129 | 8J69 130 | 8HTX 131 | 8PE3 132 | 8K5U 133 | 8AXT 134 | 8PSO 135 | 8JHR 136 | 8GY0 137 | 8QCW 138 | 8K3D 139 | 8P6J 140 | 8J0Q 141 | 7XS3 142 | 8DHJ 143 | 8EIN 144 | 7WKP 145 | 8GAQ 146 | 7WRN 147 | 8AHD 148 | 7SC4 149 | 8B3E 150 | 8AAS 151 | 8UZ8 152 | 8Q1K 153 | 8K5K 154 | 8B45 155 | 8PT7 156 | 7ZPN 157 | 8UQ9 158 | 8TJG 159 | 8TN8 160 | 8B2E 161 | 7XFZ 162 | 8FW7 163 | 8B3W 164 | 7T4W 165 | 8SVA 166 | 7YL4 167 | 8GLD 168 | 8OEI 169 | 8GMX 170 | 8OWF 171 | 8FNR 172 | 8IRQ 173 | 8JDG 174 | 7UXA 175 | 8TKA 176 | 7YH1 177 | 8HUZ 178 | 8TA2 179 | 8E5D 180 | 7YUN 181 | 7UOI 182 | 7WMY 183 | 8AA9 184 | 8ISZ 185 | 8EXA 186 | 8E7F 187 | 8B2S 188 | 8TP8 189 | 8GSY 190 | 7XRX 191 | 8SY3 192 | 8CIL 193 | 8WBR 194 | 7XF1 195 | 7YPO 196 | 8AXF 197 | 7QNL 198 | 8OYY 199 | 7R1N 200 | 8H5S 201 | 8B6U 202 | 8IBX 203 | 8Q43 204 | 8OW8 205 | 7XSG 206 | 8U0M 207 | 8IOO 208 | 8HR5 209 | 8BVK 210 | 8P0C 211 | 7TL6 212 | 8J48 213 | 8S0U 214 | 8K8A 215 | 8G53 216 | 7XYO 217 | 8POF 218 | 8U1K 219 | 8HF2 220 | 8K4L 221 | 8JAH 222 | 8KGZ 223 | 8BNB 224 | 7UG2 225 | 8A0A 226 | 8Q3Z 227 | 8XBI 228 | 8JNM 229 | 8GPS 230 | 8K1R 231 | 8Q66 232 | 7YLQ 233 | 7YNX 234 | 8IMD 235 | 7Y8H 236 | 8OXU 237 | 8BVE 238 | 8B4E 239 | 8V14 240 | 7R5I 241 | 8IR2 242 | 8UK7 243 | 8EBB 244 | 7XCC 245 | 8AEP 246 | 7YDW 247 | 8XX9 248 | 7VS6 249 | 8K3F 250 | 8CQM 251 | 7XH4 252 | 8BH9 253 | 7VXT 254 | 8SM9 255 | 8HGU 256 | 8PSQ 257 | 8SSU 258 | 8VXA 259 | 8GSX 260 | 8GHZ 261 | 8BJ3 262 | 8C9V 263 | 8T66 264 | 7XPC 265 | 8RH3 266 | 8CMQ 267 | 8AGG 268 | 8ERM 269 | 8P6M 270 | 8BUX 271 | 7S2J 272 | 8G32 273 | 8AXJ 274 | 8CID 275 | 8CPK 276 | 8P5Q 277 | 8HP8 278 | 7YUJ 279 | 8PT2 280 | 7YK3 281 | 7YYG 282 | 8ABV 283 | 7XL7 284 | 7YLZ 285 | 8JWS 286 | 8IW5 287 | 8SM6 288 | 8BBZ 289 | 8EOV 290 | 8PXC 291 | 7UWV 292 | 8A9N 293 | 7YH5 294 | 8DEO 295 | 7X2X 296 | 8W7P 297 | 8B5W 298 | 8CIH 299 | 8RB4 300 | 8HLG 301 | 8J8H 302 | 8UA5 303 | 7YKM 304 | 8S9W 305 | 7YPD 306 | 8GA6 307 | 7YPQ 308 | 8X7X 309 | 8HI8 310 | 8H7A 311 | 8C4D 312 | 8XAT 313 | 8W8S 314 | 8HM4 315 | 8H3Z 316 | 7W91 317 | 8GPP 318 | 8TNM 319 | 7YSI 320 | 8OML 321 | 8BBR 322 | 7YOJ 323 | 8JZX 324 | 8I3X 325 | 8AU6 326 | 8ITO 327 | 7SFY 328 | 8B6P 329 | 7Y8S 330 | 8ESL 331 | 8DSP 332 | 8CLZ 333 | 8F72 334 | 8QLD 335 | 8K86 336 | 8G8E 337 | 8QDO 338 | 8ANU 339 | 8PT6 340 | 8F5D 341 | 8DQ6 342 | 8IFK 343 | 8OJN 344 | 8SSC 345 | 7QRR 346 | 8E55 347 | 7TPU 348 | 7UQU 349 | 8HFP 350 | 7XGT 351 | 8A39 352 | 8CB2 353 | 8ACR 354 | 8G5S 355 | 7TZL 356 | 8T4R 357 | 8H18 358 | 7UI4 359 | 8Q41 360 | 8K76 361 | 7WUY 362 | 8VXC 363 | 8GYG 364 | 8IMS 365 | 8IKS 366 | 8X51 367 | 7Y7O 368 | 8PX4 369 | 8BF8 370 | 7XMJ 371 | 8GDW 372 | 7YTU 373 | 8CH4 374 | 7XHZ 375 | 7YH4 376 | 8PSN 377 | 8A16 378 | 8FBJ 379 | 7Y9G 380 | 8JI2 381 | 7YR9 382 | 8SW0 383 | 8A90 384 | 8X6V 385 | 8H8P 386 | 7WJU 387 | 8PSS 388 | 8HL8 389 | 8FJD 390 | 8PM4 391 | 7UK8 392 | 8DX0 393 | 8PHB 394 | 8FBN 395 | 8FXF 396 | 8GKH 397 | 8ENR 398 | 8PTH 399 | 8CBV 400 | 8GKV 401 | 8CQO 402 | 8OK3 403 | 8GSR 404 | 8TPK 405 | 8H1J 406 | 8QFL 407 | 8CHW 408 | 7V34 409 | 8HE2 410 | 7ZIE 411 | 8A50 412 | 7Z8E 413 | 8ILL 414 | 7WWC 415 | 7XVI 416 | 8Q2A 417 | 8HNO 418 | 8PR6 419 | 7XCA 420 | 7XGS 421 | 8H55 422 | 8FJE 423 | 7UNH 424 | 8AY2 425 | 8ARD 426 | 8HBR 427 | 8EWG 428 | 8D4A 429 | 8FIT 430 | 8E5E 431 | 8PMU 432 | 8F5G 433 | 8AMU 434 | 8CPN 435 | 7QPL 436 | 8EHN 437 | 8SQU 438 | 8F70 439 | 8FX9 440 | 7UR2 441 | 8T1M 442 | 7ZDS 443 | 7YH2 444 | 8B6A 445 | 8CHX 446 | 8G0N 447 | 8GY4 448 | 7YKG 449 | 8BH8 450 | 8BVI 451 | 7XF2 452 | 8BFY 453 | 8IA3 454 | 8JW3 455 | 8OQJ 456 | 8TFS 457 | 7Y1S 458 | 8HBB 459 | 8AF9 460 | 8IP1 461 | 7XZ3 462 | 8T0P 463 | 7Y16 464 | 8BRP 465 | 8JNX 466 | 8JP0 467 | 8EC3 468 | 8PZH 469 | 7URP 470 | 8B4D 471 | 8JFR 472 | 8GYR 473 | 7XFS 474 | 8SMQ 475 | 7WNH 476 | 8H0L 477 | 8OWI 478 | 8HFC 479 | 7X6G 480 | 8FKL 481 | 8PAG 482 | 8UPI 483 | 8D4B 484 | 8BCK 485 | 8JFU 486 | 8FUQ 487 | 8IF8 488 | 8PAQ 489 | 8HDU 490 | 8W9O 491 | 8ACA 492 | 7YIA 493 | 7ZFR 494 | 7Y9A 495 | 8TTO 496 | 7YFX 497 | 8B2H 498 | 8PSU 499 | 8ACC 500 | 8JMR 501 | 8IHA 502 | 7UYX 503 | 8DWJ 504 | 8BY5 505 | 8EZW 506 | 8A82 507 | 8TVL 508 | 8R79 509 | 8R8A 510 | 8AHZ 511 | 8AYV 512 | 8JHU 513 | 8Q44 514 | 8ARE 515 | 8OLJ 516 | 7Y95 517 | 7XP0 518 | 8EX9 519 | 8BID 520 | 8Q40 521 | 7QSJ 522 | 7UBA 523 | 7XFU 524 | 8OU1 525 | 8G2V 526 | 8YA7 527 | 8GMZ 528 | 8T8L 529 | 8CK0 530 | 7Y4H 531 | 8IOM 532 | 7ZLQ 533 | 8BZ2 534 | 8B4C 535 | 8DZJ 536 | 8CEG 537 | 8IBY 538 | 8T3J 539 | 8IVI 540 | 8ITN 541 | 8CR7 542 | 8TGH 543 | 8OKH 544 | 7UI8 545 | 8EHT 546 | 8ADC 547 | 8T4C 548 | 7XBJ 549 | 8CLU 550 | 7QA1 551 | -------------------------------------------------------------------------------- /src/boltz/model/layers/triangular_attention/attention.py: -------------------------------------------------------------------------------- 1 | # Copyright 2021 AlQuraishi Laboratory 2 | # Copyright 2021 DeepMind Technologies Limited 3 | # 4 | # Licensed under the Apache License, Version 2.0 (the "License"); 5 | # you may not use this file except in compliance with the License. 6 | # You may obtain a copy of the License at 7 | # 8 | # http://www.apache.org/licenses/LICENSE-2.0 9 | # 10 | # Unless required by applicable law or agreed to in writing, software 11 | # distributed under the License is distributed on an "AS IS" BASIS, 12 | # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. 13 | # See the License for the specific language governing permissions and 14 | # limitations under the License. 15 | 16 | from functools import partial, partialmethod 17 | from typing import List, Optional 18 | 19 | import torch 20 | import torch.nn as nn 21 | 22 | from boltz.model.layers.triangular_attention.primitives import ( 23 | Attention, 24 | LayerNorm, 25 | Linear, 26 | ) 27 | from boltz.model.layers.triangular_attention.utils import ( 28 | chunk_layer, 29 | permute_final_dims, 30 | ) 31 | 32 | 33 | class TriangleAttention(nn.Module): 34 | def __init__(self, c_in, c_hidden, no_heads, starting=True, inf=1e9): 35 | """ 36 | Args: 37 | c_in: 38 | Input channel dimension 39 | c_hidden: 40 | Overall hidden channel dimension (not per-head) 41 | no_heads: 42 | Number of attention heads 43 | """ 44 | super(TriangleAttention, self).__init__() 45 | 46 | self.c_in = c_in 47 | self.c_hidden = c_hidden 48 | self.no_heads = no_heads 49 | self.starting = starting 50 | self.inf = inf 51 | 52 | self.layer_norm = LayerNorm(self.c_in) 53 | 54 | self.linear = Linear(c_in, self.no_heads, bias=False, init="normal") 55 | 56 | self.mha = Attention( 57 | self.c_in, self.c_in, self.c_in, self.c_hidden, self.no_heads 58 | ) 59 | 60 | @torch.jit.ignore 61 | def _chunk( 62 | self, 63 | x: torch.Tensor, 64 | biases: List[torch.Tensor], 65 | chunk_size: int, 66 | use_memory_efficient_kernel: bool = False, 67 | use_deepspeed_evo_attention: bool = False, 68 | use_lma: bool = False, 69 | use_trifast: bool = False, 70 | inplace_safe: bool = False, 71 | ) -> torch.Tensor: 72 | """triangle! triangle!""" 73 | mha_inputs = { 74 | "q_x": x, 75 | "kv_x": x, 76 | "biases": biases, 77 | } 78 | 79 | return chunk_layer( 80 | partial( 81 | self.mha, 82 | use_memory_efficient_kernel=use_memory_efficient_kernel, 83 | use_deepspeed_evo_attention=use_deepspeed_evo_attention, 84 | use_lma=use_lma, 85 | use_trifast=use_trifast, 86 | ), 87 | mha_inputs, 88 | chunk_size=chunk_size, 89 | no_batch_dims=len(x.shape[:-2]), 90 | _out=x if inplace_safe else None, 91 | ) 92 | 93 | def forward( 94 | self, 95 | x: torch.Tensor, 96 | mask: Optional[torch.Tensor] = None, 97 | chunk_size: Optional[int] = None, 98 | use_memory_efficient_kernel: bool = False, 99 | use_deepspeed_evo_attention: bool = False, 100 | use_lma: bool = False, 101 | use_trifast: bool = False, 102 | inplace_safe: bool = False, 103 | ) -> torch.Tensor: 104 | """ 105 | Args: 106 | x: 107 | [*, I, J, C_in] input tensor (e.g. the pair representation) 108 | 109 | Returns 110 | ------- 111 | [*, I, J, C_in] output tensor 112 | """ 113 | if mask is None: 114 | # [*, I, J] 115 | mask = x.new_ones( 116 | x.shape[:-1], 117 | ) 118 | 119 | if not self.starting: 120 | x = x.transpose(-2, -3) 121 | mask = mask.transpose(-1, -2) 122 | 123 | # [*, I, J, C_in] 124 | x = self.layer_norm(x) 125 | 126 | # [*, I, 1, 1, J] 127 | mask_bias = (self.inf * (mask - 1))[..., :, None, None, :] 128 | 129 | # [*, H, I, J] 130 | triangle_bias = permute_final_dims(self.linear(x), (2, 0, 1)) 131 | 132 | # [*, 1, H, I, J] 133 | triangle_bias = triangle_bias.unsqueeze(-4) 134 | 135 | biases = [mask_bias, triangle_bias] 136 | 137 | if chunk_size is not None and not use_trifast: 138 | x = self._chunk( 139 | x, 140 | biases, 141 | chunk_size, 142 | use_memory_efficient_kernel=use_memory_efficient_kernel, 143 | use_deepspeed_evo_attention=use_deepspeed_evo_attention, 144 | use_lma=use_lma, 145 | use_trifast=use_trifast, 146 | inplace_safe=inplace_safe, 147 | ) 148 | else: 149 | x = self.mha( 150 | x, 151 | x, 152 | biases, 153 | use_memory_efficient_kernel=use_memory_efficient_kernel, 154 | use_deepspeed_evo_attention=use_deepspeed_evo_attention, 155 | use_lma=use_lma, 156 | use_trifast=use_trifast, 157 | ) 158 | 159 | if not self.starting: 160 | x = x.transpose(-2, -3) 161 | 162 | return x 163 | 164 | 165 | # Implements Algorithm 13 166 | TriangleAttentionStartingNode = TriangleAttention 167 | 168 | 169 | class TriangleAttentionEndingNode(TriangleAttention): 170 | """Implement Algorithm 14.""" 171 | 172 | __init__ = partialmethod(TriangleAttention.__init__, starting=False) 173 | -------------------------------------------------------------------------------- /src/boltz/model/loss/diffusion.py: -------------------------------------------------------------------------------- 1 | # started from code from https://github.com/lucidrains/alphafold3-pytorch, MIT License, Copyright (c) 2024 Phil Wang 2 | 3 | from einops import einsum 4 | import torch 5 | import torch.nn.functional as F 6 | 7 | 8 | def weighted_rigid_align( 9 | true_coords, 10 | pred_coords, 11 | weights, 12 | mask, 13 | ): 14 | """Compute weighted alignment. 15 | 16 | Parameters 17 | ---------- 18 | true_coords: torch.Tensor 19 | The ground truth atom coordinates 20 | pred_coords: torch.Tensor 21 | The predicted atom coordinates 22 | weights: torch.Tensor 23 | The weights for alignment 24 | mask: torch.Tensor 25 | The atoms mask 26 | 27 | Returns 28 | ------- 29 | torch.Tensor 30 | Aligned coordinates 31 | 32 | """ 33 | 34 | batch_size, num_points, dim = true_coords.shape 35 | weights = (mask * weights).unsqueeze(-1) 36 | 37 | # Compute weighted centroids 38 | true_centroid = (true_coords * weights).sum(dim=1, keepdim=True) / weights.sum( 39 | dim=1, keepdim=True 40 | ) 41 | pred_centroid = (pred_coords * weights).sum(dim=1, keepdim=True) / weights.sum( 42 | dim=1, keepdim=True 43 | ) 44 | 45 | # Center the coordinates 46 | true_coords_centered = true_coords - true_centroid 47 | pred_coords_centered = pred_coords - pred_centroid 48 | 49 | if num_points < (dim + 1): 50 | print( 51 | "Warning: The size of one of the point clouds is <= dim+1. " 52 | + "`WeightedRigidAlign` cannot return a unique rotation." 53 | ) 54 | 55 | # Compute the weighted covariance matrix 56 | cov_matrix = einsum( 57 | weights * pred_coords_centered, true_coords_centered, "b n i, b n j -> b i j" 58 | ) 59 | 60 | # Compute the SVD of the covariance matrix, required float32 for svd and determinant 61 | original_dtype = cov_matrix.dtype 62 | cov_matrix_32 = cov_matrix.to(dtype=torch.float32) 63 | U, S, V = torch.linalg.svd( 64 | cov_matrix_32, driver="gesvd" if cov_matrix_32.is_cuda else None 65 | ) 66 | V = V.mH 67 | 68 | # Catch ambiguous rotation by checking the magnitude of singular values 69 | if (S.abs() <= 1e-15).any() and not (num_points < (dim + 1)): 70 | print( 71 | "Warning: Excessively low rank of " 72 | + "cross-correlation between aligned point clouds. " 73 | + "`WeightedRigidAlign` cannot return a unique rotation." 74 | ) 75 | 76 | # Compute the rotation matrix 77 | rot_matrix = torch.einsum("b i j, b k j -> b i k", U, V).to(dtype=torch.float32) 78 | 79 | # Ensure proper rotation matrix with determinant 1 80 | F = torch.eye(dim, dtype=cov_matrix_32.dtype, device=cov_matrix.device)[ 81 | None 82 | ].repeat(batch_size, 1, 1) 83 | F[:, -1, -1] = torch.det(rot_matrix) 84 | rot_matrix = einsum(U, F, V, "b i j, b j k, b l k -> b i l") 85 | rot_matrix = rot_matrix.to(dtype=original_dtype) 86 | 87 | # Apply the rotation and translation 88 | aligned_coords = ( 89 | einsum(true_coords_centered, rot_matrix, "b n i, b j i -> b n j") 90 | + pred_centroid 91 | ) 92 | aligned_coords.detach_() 93 | 94 | return aligned_coords 95 | 96 | 97 | def smooth_lddt_loss( 98 | pred_coords, 99 | true_coords, 100 | is_nucleotide, 101 | coords_mask, 102 | nucleic_acid_cutoff: float = 30.0, 103 | other_cutoff: float = 15.0, 104 | multiplicity: int = 1, 105 | ): 106 | """Compute weighted alignment. 107 | 108 | Parameters 109 | ---------- 110 | pred_coords: torch.Tensor 111 | The predicted atom coordinates 112 | true_coords: torch.Tensor 113 | The ground truth atom coordinates 114 | is_nucleotide: torch.Tensor 115 | The weights for alignment 116 | coords_mask: torch.Tensor 117 | The atoms mask 118 | nucleic_acid_cutoff: float 119 | The nucleic acid cutoff 120 | other_cutoff: float 121 | The non nucleic acid cutoff 122 | multiplicity: int 123 | The multiplicity 124 | Returns 125 | ------- 126 | torch.Tensor 127 | Aligned coordinates 128 | 129 | """ 130 | B, N, _ = true_coords.shape 131 | true_dists = torch.cdist(true_coords, true_coords) 132 | is_nucleotide = is_nucleotide.repeat_interleave(multiplicity, 0) 133 | 134 | coords_mask = coords_mask.repeat_interleave(multiplicity, 0) 135 | is_nucleotide_pair = is_nucleotide.unsqueeze(-1).expand( 136 | -1, -1, is_nucleotide.shape[-1] 137 | ) 138 | 139 | mask = ( 140 | is_nucleotide_pair * (true_dists < nucleic_acid_cutoff).float() 141 | + (1 - is_nucleotide_pair) * (true_dists < other_cutoff).float() 142 | ) 143 | mask = mask * (1 - torch.eye(pred_coords.shape[1], device=pred_coords.device)) 144 | mask = mask * (coords_mask.unsqueeze(-1) * coords_mask.unsqueeze(-2)) 145 | 146 | # Compute distances between all pairs of atoms 147 | pred_dists = torch.cdist(pred_coords, pred_coords) 148 | dist_diff = torch.abs(true_dists - pred_dists) 149 | 150 | # Compute epsilon values 151 | eps = ( 152 | ( 153 | ( 154 | F.sigmoid(0.5 - dist_diff) 155 | + F.sigmoid(1.0 - dist_diff) 156 | + F.sigmoid(2.0 - dist_diff) 157 | + F.sigmoid(4.0 - dist_diff) 158 | ) 159 | / 4.0 160 | ) 161 | .view(multiplicity, B // multiplicity, N, N) 162 | .mean(dim=0) 163 | ) 164 | 165 | # Calculate masked averaging 166 | eps = eps.repeat_interleave(multiplicity, 0) 167 | num = (eps * mask).sum(dim=(-1, -2)) 168 | den = mask.sum(dim=(-1, -2)).clamp(min=1) 169 | lddt = num / den 170 | 171 | return 1.0 - lddt.mean() 172 | -------------------------------------------------------------------------------- /scripts/train/assets/validation_ids.txt: -------------------------------------------------------------------------------- 1 | 7UTN 2 | 7F9H 3 | 7TZV 4 | 7ZHH 5 | 7SOV 6 | 7EOF 7 | 7R8H 8 | 8AW3 9 | 7F2F 10 | 8BAO 11 | 7BCB 12 | 7D8T 13 | 7D3T 14 | 7BHY 15 | 7YZ7 16 | 8DC2 17 | 7SOW 18 | 8CTL 19 | 7SOS 20 | 7V6W 21 | 7Z55 22 | 7NQF 23 | 7VTN 24 | 7KSP 25 | 7BJQ 26 | 7YZC 27 | 7Y3L 28 | 7TDX 29 | 7R8I 30 | 7OYK 31 | 7TZ1 32 | 7KIJ 33 | 7T8K 34 | 7KII 35 | 7YZA 36 | 7VP4 37 | 7KIK 38 | 7M5W 39 | 7Q94 40 | 7BCA 41 | 7YZB 42 | 7OG0 43 | 7VTI 44 | 7SOP 45 | 7S03 46 | 7YZG 47 | 7TXC 48 | 7VP5 49 | 7Y3I 50 | 7TDW 51 | 8B0R 52 | 7R8G 53 | 7FEF 54 | 7VP1 55 | 7VP3 56 | 7RGU 57 | 7DV2 58 | 7YZD 59 | 7OFZ 60 | 7Y3K 61 | 7TEC 62 | 7WQ5 63 | 7VP2 64 | 7EDB 65 | 7VP7 66 | 7PDV 67 | 7XHT 68 | 7R6R 69 | 8CSH 70 | 8CSZ 71 | 7V9O 72 | 7Q1C 73 | 8EDC 74 | 7PWI 75 | 7FI1 76 | 7ESI 77 | 7F0Y 78 | 7EYR 79 | 7ZVA 80 | 7WEG 81 | 7E4N 82 | 7U5Q 83 | 7FAV 84 | 7LJ2 85 | 7S6F 86 | 7B3N 87 | 7V4P 88 | 7AJO 89 | 7WH1 90 | 8DQP 91 | 7STT 92 | 7VQ7 93 | 7E4J 94 | 7RIS 95 | 7FH8 96 | 7BMW 97 | 7RD0 98 | 7V54 99 | 7LKC 100 | 7OU1 101 | 7QOD 102 | 7PX1 103 | 7EBY 104 | 7U1V 105 | 7PLP 106 | 7T8N 107 | 7SJK 108 | 7RGB 109 | 7TEM 110 | 7UG9 111 | 7B7A 112 | 7TM2 113 | 7Z74 114 | 7PCM 115 | 7V8G 116 | 7EUU 117 | 7VTL 118 | 7ZEI 119 | 7ZC0 120 | 7DZ9 121 | 8B2M 122 | 7NE9 123 | 7ALV 124 | 7M96 125 | 7O6T 126 | 7SKO 127 | 7Z2V 128 | 7OWX 129 | 7SHW 130 | 7TNI 131 | 7ZQY 132 | 7MDF 133 | 7EXR 134 | 7W6B 135 | 7EQF 136 | 7WWO 137 | 7FBW 138 | 8EHE 139 | 7CLE 140 | 7T80 141 | 7WMV 142 | 7SMG 143 | 7WSJ 144 | 7DBU 145 | 7VHY 146 | 7W5F 147 | 7SHG 148 | 7VU3 149 | 7ATH 150 | 7FGZ 151 | 7ADS 152 | 7REO 153 | 7T7H 154 | 7X0N 155 | 7TCU 156 | 7SKH 157 | 7EF6 158 | 7TBV 159 | 7B29 160 | 7VO5 161 | 7TM1 162 | 7QLD 163 | 7BB9 164 | 7SZ8 165 | 7RLM 166 | 7WWP 167 | 7NBV 168 | 7PLD 169 | 7DNM 170 | 7SFZ 171 | 7EAW 172 | 7QNQ 173 | 7SZX 174 | 7U2S 175 | 7WZX 176 | 7TYG 177 | 7QCE 178 | 7DCN 179 | 7WJL 180 | 7VV6 181 | 7TJ4 182 | 7VI8 183 | 8AKP 184 | 7WAO 185 | 7N7V 186 | 7EYO 187 | 7VTD 188 | 7VEG 189 | 7QY5 190 | 7ELV 191 | 7P0J 192 | 7YX8 193 | 7U4H 194 | 7TBD 195 | 7WME 196 | 7RI3 197 | 7TOH 198 | 7ZVM 199 | 7PUL 200 | 7VBO 201 | 7DM0 202 | 7XN9 203 | 7ALY 204 | 7LTB 205 | 8A28 206 | 7UBZ 207 | 8DTE 208 | 7TA2 209 | 7QST 210 | 7AN1 211 | 7FIB 212 | 8BAL 213 | 7TMJ 214 | 7REV 215 | 7PZJ 216 | 7T9X 217 | 7SUU 218 | 7KJQ 219 | 7V6P 220 | 7QA3 221 | 7ULC 222 | 7Y3X 223 | 7TMU 224 | 7OA7 225 | 7PO9 226 | 7Q20 227 | 8H2C 228 | 7VW1 229 | 7VLJ 230 | 8EP4 231 | 7P57 232 | 7QUL 233 | 7ZQE 234 | 7UJU 235 | 7WG1 236 | 7DMK 237 | 7Y8X 238 | 7EHG 239 | 7W13 240 | 7NL4 241 | 7R4J 242 | 7AOV 243 | 7RFT 244 | 7VUF 245 | 7F72 246 | 8DSR 247 | 7MK3 248 | 7MQQ 249 | 7R55 250 | 7T85 251 | 7NCY 252 | 7ZHL 253 | 7E1N 254 | 7W8F 255 | 7PGK 256 | 8GUN 257 | 7P8D 258 | 7PUK 259 | 7N9D 260 | 7XWN 261 | 7ZHA 262 | 7TVP 263 | 7VI6 264 | 7PW6 265 | 7YM0 266 | 7RWK 267 | 8DKR 268 | 7WGU 269 | 7LJI 270 | 7THW 271 | 7OB6 272 | 7N3Z 273 | 7T3S 274 | 7PAB 275 | 7F9F 276 | 7PPP 277 | 7AD5 278 | 7VGM 279 | 7WBO 280 | 7RWM 281 | 7QFI 282 | 7T91 283 | 7ANU 284 | 7UX0 285 | 7USR 286 | 7RDN 287 | 7VW5 288 | 7Q4T 289 | 7W3R 290 | 8DKQ 291 | 7RCX 292 | 7UOF 293 | 7OKR 294 | 7NX1 295 | 6ZBS 296 | 7VEV 297 | 8E8U 298 | 7WJ6 299 | 7MP4 300 | 7RPY 301 | 7R5Z 302 | 7VLM 303 | 7SNE 304 | 7WDW 305 | 8E19 306 | 7PP2 307 | 7Z5H 308 | 7P7I 309 | 7LJJ 310 | 7QPC 311 | 7VJS 312 | 7QOE 313 | 7KZH 314 | 7F6N 315 | 7TMI 316 | 7POH 317 | 8DKS 318 | 7YMO 319 | 6S5I 320 | 7N6O 321 | 7LYU 322 | 7POK 323 | 7BLK 324 | 7TCY 325 | 7W19 326 | 8B55 327 | 7SMU 328 | 7QFK 329 | 7T5T 330 | 7EPQ 331 | 7DCK 332 | 7S69 333 | 6ZSV 334 | 7ZGT 335 | 7TJ1 336 | 7V09 337 | 7ZHD 338 | 7ALL 339 | 7P1Y 340 | 7T71 341 | 7MNK 342 | 7W5Q 343 | 7PZ2 344 | 7QSQ 345 | 7QI3 346 | 7NZZ 347 | 7Q47 348 | 8D08 349 | 7QH5 350 | 7RXQ 351 | 7F45 352 | 8D07 353 | 8EHC 354 | 7PZT 355 | 7K3C 356 | 7ZGI 357 | 7MC4 358 | 7NPQ 359 | 7VD7 360 | 7XAN 361 | 7FDP 362 | 8A0K 363 | 7TXO 364 | 7ZB1 365 | 7V5V 366 | 7WWS 367 | 7PBK 368 | 8EBG 369 | 7N0J 370 | 7UMA 371 | 7T1S 372 | 8EHB 373 | 7DWC 374 | 7K6W 375 | 7WEJ 376 | 7LRH 377 | 7ZCV 378 | 7RKC 379 | 7X8C 380 | 7PV1 381 | 7UGK 382 | 7ULN 383 | 7A66 384 | 7R7M 385 | 7M0Q 386 | 7BGS 387 | 7UPP 388 | 7O62 389 | 7VKK 390 | 7L6Y 391 | 7VG4 392 | 7V2V 393 | 7ETN 394 | 7ZTB 395 | 7AOO 396 | 7OH2 397 | 7E0M 398 | 7PEG 399 | 8CUK 400 | 7ZP0 401 | 7T6A 402 | 7BTM 403 | 7DOV 404 | 7VVV 405 | 7P22 406 | 7RUO 407 | 7E40 408 | 7O5Y 409 | 7XPK 410 | 7R0K 411 | 8D04 412 | 7TYD 413 | 7LSV 414 | 7XSI 415 | 7RTZ 416 | 7UXR 417 | 7QH3 418 | 8END 419 | 8CYK 420 | 7MRJ 421 | 7DJL 422 | 7S5B 423 | 7XUX 424 | 7EV8 425 | 7R6S 426 | 7UH4 427 | 7R9X 428 | 7F7P 429 | 7ACW 430 | 7SPN 431 | 7W70 432 | 7Q5G 433 | 7DXN 434 | 7DK9 435 | 8DT0 436 | 7FDN 437 | 7DGX 438 | 7UJB 439 | 7X4O 440 | 7F4O 441 | 7T9W 442 | 8AID 443 | 7ERQ 444 | 7EQB 445 | 7YDG 446 | 7ETR 447 | 8D27 448 | 7OUU 449 | 7R5Y 450 | 7T8I 451 | 7UZT 452 | 7X8V 453 | 7QLH 454 | 7SAF 455 | 7EN6 456 | 8D4Y 457 | 7ESJ 458 | 7VWO 459 | 7SBE 460 | 7VYU 461 | 7RVJ 462 | 7FCL 463 | 7WUO 464 | 7WWF 465 | 7VMT 466 | 7SHJ 467 | 7SKP 468 | 7KOU 469 | 6ZSU 470 | 7VGW 471 | 7X45 472 | 8GYZ 473 | 8BFE 474 | 8DGL 475 | 7Z3H 476 | 8BD1 477 | 8A0J 478 | 7JRK 479 | 7QII 480 | 7X39 481 | 7Y6B 482 | 7OIY 483 | 7SBI 484 | 8A3I 485 | 7NLI 486 | 7F4U 487 | 7TVY 488 | 7X0O 489 | 7VMH 490 | 7EPN 491 | 7WBK 492 | 8BFJ 493 | 7XFP 494 | 7LXQ 495 | 7TIL 496 | 7O61 497 | 8B8B 498 | 7W2Q 499 | 8APR 500 | 7WZE 501 | 7NYQ 502 | 7RMX 503 | 7PGE 504 | 8F43 505 | 7N2K 506 | 7UXG 507 | 7SXN 508 | 7T5U 509 | 7R22 510 | 7E3T 511 | 7PTB 512 | 7OA8 513 | 7X5T 514 | 7PL7 515 | 7SQ5 516 | 7VBS 517 | 8D03 518 | 7TAE 519 | 7T69 520 | 7WF6 521 | 7LBU 522 | 8A06 523 | 8DA2 524 | 7QFL 525 | 7KUW 526 | 7X9R 527 | 7XT3 528 | 7RB4 529 | 7PT5 530 | 7RPS 531 | 7RXU 532 | 7TDY 533 | 7W89 534 | 7N9I 535 | 7T1M 536 | 7OBM 537 | 7K3X 538 | 7ZJC 539 | 8BDP 540 | 7V8W 541 | 7DJK 542 | 7W1K 543 | 7QFG 544 | 7DGY 545 | 7ZTQ 546 | 7F8A 547 | 7NEK 548 | 7CG9 549 | 7KOB 550 | 7TN7 551 | 8DYS 552 | 7WVR 553 | -------------------------------------------------------------------------------- /scripts/process/run_pdb_parser.py: -------------------------------------------------------------------------------- 1 | #!/usr/bin/env python 2 | """Test script for PDB parser implementation.""" 3 | 4 | import argparse 5 | import json 6 | import traceback 7 | from dataclasses import asdict, replace 8 | from pathlib import Path 9 | import pickle 10 | import sys 11 | import os 12 | 13 | import numpy as np 14 | 15 | # Add script directory to path so imports work when run as a script 16 | script_dir = os.path.dirname(os.path.abspath(__file__)) 17 | sys.path.insert(0, script_dir) 18 | 19 | # Import the custom PDB parser 20 | from pdb import parse_pdb 21 | from rcsb import Resource, PDB, parse 22 | 23 | from boltz.data.filter.static.filter import StaticFilter 24 | from boltz.data.filter.static.ligand import ExcludedLigands 25 | from boltz.data.filter.static.polymer import ( 26 | ClashingChainsFilter, 27 | ConsecutiveCA, 28 | MinimumLengthFilter, 29 | UnknownFilter, 30 | ) 31 | 32 | def main(): 33 | """Run the test script.""" 34 | parser = argparse.ArgumentParser(description="Test PDB parser") 35 | parser.add_argument("--pdb-file", type=str, required=True, help="Path to PDB file to parse") 36 | parser.add_argument("--output-dir", type=Path, default=Path("./output"), help="Output directory") 37 | parser.add_argument("--cluster-file", type=str, help="Path to cluster information JSON file") 38 | parser.add_argument("--min-length", type=int, default=30, help="Min chain length") 39 | parser.add_argument("--excluded-ligands", type=str, help="Excluded ligands") 40 | parser.add_argument("--redis-host", type=str, default="localhost", help="Redis host") 41 | parser.add_argument("--redis-port", type=int, default=7777, help="Redis port") 42 | parser.add_argument("--force", action="store_true", help="Force reprocessing even if output files exist") 43 | 44 | args = parser.parse_args() 45 | 46 | # Create output directories 47 | args.output_dir.mkdir(parents=True, exist_ok=True) 48 | records_dir = args.output_dir / "records" 49 | records_dir.mkdir(parents=True, exist_ok=True) 50 | structure_dir = args.output_dir / "structures" 51 | structure_dir.mkdir(parents=True, exist_ok=True) 52 | 53 | # Setup resource using the provided Redis connection parameters 54 | resource = Resource(host=args.redis_host, port=args.redis_port) 55 | 56 | # Load clusters from JSON file if provided 57 | clusters = {} 58 | if args.cluster_file is not None: 59 | try: 60 | with open(args.cluster_file, "r") as f: 61 | cluster_data = json.load(f)["clusters"] 62 | for entity_id, cluster_id in cluster_data.items(): 63 | clusters[entity_id] = int(cluster_id) 64 | print(f"Loaded {len(clusters)} clusters from {args.cluster_file}") 65 | except Exception as e: 66 | print(f"Warning: Failed to load cluster file: {e}") 67 | 68 | # Create PDB object 69 | pdb_file = Path(args.pdb_file) 70 | file_format = "pdb" if pdb_file.suffix.lower() == ".pdb" else "mmcif" 71 | data = PDB(id=pdb_file.stem.lower(), path=str(pdb_file), format=file_format) 72 | 73 | # Create filters 74 | filters = [ 75 | UnknownFilter(), 76 | MinimumLengthFilter(min_len=args.min_length), 77 | ConsecutiveCA(), 78 | ClashingChainsFilter(), 79 | ] 80 | 81 | if args.excluded_ligands: 82 | try: 83 | excluded_file = Path(args.excluded_ligands) 84 | with excluded_file.open("r") as f: 85 | excluded = json.load(f) 86 | filters.append(ExcludedLigands(excluded=excluded)) 87 | print(f"Loaded excluded ligands from {args.excluded_ligands}") 88 | except Exception as e: 89 | print(f"Warning: Failed to load excluded ligands: {e}") 90 | 91 | # Check if we need to process 92 | struct_path = structure_dir / f"{data.id}.npz" 93 | record_path = records_dir / f"{data.id}.json" 94 | 95 | if struct_path.exists() and record_path.exists() and not args.force: 96 | print(f"Files already exist: {struct_path} and {record_path}") 97 | print("Use --force to reprocess") 98 | return 99 | 100 | print(f"Processing file: {args.pdb_file}") 101 | 102 | try: 103 | # Parse the target 104 | target = parse(data, resource, clusters) 105 | structure = target.structure 106 | 107 | # Apply the filters 108 | mask = structure.mask 109 | if filters is not None: 110 | for f in filters: 111 | filter_mask = f.filter(structure) 112 | mask = mask & filter_mask 113 | except Exception: 114 | traceback.print_exc() 115 | print(f"Failed to parse {data.id}") 116 | return 117 | 118 | # Replace chains and interfaces 119 | chains = [] 120 | for i, chain in enumerate(target.record.chains): 121 | chains.append(replace(chain, valid=bool(mask[i]))) 122 | 123 | interfaces = [] 124 | for interface in target.record.interfaces: 125 | chain_1 = bool(mask[interface.chain_1]) 126 | chain_2 = bool(mask[interface.chain_2]) 127 | interfaces.append(replace(interface, valid=(chain_1 and chain_2))) 128 | 129 | # Replace structure and record 130 | structure = replace(structure, mask=mask) 131 | record = replace(target.record, chains=chains, interfaces=interfaces) 132 | target = replace(target, structure=structure, record=record) 133 | 134 | # Dump structure 135 | np.savez_compressed(struct_path, **asdict(structure)) 136 | 137 | # Dump record 138 | with record_path.open("w") as f: 139 | json.dump(asdict(record), f) 140 | 141 | print(f"Successfully processed file: {args.pdb_file}") 142 | print(f"Structure saved to: {struct_path}") 143 | print(f"Record saved to: {record_path}") 144 | 145 | if __name__ == "__main__": 146 | main() -------------------------------------------------------------------------------- /scripts/script_utils/compile_pdb_to_manifest.py: -------------------------------------------------------------------------------- 1 | #!/usr/bin/env python3 2 | """ 3 | Script to run the finalize function on all subdirectories in the parsed_pdb_output directory. 4 | This script directly implements the finalize logic to avoid dependency issues. 5 | Now it accumulates all records into a single manifest.json file. 6 | """ 7 | 8 | import os 9 | import sys 10 | import json 11 | from pathlib import Path 12 | import argparse 13 | from tqdm import tqdm 14 | 15 | def process_and_accumulate_records(base_dir, recursive=False, limit=None): 16 | """ 17 | Process all records in subdirectories and accumulate them into a single list. 18 | 19 | Parameters 20 | ---------- 21 | base_dir : Path 22 | The base directory containing PDB output subdirectories 23 | recursive : bool 24 | Whether to process recursively 25 | limit : int, optional 26 | Limit the number of directories to process 27 | 28 | Returns 29 | ------- 30 | list 31 | List of all processed records 32 | dict 33 | Statistics of processing 34 | """ 35 | # Find all relevant directories 36 | if recursive: 37 | # Find all subdirectories that contain a 'records' folder 38 | processed_dirs = [] 39 | for root, dirs, files in os.walk(base_dir): 40 | root_path = Path(root) 41 | records_dir = root_path / "records" 42 | if records_dir.exists() and records_dir.is_dir(): 43 | processed_dirs.append(root_path) 44 | if limit and len(processed_dirs) >= limit: 45 | break 46 | else: 47 | # Process only immediate subdirectories of the base directory 48 | processed_dirs = [d for d in base_dir.iterdir() if d.is_dir()] 49 | if limit: 50 | processed_dirs = processed_dirs[:limit] 51 | 52 | if not processed_dirs: 53 | print("No directories found to process.") 54 | return [], {"total_dirs": 0, "processed_dirs": 0, "total_records": 0, "failed_records": 0} 55 | 56 | print(f"Found {len(processed_dirs)} directories to process.") 57 | 58 | # Accumulate all records 59 | all_records = [] 60 | total_failed = 0 61 | success_count = 0 62 | 63 | # Process each directory 64 | for directory in tqdm(processed_dirs, desc="Processing directories"): 65 | records_dir = directory / "records" 66 | if not records_dir.exists() or not records_dir.is_dir(): 67 | print(f"No records directory found in {directory}") 68 | continue 69 | 70 | dir_failed = 0 71 | dir_records = [] 72 | 73 | # Process each record in this directory 74 | for record_file in records_dir.iterdir(): 75 | try: 76 | with record_file.open("r") as f: 77 | record_data = json.load(f) 78 | dir_records.append(record_data) 79 | except Exception as e: 80 | dir_failed += 1 81 | print(f"Failed to parse {record_file}: {str(e)}") 82 | 83 | # Add directory records to the global list 84 | all_records.extend(dir_records) 85 | total_failed += dir_failed 86 | 87 | # Report on this directory 88 | if dir_failed > 0: 89 | print(f"Directory {directory.name}: Failed to parse {dir_failed} entries, added {len(dir_records)} entries") 90 | else: 91 | success_count += 1 92 | 93 | stats = { 94 | "total_dirs": len(processed_dirs), 95 | "processed_dirs": success_count, 96 | "total_records": len(all_records), 97 | "failed_records": total_failed 98 | } 99 | 100 | return all_records, stats 101 | 102 | def main(): 103 | parser = argparse.ArgumentParser(description="Run finalize on parsed PDB output directories") 104 | parser.add_argument( 105 | "--base-dir", 106 | type=str, 107 | default="/ist-nas/users/bunditb/boltz/scripts/examples/parsed_pdb_output", 108 | help="Base directory containing PDB output subdirectories" 109 | ) 110 | parser.add_argument( 111 | "--output-file", 112 | type=str, 113 | default=None, # Default to base_dir/manifest.json 114 | help="Path to the output manifest.json file" 115 | ) 116 | parser.add_argument( 117 | "--recursive", 118 | action="store_true", 119 | help="Process recursively (find all subdirectories containing 'records' folder)" 120 | ) 121 | parser.add_argument( 122 | "--limit", 123 | type=int, 124 | default=None, 125 | help="Limit the number of directories to process" 126 | ) 127 | 128 | args = parser.parse_args() 129 | base_dir = Path(args.base_dir) 130 | 131 | if not base_dir.exists(): 132 | print(f"Error: Directory '{base_dir}' does not exist.") 133 | return 1 134 | 135 | print(f"Processing directories in: {base_dir}") 136 | 137 | # Process and accumulate all records 138 | all_records, stats = process_and_accumulate_records(base_dir, args.recursive, args.limit) 139 | 140 | # Determine output file path 141 | if args.output_file: 142 | output_path = Path(args.output_file) 143 | else: 144 | output_path = base_dir / "manifest.json" 145 | 146 | # Save the accumulated records to a single manifest file 147 | with output_path.open("w") as f: 148 | json.dump(all_records, f) 149 | 150 | print(f"\nFinalize Summary:") 151 | print(f" Total directories processed: {stats['total_dirs']}") 152 | print(f" Directories with all records successful: {stats['processed_dirs']}") 153 | print(f" Total records accumulated: {stats['total_records']}") 154 | print(f" Failed records: {stats['failed_records']}") 155 | print(f" Manifest saved to: {output_path}") 156 | 157 | return 0 158 | 159 | if __name__ == "__main__": 160 | sys.exit(main()) -------------------------------------------------------------------------------- /src/boltz/model/modules/confidence_utils.py: -------------------------------------------------------------------------------- 1 | import torch 2 | from torch import nn 3 | 4 | from boltz.data import const 5 | from boltz.model.loss.confidence import compute_frame_pred 6 | 7 | 8 | def compute_aggregated_metric(logits, end=1.0): 9 | """Compute the metric from the logits. 10 | 11 | Parameters 12 | ---------- 13 | logits : torch.Tensor 14 | The logits of the metric 15 | end : float 16 | Max value of the metric, by default 1.0 17 | 18 | Returns 19 | ------- 20 | Tensor 21 | The metric value 22 | 23 | """ 24 | num_bins = logits.shape[-1] 25 | bin_width = end / num_bins 26 | bounds = torch.arange( 27 | start=0.5 * bin_width, end=end, step=bin_width, device=logits.device 28 | ) 29 | probs = nn.functional.softmax(logits, dim=-1) 30 | plddt = torch.sum( 31 | probs * bounds.view(*((1,) * len(probs.shape[:-1])), *bounds.shape), 32 | dim=-1, 33 | ) 34 | return plddt 35 | 36 | 37 | def tm_function(d, Nres): 38 | """Compute the rescaling function for pTM. 39 | 40 | Parameters 41 | ---------- 42 | d : torch.Tensor 43 | The input 44 | Nres : torch.Tensor 45 | The number of residues 46 | 47 | Returns 48 | ------- 49 | Tensor 50 | Output of the function 51 | 52 | """ 53 | d0 = 1.24 * (torch.clip(Nres, min=19) - 15) ** (1 / 3) - 1.8 54 | return 1 / (1 + (d / d0) ** 2) 55 | 56 | 57 | def compute_ptms(logits, x_preds, feats, multiplicity): 58 | """Compute pTM and ipTM scores. 59 | 60 | Parameters 61 | ---------- 62 | logits : torch.Tensor 63 | pae logits 64 | x_preds : torch.Tensor 65 | The predicted coordinates 66 | feats : Dict[str, torch.Tensor] 67 | The input features 68 | multiplicity : int 69 | The batch size of the diffusion roll-out 70 | 71 | Returns 72 | ------- 73 | Tensor 74 | pTM score 75 | Tensor 76 | ipTM score 77 | Tensor 78 | ligand ipTM score 79 | Tensor 80 | protein ipTM score 81 | 82 | """ 83 | # Compute mask for collinear and overlapping tokens 84 | _, mask_collinear_pred = compute_frame_pred( 85 | x_preds, feats["frames_idx"], feats, multiplicity, inference=True 86 | ) 87 | mask_pad = feats["token_pad_mask"].repeat_interleave(multiplicity, 0) 88 | maski = mask_collinear_pred.reshape(-1, mask_collinear_pred.shape[-1]) 89 | pair_mask_ptm = maski[:, :, None] * mask_pad[:, None, :] * mask_pad[:, :, None] 90 | asym_id = feats["asym_id"].repeat_interleave(multiplicity, 0) 91 | pair_mask_iptm = ( 92 | maski[:, :, None] 93 | * (asym_id[:, None, :] != asym_id[:, :, None]) 94 | * mask_pad[:, None, :] 95 | * mask_pad[:, :, None] 96 | ) 97 | 98 | # Extract pae values 99 | num_bins = logits.shape[-1] 100 | bin_width = 32.0 / num_bins 101 | end = 32.0 102 | pae_value = torch.arange( 103 | start=0.5 * bin_width, end=end, step=bin_width, device=logits.device 104 | ).unsqueeze(0) 105 | N_res = mask_pad.sum(dim=-1, keepdim=True) 106 | 107 | # compute pTM and ipTM 108 | tm_value = tm_function(pae_value, N_res).unsqueeze(1).unsqueeze(2) 109 | probs = nn.functional.softmax(logits, dim=-1) 110 | tm_expected_value = torch.sum( 111 | probs * tm_value, 112 | dim=-1, 113 | ) # shape (B, N, N) 114 | ptm = torch.max( 115 | torch.sum(tm_expected_value * pair_mask_ptm, dim=-1) 116 | / (torch.sum(pair_mask_ptm, dim=-1) + 1e-5), 117 | dim=1, 118 | ).values 119 | iptm = torch.max( 120 | torch.sum(tm_expected_value * pair_mask_iptm, dim=-1) 121 | / (torch.sum(pair_mask_iptm, dim=-1) + 1e-5), 122 | dim=1, 123 | ).values 124 | 125 | # compute ligand and protein ipTM 126 | token_type = feats["mol_type"] 127 | token_type = token_type.repeat_interleave(multiplicity, 0) 128 | is_ligand_token = (token_type == const.chain_type_ids["NONPOLYMER"]).float() 129 | is_protein_token = (token_type == const.chain_type_ids["PROTEIN"]).float() 130 | 131 | ligand_iptm_mask = ( 132 | maski[:, :, None] 133 | * (asym_id[:, None, :] != asym_id[:, :, None]) 134 | * mask_pad[:, None, :] 135 | * mask_pad[:, :, None] 136 | * ( 137 | (is_ligand_token[:, :, None] * is_protein_token[:, None, :]) 138 | + (is_protein_token[:, :, None] * is_ligand_token[:, None, :]) 139 | ) 140 | ) 141 | protein_ipmt_mask = ( 142 | maski[:, :, None] 143 | * (asym_id[:, None, :] != asym_id[:, :, None]) 144 | * mask_pad[:, None, :] 145 | * mask_pad[:, :, None] 146 | * (is_protein_token[:, :, None] * is_protein_token[:, None, :]) 147 | ) 148 | 149 | ligand_iptm = torch.max( 150 | torch.sum(tm_expected_value * ligand_iptm_mask, dim=-1) 151 | / (torch.sum(ligand_iptm_mask, dim=-1) + 1e-5), 152 | dim=1, 153 | ).values 154 | protein_iptm = torch.max( 155 | torch.sum(tm_expected_value * protein_ipmt_mask, dim=-1) 156 | / (torch.sum(protein_ipmt_mask, dim=-1) + 1e-5), 157 | dim=1, 158 | ).values 159 | 160 | # Compute pair chain ipTM 161 | chain_pair_iptm = {} 162 | asym_ids_list = torch.unique(asym_id).tolist() 163 | for idx1 in asym_ids_list: 164 | chain_iptm = {} 165 | for idx2 in asym_ids_list: 166 | mask_pair_chain = ( 167 | maski[:, :, None] 168 | * (asym_id[:, None, :] == idx1) 169 | * (asym_id[:, :, None] == idx2) 170 | * mask_pad[:, None, :] 171 | * mask_pad[:, :, None] 172 | ) 173 | 174 | chain_iptm[idx2] = torch.max( 175 | torch.sum(tm_expected_value * mask_pair_chain, dim=-1) 176 | / (torch.sum(mask_pair_chain, dim=-1) + 1e-5), 177 | dim=1, 178 | ).values 179 | chain_pair_iptm[idx1] = chain_iptm 180 | 181 | return ptm, iptm, ligand_iptm, protein_iptm, chain_pair_iptm 182 | --------------------------------------------------------------------------------